TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Caspase-3
UniProt ID CASP3_HUMAN
Gene Name CASP3
Gene ID 836
Synonyms
CASP3, CPP32, CPP32B, SCA-1
Sequence
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Pathway Map MAP LINK
T.C. Number 8.A.217.1.1
KEGG ID hsa836
TTD ID T57943
Pfam PF00656; PF12878
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 79
Pair Name Rutin, Oxaliplatin
Phytochemical Name Rutin
Anticancer drug Name Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin
Combination Pair ID: 90
Pair Name Kuromanin chloride, Cisplatin
Phytochemical Name Kuromanin chloride
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells
Combination Pair ID: 997
Pair Name Chrysin, Paclitaxel
Phytochemical Name Chrysin
Anticancer drug Name Paclitaxel
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result CR exhibited the ability to reduce oxidative DNA damage, exert anti-apoptotic and anti-inflammatory properties, and mitigate the toxic effects of Pax-induced hepatorenal toxicity.
Combination Pair ID: 109
Pair Name Calycosin-7-O-β-D-glucoside, Cisplatin
Phytochemical Name Calycosin-7-O-β-D-glucoside
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result CG significantly increases the CDDP-induced apoptosis of the SK-OV-3 cells through the p53 pathway at the cellular level. In addition, using the drugs in combination reduces the toxicity and side effects caused by using CDDP alone.
Combination Pair ID: 114
Pair Name Narirutin, Cisplatin
Phytochemical Name Narirutin
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Based on the significant anticancer effect and high biosafety, naringin has great potential as a functional food in the adjuvant treatment of lung cancer.
Combination Pair ID: 143
Pair Name Trifolirhizin, Sorafenib
Phytochemical Name Trifolirhizin
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Synergistic anticancer effect of flavonoids from Sophora alopecuroides with Sorafenib against hepatocellular carcinoma
Combination Pair ID: 173
Pair Name Parthenolide, Epirubicin
Phytochemical Name Parthenolide
Anticancer drug Name Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result According to lack of cytotoxicity of Parthenolide on normal cells that lead to reduction of drug side effects, it could be suggested as an adjuvant therapy with Epirubicin after complementary research on animal model and clinical trial.
Combination Pair ID: 1013
Pair Name Oleanolic Acid, Doxorubicin
Phytochemical Name Oleanolic Acid
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result This approach may increase the efficiency of chemotherapy and reduce unintended side effects by lowering the prescribed dose of DOX.
Combination Pair ID: 261
Pair Name Ilexgenin A, Sorafenib
Phytochemical Name Ilexgenin A
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The results described in the present study identifies Ilexgenin A as a promising therapeutic candidate that modulates inflammation, angiogenesis, and HCC growth.
Combination Pair ID: 313
Pair Name Juglone, Indomethacin
Phytochemical Name Juglone
Anticancer drug Name Indomethacin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result IND and JUG reduce the inflammatory activity and induce apoptotic cell death, while JUG effectively prevents IND induced gastric ulceration. These findings establish that a combination of IND + JUG may serve as a promising treatment regimen for colon cancer.
Combination Pair ID: 775
Pair Name Chlorogenic acid, Methotrexate
Phytochemical Name Chlorogenic acid
Anticancer drug Name Methotrexate
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These results imply that CGA has perfective effect against MTX-induced liver injury. Hence CGA supplementation might be helpful in abrogation of MTX toxicity.
Combination Pair ID: 333
Pair Name Schisandrin B, Panitumumab
Phytochemical Name Schisandrin B
Anticancer drug Name Panitumumab
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result This novel combination therapy against CRC, allows the reduction of panitumumab dose to guard against its adverse effects.
Combination Pair ID: 356
Pair Name Withaferin A, Oxaliplatin
Phytochemical Name Withaferin A
Anticancer drug Name Oxaliplatin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Caspase-3 Activity
Result These results support the notion that combination treatment with oxaliplatin and WA could facilitate development of an effective strategy for PC treatment.
Combination Pair ID: 401
Pair Name Curcumin, Temozolomide
Phytochemical Name Curcumin
Anticancer drug Name Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result We showed for the first time that exosomes released from drug-treated U87 cells could be a new therapeutic approach in glioblastoma, and could reduce the side effects produced by drugs alone. This concept needs to be further examined in animal models before clinical trials could be considered.
Combination Pair ID: 443
Pair Name Paeonol, Epirubicin
Phytochemical Name Paeonol
Anticancer drug Name Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings suggest that combination of Paeonol and Epirubicin is potentially applicable for breast cancer treatment.
Combination Pair ID: 444
Pair Name Paeonol, Methotrexate
Phytochemical Name Paeonol
Anticancer drug Name Methotrexate
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result Paeonol protects against MTX-induced nephrotoxicity through antioxidant, anti-inflammatory, and antiapoptotic mechanisms and might potentiate MTX chemotherapeutic efficacy.
Combination Pair ID: 453
Pair Name Mangiferin, Cisplatin
Phytochemical Name Mangiferin
Anticancer drug Name Cisplatin
Disease Info Nephrotoxicity Investigative
Regulate Info Down-regulation Caspase-3 Cleavage
Result The study reveals a mechanistic basis of mangiferin action against cisplatin induced nephrotoxicity. Since Mangiferin shows synergistic anticancer activity with cisplatin, it can be considered as a promising drug candidate, to be used in combination with cisplatin.
Combination Pair ID: 472
Pair Name Umbelliferone, Cisplatin
Phytochemical Name Umbelliferone
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Combination of 7-hydroxycoumarin in a platinum(IV) complex derived from cisplatin enhanced cytotoxicity with multiple mechanisms of action.
Combination Pair ID: 484
Pair Name 10-Gingerol, Doxorubicin
Phytochemical Name 10-Gingerol
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Our data indicate that [10]-gingerol has potential to be used as a neoadjuvant or in combined therapy with doxorubicin, to improve its anticancer activity.
Combination Pair ID: 503
Pair Name Usnic acid, Bleomycin
Phytochemical Name Usnic acid
Anticancer drug Name Bleomycin
Disease Info [ICD-11: 2F94] Ascitic tumor Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin
Combination Pair ID: 505
Pair Name Magnoflorine, Doxorubicin
Phytochemical Name Magnoflorine
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Magnoflorine improves sensitivity to doxorubicin (DOX) of breast cancer cells via inducing apoptosis and autophagy through AKT/mTOR and p38 signaling pathways
Combination Pair ID: 566
Pair Name Levistolide A, Doxorubicin
Phytochemical Name Levistolide A
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2B33.2] Chronic myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Levistolide A synergistically enhances doxorubicin‑induced apoptosis of k562/dox cells by decreasing MDR1 expression through the ubiquitin pathway
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 5
Pair Name Homoharringtonine, Suberoylanilide hydroxamic acid (SAHA)
Phytochemical Homoharringtonine
Drug Suberoylanilide hydroxamic acid (SAHA)
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result The synergistic effect between HHT and SAHA was blocked partially using a specific anti‑TRAIL antibody. The combination therapy was also found to significantly inhibit the growth of leukemia xenografts in vivo with enhanced apoptosis. These results indicate that, by regulating the induction of TRAIL and activation of the TRAIL apoptotic pathway, it is possible to administer HHT at low concentrations in combination with SAHA as an effective therapeutic approach for the treatment of AML.
Combination Pair ID: 967
Pair Name Homoharringtonine, ACC010
Phytochemical Homoharringtonine
Drug ACC010
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result ACC010 and HHT cooperatively downregulated MYC and inhibited FLT3 activation. Further, when HHT was added, ACC010-resistant cells demonstrated a good synergy. We also extended our study to the mouse BaF3 cell line with FLT3-inhibitor-resistant FLT3-ITD/tyrosine kinase domain mutations and AML cells without FLT3-ITD. Collectively, our results suggested that the combination treatment of ACC010 and HHT might be a promising strategy for AML patients, especially those carrying FLT3-ITD.
Combination Pair ID: 12
Pair Name Piperlongumine, Sorafenib
Phytochemical Piperlongumine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Piperlongumine synergistically enhances the antitumour activity of sorafenib by mediating ROS-AMPK activation and targeting CPSF7 in liver cancer
Combination Pair ID: 618
Pair Name Piperlongumine, Oxaliplatin
Phytochemical Piperlongumine
Drug Oxaliplatin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result This study provides a novel combination therapy for colorectal cancer, and reveals that manipulating ROS production might constitute an effective tool for developing novel treatments in colorectal cancer.
Combination Pair ID: 13
Pair Name Halofuginone, Cisplatin
Phytochemical Halofuginone
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Halofuginone Sensitizes Lung Cancer Organoids to Cisplatin via Suppressing PI3K/AKT and MAPK Signaling Pathways
Combination Pair ID: 14
Pair Name Cepharanthine, Epirubicin
Phytochemical Cepharanthine
Drug Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Cepharanthine sensitizes human triple negative breast cancer cells to chemotherapeutic agent epirubicin via inducing cofilin oxidation-mediated mitochondrial fission and apoptosis
Combination Pair ID: 16
Pair Name Tetrandrine, Sorafenib
Phytochemical Tetrandrine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The antitumour activity of sorafenib plus tetrandrine may be attributed to the induction of the intrinsic apoptosis pathway through ROS/Akt signaling. This finding provides a novel approach that may broaden the clinical application of sorafenib.
Combination Pair ID: 620
Pair Name Tetrandrine, Cisplatin
Phytochemical Tetrandrine
Drug Cisplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo
Combination Pair ID: 18
Pair Name Oxymatrine, Paclitaxel
Phytochemical Oxymatrine
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model
Combination Pair ID: 26
Pair Name Trigonelline, Cisplatin
Phytochemical Trigonelline
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our study demonstrated that Trigonelline blocks Nrf2 activation and its nuclear translocation via inhibition of EGFR signalling pathway. It has improved responsiveness of NSCLC cells for Cisplatin and Etoposide and could be a promising choice for lung cancer therapy. Toxicol In Vitro. 2021 Feb;70:105038. doi: 10.1016/j.tiv.2020.105038.
Combination Pair ID: 29
Pair Name Berbamine, Sorafenib
Phytochemical Berbamine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings identify a new type of natural STAT3 inhibitor and provide a novel approach to the enhancement of SORA efficacy by blocking the activation of STAT3.
Combination Pair ID: 30
Pair Name Berbamine, Sorafenib
Phytochemical Berbamine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Targeting Na+/K+-ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma
Combination Pair ID: 31
Pair Name Berbamine, Arcyriaflavin A
Phytochemical Berbamine
Drug Arcyriaflavin A
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells.
Combination Pair ID: 621
Pair Name Berbamine, Cisplatin
Phytochemical Berbamine
Drug Cisplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result This study proposed that the combination therapy of BBR and DDP markedly enhanced more ovarian cancer cell death by inducing apoptosis and necroptosis, which may improve the anticancer effect of chemotherapy drugs. The apoptosis involved the caspase-dependent pathway, while the necroptosis involved the activation of the RIPK3-MLKL pathway. We hope our findings might provide a new insight for the potential of BBR as a therapeutic agent in the treatment of ovarian cancer.
Combination Pair ID: 972
Pair Name Berbamine, Cisplatin
Phytochemical Berbamine
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings indicate that Ber might be a promising adjuvant for enhancing the cancer cell killing effect of chemotherapy via the inhibition of autophagy. In this process, Nox2 might be a significant mediator of Ber-induced aberrant lysosomal acidification.
Combination Pair ID: 38
Pair Name Rutaecarpine, Fluorouracil
Phytochemical Rutaecarpine
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Combined therapy with 5-FU and RUT exerted a superior curative effect in CRC than treatment with either single drug alone and has potential as a novel therapeutic modality for the treatment of CRC.
Combination Pair ID: 39
Pair Name Fangchinoline, Everolimus
Phytochemical Fangchinoline
Drug Everolimus
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Firstly link CHOP to Notch 3/c-MYC axis-dependent apoptosis and provide the Notch 3/c-MYC/CHOP activation as a promising strategy for mTOR-targeted combination therapy in lung cancer treatment.
Combination Pair ID: 40
Pair Name Leonurine, Cisplatin
Phytochemical Leonurine
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Leonurine and cisplatin have synergistic antitumorigenic effects on cervical cancer. Combination with leonurine may serve as a novel strategy for enhancing cisplatin sensitivity via the inhibition of the expression of MRP1 and P-Gp.
Combination Pair ID: 44
Pair Name Solamargine, Cisplatin
Phytochemical Solamargine
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Identification of solamargine as a cisplatin sensitizer through phenotypical screening in cisplatin-resistant NSCLC organoids
Combination Pair ID: 45
Pair Name Solamargine, Bortezomib
Phytochemical Solamargine
Drug Bortezomib
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings indicate that SM exerts an anti-MM effect, at least in part, by activating cell autophagy and reveal that SM alone or in combination with BTZ is a potential therapeutic strategy for treating MM.
Combination Pair ID: 48
Pair Name Jervine, Decitabine
Phytochemical Jervine
Drug Decitabine
Disease Info [ICD-11: 2A3Z] Myelodysplastic syndrome Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The Smo inhibitor jervine and its combination with decitabine have a synergistic effect on the proliferation, cell cycle, and apoptosis of MUTZ-1 cells, and its mechanism may be achieved by interfering with the Shh signaling pathway.
Combination Pair ID: 51
Pair Name Sanguinarium, Bortezomib
Phytochemical Sanguinarium
Drug Bortezomib
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Down-regulation Caspase-3 Activity
Result Our findings demonstrate that SNG induces mitochondrial and caspase-dependent apoptosis, generates oxidative stress, and suppresses MM cell lines proliferation. In addition, co-treatment of MM cell lines with sub-toxic doses of SNG and BTZ potentiated the cytotoxic activity. These results would suggest that SNG could be developed into therapeutic agent either alone or in combination with other anticancer drugs in MM.
Combination Pair ID: 974
Pair Name Sanguinarium, Doxorubicin
Phytochemical Sanguinarium
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Cellular and molecular studies suggested adjuvant chemosensitizers SA and SN to reverse MDR in breast cancer cells.
Combination Pair ID: 53
Pair Name Daurinoline, Sorafenib
Phytochemical Daurinoline
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our study provides insights into the molecular mechanisms underlying DS-induced inhibition of VM, which may facilitate the development of a novel clinical anti-HCC drug. Moreover, our findings suggest that the combination of DS and sorafenib constitutes a potential therapeutic strategy for HCC.
Combination Pair ID: 55
Pair Name Hyaluronic acid, Doxorubicin
Phytochemical Hyaluronic acid
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result This multifunctional nanoparticle system could deliver R848 and DOX respectively to tumor microenvironment and breast cancer cells to achieve synergistic effects of immunotherapy and chemotherapy against breast cancer.
Combination Pair ID: 56
Pair Name Lentinan, Oxaliplatin
Phytochemical Lentinan
Drug Oxaliplatin
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These data imply that LNT increases the susceptibility of esophageal cancerous cells to Oxa by driving EC-109 cells to display immunogenic death. Therefore, LNT combined with Oxa may be an effective method in esophageal cancer management.
Combination Pair ID: 57
Pair Name Polyphyllin I, Cisplatin
Phytochemical Polyphyllin I
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The results from the present study demonstrated that PPI and PPVII may function as chemosensitizers by enhancing apoptosis via the p53 pathway, reversing EMT and suppressing the CIP2A/AKT/mTOR signaling axis, and the combination with DDP may be a promising strategy for the development of new therapeutic agents.
Combination Pair ID: 624
Pair Name Quercetin, Doxorubicin
Phytochemical Quercetin
Drug Doxorubicin
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result These findings demonstrated that quercetin is important in MDR and may be developed into a new reversal agent for cancer chemotherapy.
Combination Pair ID: 978
Pair Name Quercetin, Oxaliplatin
Phytochemical Quercetin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings suggest that the depletion of intracellular glutathione by quercetin and sulforaphane could strengthen the anti-cancer efficacy of oxaliplatin.
Combination Pair ID: 626
Pair Name Luteolin, Oxaliplatin
Phytochemical Luteolin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Luteolin can induce p53-mediated apoptosis regardless of oxaliplatin treatment and may eliminate oxaliplatin-resistant p53-null colorectal cells
Combination Pair ID: 627
Pair Name Luteolin, Oxaliplatin
Phytochemical Luteolin
Drug Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Luteolin Suppresses the Proliferation of Gastric Cancer Cells and Acts in Synergy with Oxaliplatin through the Cyt c/caspase pathway
Combination Pair ID: 70
Pair Name Baicalin, Fluorouracil
Phytochemical Baicalin
Drug Fluorouracil
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result BA is a promising preventive or adjuvant therapy in breast cancer treatment with 5-FU mainly via cooperative inhibition of inflammation, angiogenesis, and triggering apoptotic cell death.
Combination Pair ID: 633
Pair Name Fisetin, Sorafenib
Phytochemical Fisetin
Drug Sorafenib
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The combination of fisetin and sorafenib exerted better synergistic effects in vitro and in vivo than either agent used alone against human cervical cancer, and this synergism was based on apoptotic potential through a mitochondrial- and DR5-dependent caspase-8/caspase-3 signaling pathway
Combination Pair ID: 634
Pair Name Fisetin, Sorafenib
Phytochemical Fisetin
Drug Sorafenib
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Fisetin potentiates sorafenib-induced apoptosis and abrogates tumor growth in athymic nude mice implanted with BRAF-mutated melanoma cells.
Combination Pair ID: 637
Pair Name Apigenin, TNF-related apoptosis inducing ligand
Phytochemical Apigenin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Apigenin sensitizes cells to TRAIL-induced apoptosis by activating both intrinsic and extrinsic apoptotic pathway-related caspases. The augmented apoptotic effect by TRAIL/apigenin combination was accompanied by triggering mitochondria-dependent signaling pathway, as indicated by Bax/Bcl-2 ratio up-regulation
Combination Pair ID: 85
Pair Name Scutellarin, Oxaliplatin
Phytochemical Scutellarin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result It was indicated that scutellarin resensitizes oxaliplatin-resistant CRC cells to oxaliplatin treatment through inhibition of PKM2.
Combination Pair ID: 643
Pair Name Scutellarin, Cisplatin
Phytochemical Scutellarin
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our study supports that scutellarin acts as a potential sensitizer to cisplatin treatment and the combination of scutellarin and cisplatin may be a novel therapeutic strategy to overcome platinum resistance of ovarian cancer.
Combination Pair ID: 86
Pair Name Tangeretin, Metformin
Phytochemical Tangeretin
Drug Metformin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The current work underscores the importance of metformin as an ERMA in tackling breast cancer and as a novel approach to boost its anticancer activity via a synergistic combination with tangeretin.
Combination Pair ID: 646
Pair Name Hesperetin, Cisplatin
Phytochemical Hesperetin
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Hesperetin could inhibit the phosphatidylinositol-4,5-bisphosphate 3-kinase (PI3K)/AKT signaling pathway and induce the mitochondrial pathway via upregulating PTEN expression, thereby significantly enhancing DDP's anti-tumor effect on GC
Combination Pair ID: 88
Pair Name Hyperoside, Paclitaxel
Phytochemical Hyperoside
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Hyperoside may elevate breast cancer cell sensitivity to paclitaxel by blocking TLR4 activation-mediated pro-inflammatory and pro-survival approaches, thereby endorsing its usefulness as a promising therapeutic combination to overcome chemosensitivity in breast cancer.
Combination Pair ID: 91
Pair Name Isorhamnetin, Chloroquine
Phytochemical Isorhamnetin
Drug Chloroquine
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our study highlights the critical role of ROS-mediating CaMKII/Drp1 signaling in the regulation of mitochondrial fission and apoptosis induced by combination of CQ/IH. These findings also suggest that IH could potentially be further developed as a novel chemotherapeutic agent. Furthermore, a combination of IH with classic autophagy/mitophagy inhibitor could represent a novel therapeutic strategy for the treatment of TNBC.
Combination Pair ID: 92
Pair Name Isorhamnetin, Doxorubicin
Phytochemical Isorhamnetin
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Isorhamnetin induces cell cycle arrest and apoptosis by triggering DNA damage and regulating the AMPK/mTOR/p70S6K signaling pathway in doxorubicin-resistant breast cancer
Combination Pair ID: 94
Pair Name Amentoflavone, Cisplatin
Phytochemical Amentoflavone
Drug Cisplatin
Disease Info [ICD-11: 2B66.0] Oral squamous cell carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Inactivation of NF-κB and induction of apoptosis through intrinsic caspase-dependent and independent apoptotic pathways are associated with amentoflavone enhanced anti-OSCC efficacy of cisplatin.
Combination Pair ID: 649
Pair Name Amentoflavone, Sorafenib
Phytochemical Amentoflavone
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result Our results demonstrated that amentoflavone significantly enhanced sorafenib-inhibited tumor growth and expression of ERK/AKT phosphorylation and anti-apoptotic proteins compared to single-agent treatment. Additionally, amentoflavone also triggered sorafenib-induced apoptosis through extrinsic and intrinsic apoptotic pathways.
Combination Pair ID: 651
Pair Name Licochalcone A, Fluorouracil
Phytochemical Licochalcone A
Drug Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result LCA alone or in combination with 5-FU may have significant anticancer effects on gastric cancer cells
Combination Pair ID: 99
Pair Name Silibinin, Sorafenib
Phytochemical Silibinin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These results suggested that silibinin improved the efficacy of sorafenib in HCC therapy, indicating a clinical promising therapeutic strategy for HCC patients.
Combination Pair ID: 100
Pair Name Silibinin, Paclitaxel
Phytochemical Silibinin
Drug Paclitaxel
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines
Combination Pair ID: 104
Pair Name Chrysin, Cisplatin
Phytochemical Chrysin
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result The combination of Chrysin and Cisplatin Induces Apoptosis in HepG2 through Down-regulation of cFLIP and Activity of Caspase.
Combination Pair ID: 655
Pair Name Chrysin, Cisplatin
Phytochemical Chrysin
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our results suggest that combination of chrysin and cisplatin is a promising strategy for chemotherapy of human cancers that are resistant to cisplatin.
Combination Pair ID: 107
Pair Name Liquiritin, TNF-related apoptosis inducing ligand
Phytochemical Liquiritin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation
Combination Pair ID: 108
Pair Name Hispidulin, Temozolomide
Phytochemical Hispidulin
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These results collectively suggested that the combination of hispidulin and TMZ could improve the antitumor efficiency of TMZ against malignant gliomas.
Combination Pair ID: 113
Pair Name Butein, TNF-related apoptosis inducing ligand
Phytochemical Butein
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Our data suggests that combined treatment with butein and TRAIL may provide a safe and effective strategy for treating cancer.
Combination Pair ID: 116
Pair Name Morin, Auranofin
Phytochemical Morin
Drug Auranofin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result This study provides evidence that morin can enhance the anticancer activity of AF in Hep3B human hepatocellular carcinoma cells, indicating that its combination could be an alternative treatment strategy for the hepatocellular carcinoma.
Combination Pair ID: 660
Pair Name Morin, MST312
Phytochemical Morin
Drug MST312
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Caspase-3 Cleavage
Result Our study suggests that novel targeted-therapy can be implemented by using flavonoid morin and telomerase inhibitor MST‑312 for improved cancer prognosis.
Combination Pair ID: 119
Pair Name Morin Hydrate, Cisplatin
Phytochemical Morin Hydrate
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Our findings indicate that CP-Mh in combination served as a prominent regulator of autophagy and significant inducer of apoptosis that maintains a homeostatic balance towards HepG2 cells and the subcutaneous tumor model.
Combination Pair ID: 122
Pair Name Epigallocatechin gallate, Metformin
Phytochemical Epigallocatechin gallate
Drug Metformin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Anti-proliferative and anti-apoptotic potential effects of epigallocatechin-3-gallate and/or metformin on hepatocellular carcinoma cells: in vitro study
Combination Pair ID: 124
Pair Name Epigallocatechin gallate, Fluorouracil
Phytochemical Epigallocatechin gallate
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our data show that EGCG may be act as a novel chemo-sensitizer, and the GRP78/NF-κB/miR-155-5p/MDR1 pathway plays a vital role in EGCG enhancing the sensitivity of colorectal cancer to 5-FU.
Combination Pair ID: 661
Pair Name Epigallocatechin gallate, TNF-related apoptosis inducing ligand
Phytochemical Epigallocatechin gallate
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis
Combination Pair ID: 662
Pair Name Epigallocatechin gallate, TNF-related apoptosis inducing ligand
Phytochemical Epigallocatechin gallate
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Combination of epigallocatechin-3-gallate and TRAIL synergistically increase the apoptosis and cleavage of procaspase-3 in pancreatic cancer cells
Combination Pair ID: 663
Pair Name Epigallocatechin gallate, TNF-related apoptosis inducing ligand
Phytochemical Epigallocatechin gallate
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B6B] Nasopharyngeal carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result EGCG sensitizes NPC cells to TRAIL-mediated apoptosis via modulation of extrinsic and intrinsic apoptotic pathways and inhibition of NF-κB activation.
Combination Pair ID: 664
Pair Name Epigallocatechin gallate, TNF-related apoptosis inducing ligand
Phytochemical Epigallocatechin gallate
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result EGCG enhances TRAIL-mediated apoptosis in human melanoma A375 cell line
Combination Pair ID: 132
Pair Name Casticin, Fluorouracil
Phytochemical Casticin
Drug Fluorouracil
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result We may suggest that 5-FU combined with casticin treatment increased apoptotic cell death in WEHI-3 mouse leukemia cells that may undergo mitochondria and caspases signaling pathways in vitro.
Combination Pair ID: 133
Pair Name Kurarinone, TNF-related apoptosis inducing ligand
Phytochemical Kurarinone
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Kurarinone Synergizes TRAIL-Induced Apoptosis in Gastric Cancer Cells
Combination Pair ID: 136
Pair Name Tectorigenin, Paclitaxel
Phytochemical Tectorigenin
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result These data suggest that tectorigenin could sensitize paclitaxel-resistant human ovarian cancer cells through inactivation of the Akt/IKK/IκB/NFκB signaling pathway, and promise a new intervention to chemosensitize paclitaxel-induced cytotoxicity in ovarian cancer.
Combination Pair ID: 138
Pair Name Neobavaisoflavone, TNF-related apoptosis inducing ligand
Phytochemical Neobavaisoflavone
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Taken together, our results suggest that NBIF reduces the resistance of cancer cells to TRAIL and that the combination of NBIF and TRAIL may be a new therapeutic strategy for treating TRAIL-resistant glioma cells.
Combination Pair ID: 142
Pair Name Irigenin, TNF-related apoptosis inducing ligand
Phytochemical Irigenin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our present study gave new insights into the effects of Iri on potentiating TRAIL-sensitivity, and suggested that Iri could be a potential candidate for sensitizer of TRAIL-resistant cancer cell treatment.
Combination Pair ID: 145
Pair Name Helichrysetin, Tumor necrosis factor-alpha
Phytochemical Helichrysetin
Drug Tumor necrosis factor-alpha
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Helichrysetin and TNF‑α synergistically promoted apoptosis by inhibiting TAK1/IKK/NF‑κB and TAK1/EGFR signaling pathways in HeLa and T98G cells, indicating a potential therapeutic strategy for cancer.
Combination Pair ID: 667
Pair Name Gambogic acid, Cisplatin
Phytochemical Gambogic acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Combination of GA with cisplatin enhances the antitumor effects on cisplatin-resistant lung cancer cells by downregulating MRP2 and LRP expression.
Combination Pair ID: 668
Pair Name Quercetin, Doxorubicin
Phytochemical Quercetin
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Que could attenuate AC-induced cardiotoxicity by inhibiting ROS accumulation and activating ERK1/2 pathway in cardiomyocytes, but interestingly, Que could enhance the antitumor activity of AC by inhibiting ROS accumulation and ERK1/2 pathway in TNBC cells. In addition,in vivo studies further confirmed that Que could enhance the chemotherapeutic effect of AC against TNBC while it reduced the injury of cardiotoxicity induced by AC
Combination Pair ID: 671
Pair Name Celastrol, TNF-related apoptosis inducing ligand
Phytochemical Celastrol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result The combined use of TRAIL with celastrol may serve as a safe and adequate therapeutic technique for the treatment of TRAIL‑resistant lung cancer, suggesting that celastrol‑mediated autophagy flux inhibition sensitized TRAIL‑initiated apoptosis via regulation of ROS and ΔΨm.
Combination Pair ID: 672
Pair Name Celastrol, TNF-related apoptosis inducing ligand
Phytochemical Celastrol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The results of our study demonstrate that celastrol sensitizes glioma cells to TRAIL via the death receptor pathway and that DR5 plays an important role in the effects of this cotreatment. The results indicate that this cotreatment is a promising tumor-killing therapeutic strategy with high efficacy and low toxicity.
Combination Pair ID: 1000
Pair Name Celastrol, Tamoxifen
Phytochemical Celastrol
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result CEL can promote apoptosis and enhance the TAM sensitivity in TNBC treatment through a mitochondria-mediated pathway.
Combination Pair ID: 166
Pair Name Dihydroartemisinin, Oxaliplatin
Phytochemical Dihydroartemisinin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result We demonstrated an improved therapeutic strategy for CRC patients by combining DHA and oxaliplatin treatments.
Combination Pair ID: 1001
Pair Name Dihydroartemisinin, Doxorubicin
Phytochemical Dihydroartemisinin
Drug Doxorubicin
Disease Info [ICD-11: 2A81] Primary effusion lymphoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result DHA is a potentially effective candidate drug for PEL treatment.
Combination Pair ID: 168
Pair Name Resveratrol, Temozolomide
Phytochemical Resveratrol
Drug Temozolomide
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result TMZ in combination with resveratrol remarkably increased reactive oxygen species (ROS) production, which serves as an upstream signal for AMP-activated protein kinase (AMPK) activation. Subsequently, activated AMPK inhibited mTOR signaling and downregulated antiapoptosis protein Bcl-2, which was contributed to the additive antiproliferation effects of combination treatment. In an orthotopic xenograft model of GBM, TMZ plus resveratrol treatment significantly reduced the volume of tumor, which was confirmed by decreased expression of Ki-67, a marker of proliferation index
Combination Pair ID: 674
Pair Name Artesunate, Cisplatin
Phytochemical Artesunate
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result ART exhibited significant anti-tumor effect on A549 cells and this efficiency could be enhanced by combination with CIS
Combination Pair ID: 1006
Pair Name Artesunate, Sorafenib
Phytochemical Artesunate
Drug Sorafenib
Disease Info [ICD-11: XH50P3] Non‑hodgkin lymphoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Artesunate synergistically promotes sorafenib‑induced apoptosis and ferroptosis in non‑Hodgkin lymphoma cells through inhibition of the STAT3 pathway
Combination Pair ID: 1007
Pair Name Artesunate, TP-0903
Phytochemical Artesunate
Drug TP-0903
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Synergistic interactions between TP-0903 and ART indicate that combination approaches involving these compounds can have therapeutic prospects for TNBC treatment.
Combination Pair ID: 175
Pair Name Parthenolide, Balsalazide
Phytochemical Parthenolide
Drug Balsalazide
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result These results demonstrate that parthenolide potentiates the efficacy of balsalazide through synergistic inhibition of NF-κB activation and the combination of dual agents prevents colon carcinogenesis from chronic inflammation.
Combination Pair ID: 1009
Pair Name Oridonin, Venetoclax
Phytochemical Oridonin
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Oridonin and venetoclax synergistically promote AML cell apoptosis by inhibiting AKT signaling.
Combination Pair ID: 185
Pair Name Astragaloside IV, Carboplatin
Phytochemical Astragaloside IV
Drug Carboplatin
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our results suggested that AgIV enhanced carboplatin sensitivity in prostate cancer cell lines by suppressing AKT/NF-κB signaling, thus suppressed epithelial-mesenchymal transition induced by carboplatin. Our findings provided a new mechanism for AgIV in overcoming drug resistance of platinum-based chemotherapy and suggested a potential combination therapy of AgIV and carboplatin in prostate cancer.
Combination Pair ID: 186
Pair Name Astragaloside IV, Bevacizumab
Phytochemical Astragaloside IV
Drug Bevacizumab
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result This paper demonstrates that AST-IV enhances the effect of BV on inhibiting proliferation and promoting apoptosis of lung adenocarcinoma cells through inhibiting autophagy pathway.
Combination Pair ID: 189
Pair Name Ursolic acid, Sorafenib
Phytochemical Ursolic acid
Drug Sorafenib
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result These results suggest that the synergistic antitumor effects of sorafenib combined with ursolic acid may involve the induction of Mcl-1-related apoptosis and SLC7A11-dependent ferroptosis. Our findings may offer a novel effective therapeutic strategy for tumor treatment.
Combination Pair ID: 192
Pair Name Ursolic acid, Oxaliplatin
Phytochemical Ursolic acid
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result These observations suggested that a combination of UA and Oxa elicited synergistically anticancer effects in RKO cells and provided new evidence for potential application of UA and Oxa for CRC treatment.
Combination Pair ID: 681
Pair Name Ursolic acid, Cisplatin
Phytochemical Ursolic acid
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The combination of UA with DDP could more effectively inhibit SiHa cells proliferation and facilitate cell apoptosis through suppressing NF-κB p65.
Combination Pair ID: 194
Pair Name Oleanolic Acid, Sorafenib
Phytochemical Oleanolic Acid
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result OA represents a novel approach to increase the sensitivity of HCC cells to Sorafenib via oxidative stress.
Combination Pair ID: 199
Pair Name Tanshinone IIA, Cisplatin
Phytochemical Tanshinone IIA
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The combination of Tan IIA and cisplatin exhibited the most significant difference. Tanshinone IIA may function as a novel option for combination therapy for non-small-cell lung cancer treatment.
Combination Pair ID: 199
Pair Name Tanshinone IIA, Cisplatin
Phytochemical Tanshinone IIA
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result The combination of Tan IIA and cisplatin exhibited the most significant difference. Tanshinone IIA may function as a novel option for combination therapy for non-small-cell lung cancer treatment.
Combination Pair ID: 201
Pair Name Astaxanthin, Cytarabine
Phytochemical Astaxanthin
Drug Cytarabine
Disease Info [ICD-11: 2B33.3] Acute lymphoblastic leukemia Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Co-treatment of ASX and Ara-C has synergism effects on apoptosis pathways, cell proliferation inhibition, and decreased inflammation.
Combination Pair ID: 202
Pair Name Ginsenoside Rh2, Gemcitabine
Phytochemical Ginsenoside Rh2
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Rh2 activation of DCs may remodel the cold TIME and optimize GEM chemotherapy for future therapeutic use.
Combination Pair ID: 685
Pair Name Ginsenoside Rh2, Sodium selenite
Phytochemical Ginsenoside Rh2
Drug Sodium selenite
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Sodium selenite and G-Rh2 combination have a synergistic effect on cell growth inhibition (57%) compared with sodium selenite (25%) and G-Rh2 alone (28%) after 24 hours of treatment
Combination Pair ID: 204
Pair Name Ginsenoside Rg3, Sorafenib
Phytochemical Ginsenoside Rg3
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings suggest a promising strategy for HCC treatment, which could be performed in a sufficiently frequent manner.
Combination Pair ID: 1019
Pair Name Ginsenoside Rg3, Tamoxifen
Phytochemical Ginsenoside Rg3
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result This study highlights the contribution of Rg3 in enhancing the therapeutic efficacy of TAM in breast cancer, and suggests that targeting TAM-resistant PFKFB3 overexpression may represent a promising strategy to improve the response to combination therapy in breast cancer.
Combination Pair ID: 206
Pair Name 20(s)-ginsenoside Rh2, TNF-related apoptosis inducing ligand
Phytochemical 20(s)-ginsenoside Rh2
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result Our study indicates that Rh2 may act as a sensitizer in combination with TRAIL to increase the efficacy of its anti-tumor activity.
Combination Pair ID: 208
Pair Name Ginsenoside Rg1, Doxorubicin
Phytochemical Ginsenoside Rg1
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The present results support the chemosensitizing property of ginsenoside Rg1 in triple-negative breast cancer cell lines.
Combination Pair ID: 209
Pair Name Ginsenoside, Regorafenib
Phytochemical Ginsenoside
Drug Regorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The findings in this study offered a theoretical insight into clinical use of regorafenib and ginsenoside for treatment of liver cancer.
Combination Pair ID: 1021
Pair Name Betulin, Arsenic oxide (As2O3)
Phytochemical Betulin
Drug Arsenic oxide (As2O3)
Disease Info [ICD-11: 2D11.Y] Neuroblastoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The novel combination of As2O3 plus betulin has the potential to serve as a practical anti-neuroblastoma drug.
Combination Pair ID: 213
Pair Name Betulinic acid, Imatinib
Phytochemical Betulinic acid
Drug Imatinib
Disease Info [ICD-11: 2B33.2] Chronic myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our findings demonstrated that HDAC3 is an essential factor in BCR-ABL1 kinase-independent IM resistance, and that BA in combination with IM may be a novel treatment strategy for overcoming IM resistance in CML.
Combination Pair ID: 219
Pair Name Cucurbitacin B, Sorafenib
Phytochemical Cucurbitacin B
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Sorafenib and CuB exert synergistic antitumor effects through a pathway that may involve STAT3 phosphorylation, and this may represent a promising therapeutic approach for treatment of HCC.
Combination Pair ID: 221
Pair Name Toosendanin, Irinotecan
Phytochemical Toosendanin
Drug Irinotecan
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The data showed that TSN blocked 7-ethyl-10-hydroxycamptothecin (SN-38)/irinotecan-induced protective autophagy, and significantly induced apoptosis in TNBC cells and tumor xenograft models when compared to SN-38/irinotecan alone group.
Combination Pair ID: 1024
Pair Name Toosendanin, Paclitaxel
Phytochemical Toosendanin
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result The results suggest that combination of TSN and PTX is superior to PTX alone, suggesting that it may be a promising alternative adjuvant chemotherapy strategy for patients with TNBC, especially those with metastatic TNBC.
Combination Pair ID: 224
Pair Name Curcumol, Cisplatin
Phytochemical Curcumol
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings suggest that curcumol inhibits the polarization of M2-like macrophages and could be a promising combination strategy to synergize with CDDP in the osteosarcoma.
Combination Pair ID: 693
Pair Name Saikosaponin D, 1,9-Pyrazoloanthrone
Phytochemical Saikosaponin D
Drug 1,9-Pyrazoloanthrone
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result A dramatic inhibition of cellular proliferation, invasion, and migration in cells treated with Ssd alone or in combination with SP600125 was observed
Combination Pair ID: 694
Pair Name Carnosic acid, Tamoxifen
Phytochemical Carnosic acid
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our study supplies a novel therapeutic strategy to induce apoptosis for suppressing breast cancer, which was relied on Caspase-3/TRAIL activation.
Combination Pair ID: 705
Pair Name Costunolide, Imatinib
Phytochemical Costunolide
Drug Imatinib
Disease Info [ICD-11: 2B33.3] Acute lymphoblastic leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These results demonstrate that costunolide may be a potent therapeutic agent against chronic myeloid leukemia.
Combination Pair ID: 706
Pair Name Costunolide, Doxorubicin
Phytochemical Costunolide
Drug Doxorubicin
Disease Info [ICD-11: 2B33.3] Acute lymphoblastic leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These results demonstrate that costunolide may be a potent therapeutic agent against chronic myeloid leukemia.
Combination Pair ID: 697
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result These results define a pathway of procaspase‑3-β-ELE function that involves decreased mitochondrial membrane potential, leading to apoptosis triggered by the release of cytochrome c into the cytoplasm and the modulation of apoptosis-related genes. The reversal of drug resistance of the A549/DDP cell line by β-ELE may be derived from its effect in inducing apoptosis.
Combination Pair ID: 698
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our data provide a rationale for developing a combination of beta-elemene and cisplatin as a regimen for the treatment of lung carcinoma and other cisplatin-resistant tumors.
Combination Pair ID: 699
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The results of the present study suggested that β-ELE inhibited the proliferation of bladder cancer cells in vitro and enhanced cisplatin-induced mitochondria-dependent apoptosis via the ROS-AMPK signaling pathway. Combination therapy with β-ELE requires further investigation as a potential treatment of bladder cancer.
Combination Pair ID: 700
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result β-elemene enhancement of cisplatin-induced apoptosis via mitochondrial activation of the caspase-mediated apoptotic pathway may account for the augmented anti-cancer potency of cisplatin in prostate cancer. Cisplatin combined with β-elemene as a chemosensitizer or adjuvant warrants further study and may be potentially useful as a first-line treatment of androgen-independent prostate carcinomas.
Combination Pair ID: 701
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Cisplatin combined with β-elemene as a chemosensitizer warrants further pre-clinical therapeutic studies and may be useful for the treatment of cisplatin-resistant bladder cancer and other types of carcinomas.
Combination Pair ID: 703
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2B63] Gingival squamous cell carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The results indicated that β-elemene promoted the anti-proliferative and apoptotic effect of cisplatin by inhibiting STAT3 and blocking the JAK2-STAT3 signaling pathway in GSCC in vitro and in vivo.
Combination Pair ID: 704
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result These data indicate that β-elemene sensitizes chemoresistant ovarian carcinoma cells to cisplatin-induced apoptosis and that the augmented effect of β-elemene on cisplatin cytotoxicity and sensitivity in resistant ovarian tumor cells is mediated through a mitochondria- and caspase-dependent cell death pathway.
Combination Pair ID: 709
Pair Name Beta-Elemene, TNF-related apoptosis inducing ligand
Phytochemical Beta-Elemene
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Our results suggest that β-elemene increases the sensitivity of gastric cancer cells to TRAIL partially by promoting the formation of DISC in lipid rafts.
Combination Pair ID: 238
Pair Name Ginkgolide B, Cisplatin
Phytochemical Ginkgolide B
Drug Cisplatin
Disease Info [ICD-11: 2B66.Z] Oral cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These results suggest that PAFR is a therapeutic target for modulating CDDP sensitivity in OSCC cells. Thus, GB may be a novel drug that could enhance combination chemotherapy with CDDP for OSCC patients.
Combination Pair ID: 1031
Pair Name Atractylenolide I, Cabozantinib
Phytochemical Atractylenolide I
Drug Cabozantinib
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Silencing Hsp27 inhibits EMT. ATL-1 can inhibit the malignant evolution of prostate cancer cells by inhibiting Hsp27/eIF4E. ATL-1 also enhanced chemosensitization of cabozantinib in prostate cancer.
Combination Pair ID: 248
Pair Name Oleuropein, Cisplatin
Phytochemical Oleuropein
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Our results showed for the first time that the anti-tumor activity of oleuropein against HCC could be attributed to influencing the pro-NGF/NGF balance via affecting MMP-7 activity without affecting the gene expression of NGF. Concurrent treatment with both oleuropein and cisplatin could lead to more effective chemotherapeutic combination against HCC.
Combination Pair ID: 250
Pair Name Ginsenoside Rg5, Paclitaxel
Phytochemical Ginsenoside Rg5
Drug Paclitaxel
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel
Combination Pair ID: 716
Pair Name Nimbolide, Tumor necrosis factor-alpha
Phytochemical Nimbolide
Drug Tumor necrosis factor-alpha
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our findings overall indicate that nimbolide may enhance TNF-α-mediated cellular proliferation inhibition through increasing cell apoptosis of HT-29 cells by up-reglation of DR5 expression via the JNK pathway.
Combination Pair ID: 1033
Pair Name Patchouli alcohol, Vincristine
Phytochemical Patchouli alcohol
Drug Vincristine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage
Combination Pair ID: 254
Pair Name Alpha-Hederin, Carboplatin
Phytochemical Alpha-Hederin
Drug Carboplatin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Chemopreventive effect of α-hederin/carboplatin combination against experimental colon hyperplasia and impact on JNK signaling
Combination Pair ID: 255
Pair Name Alpha-Hederin, Paclitaxel
Phytochemical Alpha-Hederin
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our findings suggest that α-Hed can increase the killing effect of Tax on NSCLC cells by promoting ROS accumulation, and that combining α-Hed with classical Tax represents a novel strategy for treating NSCLC.
Combination Pair ID: 256
Pair Name Alpha-Hederin, Cisplatin
Phytochemical Alpha-Hederin
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result α-Hederin enhances cisplatin-induced anti-tumour effects in GC both in vitro and in vivo by promoting the accumulation of ROS and decreasing MMP. Our data strongly suggested that α-Hederin is a promising candidate for intervention in gastric cancer.
Combination Pair ID: 256
Pair Name Alpha-Hederin, Cisplatin
Phytochemical Alpha-Hederin
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result α-Hederin enhances cisplatin-induced anti-tumour effects in GC both in vitro and in vivo by promoting the accumulation of ROS and decreasing MMP. Our data strongly suggested that α-Hederin is a promising candidate for intervention in gastric cancer.
Combination Pair ID: 262
Pair Name Panaxadiol, Irinotecan
Phytochemical Panaxadiol
Drug Irinotecan
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Data from this study suggested that caspase-3- and caspase-9-mediated apoptosis may play an important role in the panaxadiol enhanced antiproliferative effects of irinotecan on human colorectal cancer cells.
Combination Pair ID: 263
Pair Name Gynostemma Extract, Fluorouracil
Phytochemical Gynostemma Extract
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Gypenosides Synergistically Enhances the Anti-Tumor Effect of 5-Fluorouracil on Colorectal Cancer In Vitro and In Vivo: A Role for Oxidative Stress-Mediated DNA Damage and p53 Activation
Combination Pair ID: 266
Pair Name Sclareolide, Gemcitabine
Phytochemical Sclareolide
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Sclareolide enhances gemcitabine‑induced cell death through mediating the NICD and Gli1 pathways in gemcitabine‑resistant human pancreatic cancer
Combination Pair ID: 268
Pair Name Curcumenol, Cisplatin
Phytochemical Curcumenol
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Curcumenol can enhance cisplatin to inhibit cancer cell proliferation, migration, and invasion and promote tumor cell apoptosis. The combination of drugs may promote the apoptosis of cervical cancer cells through the YWHAG pathway.
Combination Pair ID: 270
Pair Name Pulsatilla saponin D, Temozolomide
Phytochemical Pulsatilla saponin D
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result SB365 inhibits autophagic flux and induces caspase-independent cell death in GBM cells in a manner involving cathepsin B and mainly reactive oxygen species, and its use in combination with temozolomide shows promise for the treatment of GBM.
Combination Pair ID: 273
Pair Name Eurycomalactone, Cisplatin
Phytochemical Eurycomalactone
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result This finding provides a rationale for the combined use of chemotherapy drugs with ECL to improve their efficacy in NSCLC treatment.
Combination Pair ID: 278
Pair Name Furanodiene, Doxorubicin
Phytochemical Furanodiene
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result These results indicate that furanodiene may be a promising and safety natural agent for cancer adjuvant therapy in the future.
Combination Pair ID: 281
Pair Name Britannin, Vincristine
Phytochemical Britannin
Drug Vincristine
Disease Info [ICD-11: 2B33.3] Acute lymphoblastic leukemia Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The results of this study showed for the first time that Britannin, as a natural Sesquiterpene Lactone, has cytotoxic effects that could be considered as an anti-leukemic agent in the treatment of ALL. However, there is still a demand for further studies that examine the efficacy and the safety of this purified compound.
Combination Pair ID: 284
Pair Name Shikonin, 4-hydroxytamoxifen
Phytochemical Shikonin
Drug 4-hydroxytamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The combination of SK and 4-OHT shows highly efficient anticancer effects on breast cancer therapy. SK may be a promising candidate as an adjuvant to 4-OHT for breast cancer treatments, especially for ER- breast cancer.
Combination Pair ID: 720
Pair Name Shikonin, Cisplatin
Phytochemical Shikonin
Drug Cisplatin
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Shikonin as a synergistic agent to cisplatin could be a highly efficient way to achieve anticancer synergism by inducing intracellular oxidative stress
Combination Pair ID: 724
Pair Name Shikonin, TNF-related apoptosis inducing ligand
Phytochemical Shikonin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result The results indicated that shikonin sensitized resistant cancer cells to TRAIL-induced cytotoxicity via the modulation of the JNK, STAT3 and AKT pathways, the downregulation of antiapoptotic proteins and the upregulation of proapoptotic proteins.
Combination Pair ID: 725
Pair Name Shikonin, Gemcitabine
Phytochemical Shikonin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Our results suggest that shikonin can suppress the growth of human pancreatic tumors and potentiate the antitumor effects of gemcitabine through the suppression of NF-κB and NF-κB-regulated gene products.
Combination Pair ID: 289
Pair Name Emodin, Vinblastine
Phytochemical Emodin
Drug Vinblastine
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Emodin Sensitizes Cervical Cancer Cells to Vinblastine by Inducing Apoptosis and Mitotic Death
Combination Pair ID: 729
Pair Name Emodin, Cytarabine
Phytochemical Emodin
Drug Cytarabine
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Emodin and its combination with Ara-C may be considered a promising therapeutic approach in AML and worthy of further investigation.
Combination Pair ID: 292
Pair Name Cryptotanshinone, Trifluridine
Phytochemical Cryptotanshinone
Drug Trifluridine
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result FTD combined with CTS has a synergistic anti-gastric cancer effect as shown by in vitro and in vivo experiments, and the combined treatment of FTD and CTS will be a promising treatment option for advanced gastric cancer.
Combination Pair ID: 731
Pair Name Cryptotanshinone, Gefitinib
Phytochemical Cryptotanshinone
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings indicated the role of TKT in lung cancer progression and may provide novel therapeutic strategies to overcome resistance to gefitinib. Furthermore, CTS may serve as a new candidate in adjuvant treatment of advanced lung cancer.
Combination Pair ID: 295
Pair Name Tanshinone IIA, Imatinib
Phytochemical Tanshinone IIA
Drug Imatinib
Disease Info [ICD-11: 2A20.1] Chronic myelogenous leukemia Investigative
Regulate Info Down-regulation Caspase-3 Cleavage
Result The results revealed that Tan IIA enhanced the inhibitory effect of imatinib on TIB‑152 cell proliferation, migration and invasion, and induced apoptosis, which may be associated with inhibition of the PI3K/AKT/mTOR signaling pathway.
Combination Pair ID: 299
Pair Name Rhein, Doxorubicin
Phytochemical Rhein
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Our data indicate that a decline in mitochondrial energy metabolism was responsible for the synergistic antitumor effects of rhein and DOX in hepatocellular carcinoma cells. Reduction of ΔΨm and opening of mPTP inhibited the exchange of ATP/adenosine diphosphate between mitochondrial matrix and cytoplasm is the important mechanism.
Combination Pair ID: 304
Pair Name Dihydrotanshinone I, Cisplatin
Phytochemical Dihydrotanshinone I
Drug Cisplatin
Disease Info [ICD-11: 2D10.Z] Thyroid cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The present study is the first to demonstrate that DHT exerts antitumor effects on ATC cells by reducing MAD2 expression levels. Moreover, a synergistic effect of DHT with cisplatin was shown. Further in vivo studies are required to assess this phytochemical compound as a potential adjuvant for the treatment of ATC.
Combination Pair ID: 306
Pair Name Thymoquinone, Fluorouracil
Phytochemical Thymoquinone
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result TQ and 5-FU probably showed synergistic effect on both of cell cycle and apoptosis of tested TNBC cell lines. Our study reveals that TQ can synergise 5-FU action, and increase its anticancer efficiency against TNBC cells, which might be good choice in drug development for TNBC treatment.
Combination Pair ID: 309
Pair Name Thymoquinone, Methotrexate
Phytochemical Thymoquinone
Drug Methotrexate
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The findings of the present study highlight new insights into understanding the role of TQ as a potential therapeutic agent in osteosarcoma by increasing MTX-induced apoptosis.
Combination Pair ID: 746
Pair Name Thymoquinone, Bortezomib
Phytochemical Thymoquinone
Drug Bortezomib
Disease Info [ICD-11: 2A85.5] Mantle cell lymphoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-KappaB regulated gene products in multiple myeloma xenograft mouse model
Combination Pair ID: 748
Pair Name Thymoquinone, Zoledronic acid
Phytochemical Thymoquinone
Drug Zoledronic acid
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result TQ and ZA had minimal hematological and non-hematological toxicity profile compared to cytotoxic agents. So, this combination may be an alternative approach for patients who are unable to be treated by conventional treatments because of poor performance status.
Combination Pair ID: 749
Pair Name Thymoquinone, Topotecan
Phytochemical Thymoquinone
Drug Topotecan
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Thymoquinone, when combined with topotecan in noncytotoxic doses, produced synergistic antiproliferative and proapoptotic effects in AML cells
Combination Pair ID: 754
Pair Name Thymoquinone, Propranolol
Phytochemical Thymoquinone
Drug Propranolol
Disease Info [ICD-11: 2C23.Z] Laryngeal cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The effect of thymoquinone and propranolol combination on epidermoid laryngeal carcinoma cell.
Combination Pair ID: 758
Pair Name Thymoquinone, Temozolomide
Phytochemical Thymoquinone
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our findings demonstrate that TQ can effectively cross the BBB and function alone or in combination with TMZ to treat glioblastoma.
Combination Pair ID: 761
Pair Name Aloin, Irinotecan
Phytochemical Aloin
Drug Irinotecan
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our findings suggests that CPT-11 and Aloin are potential combination treatment partners against colorectal cancer. MicroRNA-133b may serve as a co-therapeutic target with IGF1R against colorectal cancer, which might overcome the existing treatment limitations.
Combination Pair ID: 315
Pair Name Damnacanthal, Doxorubicin
Phytochemical Damnacanthal
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Combinatorial Cytotoxic Effects of Damnacanthal and Doxorubicin against Human Breast Cancer MCF-7 Cells in Vitro
Combination Pair ID: 762
Pair Name Honokiol, Temozolomide
Phytochemical Honokiol
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Taken together, this study demonstrated the improved effects of honokiol with TMZ on autophagy and subsequent apoptosis of drug-sensitive and -tolerant glioma cells. Thus, honokiol has the potential to be a drug candidate for treating human gliomas.
Combination Pair ID: 767
Pair Name Honokiol, Fluorouracil
Phytochemical Honokiol
Drug Fluorouracil
Disease Info [ICD-11: 2B62.0] Tongue squamous cell carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings suggest that HNK and 5-FU exert a synergistic therapeutic effect on OSCC by inducing apoptosis. HNK might thus enhance the clinical therapeutic efficacy of 5-FU without increasing its toxicity.
Combination Pair ID: 318
Pair Name Chlorogenic acid, Doxorubicin
Phytochemical Chlorogenic acid
Drug Doxorubicin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings firstly propose CGA as a promising chemosensitizer and cardioprotective agent in OS therapy, suggesting the p44/42 MAPK pathway as relevantly involved in CGA-mediated Doxo susceptibility.
Combination Pair ID: 319
Pair Name Rosmarinic acid, Paclitaxel
Phytochemical Rosmarinic acid
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Rosmarinic acid exerted chemo-preventive and therapeutic potential alone or in combination with Paclitaxel. Moreover, rosmarinic acid targets numerous signaling pathways associated with breast cancer.
Combination Pair ID: 320
Pair Name Rosmarinic acid, Anti-MUC1 antibody
Phytochemical Rosmarinic acid
Drug Anti-MUC1 antibody
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Results of the study indicate that combined action of anti-MUC1 and RA is more effective than monotherapy in relation to examined cancer related factors. Such treatment can be considered as new, promising strategy in gastric cancer therapy.
Combination Pair ID: 322
Pair Name Caffeic acid phenethyl ester, Fluorouracil
Phytochemical Caffeic acid phenethyl ester
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result This study demonstrated the cytotoxicity of CAPE potential to induce apoptosis of breast cancer MCF-7 cell line single and cytotoxic-cytostatic combination with 5-FU. Therefore, further studies to develop CAPE and its derivatives will be required to discover new candidates for breast cancer agents.
Combination Pair ID: 323
Pair Name Caffeic acid phenethyl ester, Cisplatin
Phytochemical Caffeic acid phenethyl ester
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result This study reveals the therapeutic potential of CAPE in cisplatin-resistant ovarian tumors as well as in tumors expressing USP8.
Combination Pair ID: 327
Pair Name Caffeic acid, Paclitaxel
Phytochemical Caffeic acid
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Our results indicated that CA inhibited NSCLC H1299 cell growth by inducing apoptosis and CA and PTX combined produced a synergistic anti-cancer effect in H1299 cells.
Combination Pair ID: 328
Pair Name Osthol, Lobaplatin
Phytochemical Osthol
Drug Lobaplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result OST enhanced the apoptosis-mediated growth inhibitory effect of lobaplatin on breast cancer cells and has potential for the treatment of breast cancer in the future.
Combination Pair ID: 329
Pair Name Osthol, Temozolomide
Phytochemical Osthol
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Our results indicated that osthole effectively eliminated glioma cells via apoptosis, what was correlated with Bcl-2/Beclin 1 complex formation. Considering the anti-migratory effect, osthole and Temozolomide display antiglioma potential but it needs further extensive studies.
Combination Pair ID: 331
Pair Name Eugenol, Cisplatin
Phytochemical Eugenol
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Eugenol showed antiproliferative and cytotoxic effects via apoptosis and also synergism with cisplatin and ionizing radiation in the human cervical cancer cell line.
Combination Pair ID: 782
Pair Name Eugenol, Cisplatin
Phytochemical Eugenol
Drug Cisplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These results provide strong preclinical justification for combining cisplatin with eugenol as therapeutic approach for triple-negative breast cancers through targeting the resistant ALDH-positive cells and inhibiting the NF-κB pathway.
Combination Pair ID: 334
Pair Name Chicoric acid, TNF-related apoptosis inducing ligand
Phytochemical Chicoric acid
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Our results suggest that TO plays an important role in TRAIL-induced apoptosis, and further functional studies are warranted to confirm the importance of TO as a novel TRAIL sensitizer for cancer therapy.
Combination Pair ID: 335
Pair Name Decursin, Doxorubicin
Phytochemical Decursin
Drug Doxorubicin
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result The combination treatment of decursin and doxorubicin can enhance apoptotic activity via mTOR and/or STAT3 signaling pathway in multiple myeloma cells.
Combination Pair ID: 343
Pair Name Angelicin, TNF-related apoptosis inducing ligand
Phytochemical Angelicin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C90.Z] Renal carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result This study provides evidence that angelicin might be a TRAIL sensitizer.
Combination Pair ID: 351
Pair Name Bufalin, Sorafenib
Phytochemical Bufalin
Drug Sorafenib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Sorafenib in combination with bufalin shows more potent cytotoxic effects and cell apoptosis than sorafenib or bufalin treatment alone in NCI-H292 cells. The combined treatment significantly enhanced apoptotic cell death in NCI-H292 lung cancer cells by activating ROS-, mitochondria-, and caspase-signaling pathways in vitro.
Combination Pair ID: 787
Pair Name Bufalin, 2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one
Phytochemical Bufalin
Drug 2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Bufalin is a potential regimen to be used in combination with conventional chemotherapeutic drugs to improve acute promyelocytic leukemia therapy.
Combination Pair ID: 795
Pair Name Withaferin A, Sorafenib
Phytochemical Withaferin A
Drug Sorafenib
Disease Info [ICD-11: 2D10.Z] Thyroid cancer Investigative
Regulate Info Down-regulation Caspase-3 Phosphorylation
Result Combination therapy with sorafenib + withaferin showed synergistic efficacy in papillary and anaplastic cancers in vitro with significant induction of apoptosis. This combination achieved potent anticancer activity with lower overall doses of sorafenib, indicating a potential strategy to decrease sorafenib toxicity in future translational studies.
Combination Pair ID: 360
Pair Name OSW-1, Carboplatin
Phytochemical OSW-1
Drug Carboplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our data revealed the mode of action and molecular mechanism underlying the effect of OSW-1 against TNBC, and provided a useful guidance for improving the sensitivity of TNBC cells to conventional chemotherapeutic drugs, which warrants further investigation.
Combination Pair ID: 361
Pair Name Oleandrin, Cisplatin
Phytochemical Oleandrin
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The combination of oleandrin with cisplatin exerts a synergistic antitumor effect in osteosarcoma, which relates to the activation of the p38 MAPK pathway.
Combination Pair ID: 363
Pair Name Tenacissoside G, Fluorouracil
Phytochemical Tenacissoside G
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result TG potentiated 5-FU's inhibitory activity to human colorectal cancer through arresting cell cycle progression and inducing p53-mediated apoptosis, which may present a novel strategy in CRC therapies and contribute to the optimizing clinical application of 5-FU.
Combination Pair ID: 802
Pair Name Pterostilbene, TNF-related apoptosis inducing ligand
Phytochemical Pterostilbene
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Pterostilbene enhances TRAIL-induced apoptosis through the induction of death receptors and downregulation of cell survival proteins in TRAIL-resistance triple negative breast cancer cells
Combination Pair ID: 804
Pair Name Pterostilbene, Sorafenib
Phytochemical Pterostilbene
Drug Sorafenib
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result PET obviously enhanced sorafenib's antitumour effects against GAC through inhibiting cell proliferation, inducing autophagy and promoting apoptosis. The combination therapy with PET and sorafenib may serve as a novel therapeutic strategy for treating GAC and deserve further clinical trials.
Combination Pair ID: 367
Pair Name Polydatin, Paclitaxel
Phytochemical Polydatin
Drug Paclitaxel
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Polydatin may enhance the chemosensitivity of osteosarcoma cells to paclitaxel.
Combination Pair ID: 370
Pair Name Oxyresveratrol, Dacarbazine
Phytochemical Oxyresveratrol
Drug Dacarbazine
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result This combination treatment may serve as a novel therapeutic strategy for treating malignant melanoma.
Combination Pair ID: 371
Pair Name Epsilon-Viniferin, alpha-Viniferin
Phytochemical Epsilon-Viniferin
Drug alpha-Viniferin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result ε-viniferin and α-viniferin may prove to be new approaches and effective therapeutic agents for osteosarcoma and lung cancer treatment.
Combination Pair ID: 378
Pair Name Resveratrol, Rapamycin
Phytochemical Resveratrol
Drug Rapamycin
Disease Info [ICD-11: 2D10.1] Papillary thyroid cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The present study suggests that the combination of rapamycin and resveratrol may be a promising strategy for the treatment of papillary thyroid cancer.
Combination Pair ID: 381
Pair Name Resveratrol, Cisplatin
Phytochemical Resveratrol
Drug Cisplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result RSV, an effective anti-oxidant, and CDDP as an effective drug in cancer treatment, were found to increase apoptosis when given in the MDA-MB-231 cell.
Combination Pair ID: 383
Pair Name Resveratrol, TNF-related apoptosis inducing ligand
Phytochemical Resveratrol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C90.0] Renal cell carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Our data demonstrated that RES plus Ad5/35-TRAIL significantly inhibited RCC xenograft growth in nude mice. These results suggest the possibility of a new combination therapeutic leading to the improvement of RCC treatment.
Combination Pair ID: 813
Pair Name Resveratrol, Cisplatin
Phytochemical Resveratrol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Resveratrol Enhances Cytotoxic Effects of Cisplatin by Inducing Cell Cycle Arrest and Apoptosis in Ovarian Adenocarcinoma SKOV-3 Cells through Activating the p38 MAPK and Suppressing AKT
Combination Pair ID: 389
Pair Name Curcumin, Docetaxel
Phytochemical Curcumin
Drug Docetaxel
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result CUR combined with DTX induced apoptosis and autophagy of ESCC and probably worked through the PI3K/AKT/mTOR signaling pathway. The combination of the autophagy inhibitor, CUR and DTX may become a new treatment strategy for esophageal cancer.
Combination Pair ID: 403
Pair Name Curcumin, Binimetinib
Phytochemical Curcumin
Drug Binimetinib
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our data demonstrates that curcumin exerts significant synergistic anticancer effects on MM cells by inducing ROS and necroptosis when combined with binimetinib. Therefore, a strategy of adding curcumin to conventional anticancer agents holds promise for treating MM.
Combination Pair ID: 818
Pair Name Curcumin, Nimustine
Phytochemical Curcumin
Drug Nimustine
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Curcumin potentiates the potent antitumor activity of ACNU against glioblastoma by suppressing the PI3K/AKT and NF-kappaB/COX-2 signaling pathways
Combination Pair ID: 823
Pair Name Curcumin, Doxorubicin
Phytochemical Curcumin
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Our findings provide a novel and simple approach to nhibit the growth and metastasis of hepatocellular carcinoma.
Combination Pair ID: 825
Pair Name Curcumin, Dactolisib
Phytochemical Curcumin
Drug Dactolisib
Disease Info [ICD-11: 2D11.Y] Neuroblastoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Synergistic anti-proliferative and apoptotic effect of NVP-BEZ235 and curcumin on human SH-SY5Y neuroblastoma cells.
Combination Pair ID: 826
Pair Name Curcumin, Melphalan
Phytochemical Curcumin
Drug Melphalan
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Curcumin and melphalan cotreatment induces cell cycle arrest and apoptosis in MDA-MB-231 breast cancer cells
Combination Pair ID: 827
Pair Name Curcumin, TNF-related apoptosis inducing ligand
Phytochemical Curcumin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Combined treatment with curcumin and carboplatin inhibited tumor cell growth, migration, and invasion compared with either drug alone. The synergistic antitumor activity of curcumin combined with carboplatin is mediated by multiple mechanisms involving suppression of NF-kappaB via inhibition of the Akt/IKKalpha pathway and enhanced ERK1/2 activity
Combination Pair ID: 406
Pair Name Capsaicin, Arsenic trioxide
Phytochemical Capsaicin
Drug Arsenic trioxide
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Combination index (CI) values were < 1 in all matched combination groups. Additional evaluation of As2O3 combined with ACM as a potential therapeutic benefit for AML seems warranted.
Combination Pair ID: 834
Pair Name Capsaicin, Sorafenib
Phytochemical Capsaicin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result These data confirm that capsaicin and sorafenib combination treatment inhibits the growth, invasion and metastasis of HCC cells and induces autophagy in a synergistic manner, supporting its potential as a therapeutic option for HCC.
Combination Pair ID: 409
Pair Name Luteolin, Paclitaxel
Phytochemical Luteolin
Drug Paclitaxel
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The molecular mechanism of inhibiting cell migration and EMT processes may be related to the inhibition of SIRT1, and the mechanism of apoptosis induction is associated with the reactive oxygen species (ROS)/c-Jun N-terminal kinase (JNK) pathway-mediated activation of mitochondrial apoptotic pathway.
Combination Pair ID: 840
Pair Name Luteolin, Cisplatin
Phytochemical Luteolin
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result These findings indicate the anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cells and luteolin may be a promising candidate agent used in the treatment of gastric cancer.
Combination Pair ID: 842
Pair Name Luteolin, SMC3
Phytochemical Luteolin
Drug SMC3
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The results suggest that combination of SMC3 and luteolin is an effective approach for improving the anticancer value of SMC3, which has implications in cancer prevention and therapy.
Combination Pair ID: 843
Pair Name Luteolin, IL-24
Phytochemical Luteolin
Drug IL-24
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These data confirm that the synergistic mechanism of VV-IL-24 and luteolin elicits a stronger tumor growth inhibition than any single therapy. Thus, the combination of VV-IL-24 and luteolin could provide the basis for preclinical research in the treatment of liver cancer.
Combination Pair ID: 846
Pair Name Luteolin, Sorafenib
Phytochemical Luteolin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Sorafenib and luteolin combination synergistically kills HCC cells through JNK-mediated apoptosis, and luteolin may be an ideal candidate for increasing the activity of sorafenib in HCC therapy.
Combination Pair ID: 848
Pair Name Luteolin, Fluorouracil
Phytochemical Luteolin
Drug Fluorouracil
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Current results proved the antitumor therapeutic effects of luteolin alone or combined with 5-FU as a novel strategy for cancer therapy.
Combination Pair ID: 849
Pair Name Luteolin, Gemcitabine
Phytochemical Luteolin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Luteolin + Gem promoted apoptotic cell death in pancreatic tumor cells in vivo through inhibition of the K-ras/GSK-3β/NF-κB signaling pathway, leading to a reduction in the Bcl-2/Bax ratio, release of cytochrome c, and activation of caspase 3.
Combination Pair ID: 415
Pair Name Icariin, Fluorouracil
Phytochemical Icariin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result We suggest that combination of icariin with 5-FU might offer a therapeutic benefit to the patients with CRC; however, further studies are required to ascertain this proposition.
Combination Pair ID: 416
Pair Name Icariin, Arsenic oxide (As2O3)
Phytochemical Icariin
Drug Arsenic oxide (As2O3)
Disease Info [ICD-11: XH1A50] Acute promyelocytic leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our results showed that Icariin, by increasing intracellular ROS, exhibited antitumor activity and potentiated the antitumor activity of ATO against APL. Therefore, combination treatment with Icariin and ATO might offer a novel therapeutic option for patients with APL, although further studies are needed.
Combination Pair ID: 417
Pair Name Icariin, Gemcitabine
Phytochemical Icariin
Drug Gemcitabine
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result Icariin, by suppressing NF-κB activity, exerts antitumor activity, and potentiates the antitumor activity of gemcitabine in gallbladder cancer. Combined administration of gemcitabine and icariin may offer a better therapeutic option for the patients with gallbladder cancer.
Combination Pair ID: 420
Pair Name Anacardic Acid, Bortezomib
Phytochemical Anacardic Acid
Drug Bortezomib
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The results of the present study suggest that AA/Bor combination may be a potential therapeutic strategy for MM treatment.
Combination Pair ID: 422
Pair Name Icaritin, TNF-related apoptosis inducing ligand
Phytochemical Icaritin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These data suggest that icaritin sensitizes TRAIL-induced tumor cell apoptosis via suppression of NF-κB-dependent c-FLIP expression, providing in vitro evidence supporting the notion that icaritin is a potential sensitizer of TRAIL in anticancer therapy against human GBM.
Combination Pair ID: 424
Pair Name Cianidanol, Fluorouracil
Phytochemical Cianidanol
Drug Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result We suggest catechin as a candidate for the development of a novel adjuvant drug that reduces chemoresistance to 5FU by restricting LDHA.
Combination Pair ID: 426
Pair Name Acteoside, Temozolomide
Phytochemical Acteoside
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result It was also determined that TMZ + acteoside induced apoptosis and autophagy through the mitogen‑activated protein kinase signaling pathway. These findings suggest that acteoside has beneficial effects on TMZ‑based glioblastoma therapy.
Combination Pair ID: 431
Pair Name Hypericin, Gemcitabine
Phytochemical Hypericin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result We demonstrated that Gem combined HY-PDT could inhibit the proliferation of Capan-2 cells and induce cell apoptosis. HY-PDT combined with Gem had a great potential on pancreatic cancer treatment clinically.
Combination Pair ID: 435
Pair Name Garcinol, Paclitaxel
Phytochemical Garcinol
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Caspase-3 Cleavage
Result Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model
Combination Pair ID: 862
Pair Name Garcinol, Cisplatin
Phytochemical Garcinol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our data demonstrated that garcinol has the potential to be used as an anticancer agent and may synergize the effect of DDP. These actions are most likely through the regulation of the PI3K/AKT and NF-κB pathways.
Combination Pair ID: 436
Pair Name Vanillin, Fluorouracil
Phytochemical Vanillin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Vanillin is deemed to be a promising anticancer candidate by inhibiting NNMT and may attenuate NNMT‑induced resistance to 5‑Fu in human CRC therapy with few side effects.
Combination Pair ID: 441
Pair Name alpha-Mangostin, TNF-related apoptosis inducing ligand
Phytochemical alpha-Mangostin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B66.0] Oral squamous cell carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Synergism between α-mangostin and TRAIL induces apoptosis in squamous cell carcinoma of the oral cavity through the mitochondrial pathway
Combination Pair ID: 864
Pair Name Paeonol, Cisplatin
Phytochemical Paeonol
Drug Cisplatin
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Paeonol, in combination with cisplatin, had a significantly synergistic growth-inhibitory effect on oesophageal cell line, which may be related to apoptosis induction
Combination Pair ID: 448
Pair Name Naringenin, Diosmin
Phytochemical Naringenin
Drug Diosmin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Diosmin in combination with naringenin enhances apoptosis in colon cancer cells
Combination Pair ID: 450
Pair Name Naringenin, AMG-951
Phytochemical Naringenin
Drug AMG-951
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The present study provides a novel therapeutic strategy for glioma by potentiating APO2L-induced apoptosis via the combination with NG in glioma tumor cells.
Combination Pair ID: 866
Pair Name Naringenin, ABT-737
Phytochemical Naringenin
Drug ABT-737
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The combination of these drugs was found to further increase the cleavage of caspase-3 and poly ADP-ribose polymerase. Naringenin and ABT-737 also decreased Akt activation and increased p53 expression, suggesting the involvement of these pathways in the inhibition of gastric cell growth.
Combination Pair ID: 867
Pair Name Theaflavin 3,3'-digallate, Cisplatin
Phytochemical Theaflavin 3,3'-digallate
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result TF3 may be used as an adjuvant for the treatment of advanced ovarian cancer.
Combination Pair ID: 454
Pair Name Mangiferin, Doxorubicin
Phytochemical Mangiferin
Drug Doxorubicin
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Our findings suggest that the combination of mangiferin and an anticancer drug could be used as a new regime for the treatment of MM.
Combination Pair ID: 868
Pair Name Mangiferin, Oxaliplatin
Phytochemical Mangiferin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The present study indicates that mangiferin in combination with oxaliplatin favours apoptotic cell death and thereby improves the efficacy of oxaliplatin in vitro. In addition, combination therapy with mangiferin may also counteract the development of resistance in cancer cell lines.
Combination Pair ID: 456
Pair Name Corylin, Etoposide
Phytochemical Corylin
Drug Etoposide
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Corylin increases the sensitivity of hepatocellular carcinoma cells to chemotherapy through long noncoding RNA RAD51-AS1-mediated inhibition of DNA repair
Combination Pair ID: 461
Pair Name Shogaol, Gefitinib
Phytochemical Shogaol
Drug Gefitinib
Disease Info [ICD-11: 2C73] Ovarian Cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our results suggest that 6-shogaol exerts a potential anti-cancer effect in ovarian cancer and combination treatment with 6-shogaol and gefitinib may provide a novel anti-tumor therapeutic strategy in gefitinib-resistant ovarian cancer.
Combination Pair ID: 869
Pair Name Shogaol, Fluorouracil
Phytochemical Shogaol
Drug Fluorouracil
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Our data suggest that the addition of 6-shogaol to established chemotherapeutic regimens could potentially be a remarkable therapeutic strategy for colorectal cancer.
Combination Pair ID: 870
Pair Name Shogaol, Gemcitabine
Phytochemical Shogaol
Drug Gemcitabine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our results suggest that 6-shogaol can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing of TLR4/NF-κB-mediated inflammatory pathways linked to tumorigenesis.
Combination Pair ID: 467
Pair Name Gossypol, Fluorouracil
Phytochemical Gossypol
Drug Fluorouracil
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings suggest that gossypol-mediated down-regulation of TS, cyclin D1, and the mTOR/p70S6K1 signaling pathways enhances the anti-tumor effect of 5-FU. Ultimately, our data exposed a new action for gossypol as an enhancer of 5-FU-induced cell growth suppression.
Combination Pair ID: 873
Pair Name Gossypol, TRAIL/Apo2L
Phytochemical Gossypol
Drug TRAIL/Apo2L
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Gossypol profoundly sensitizes thoracic cancer cells to the cytotoxic effect of Apo2L/TRAIL via activation of the mitochondria-dependent death signaling pathway. This study provides evidence for the profound anticancer activity of this drug combination and should be further evaluated as a novel targeted molecular therapeutic for thoracic cancers.
Combination Pair ID: 874
Pair Name Gossypol, Imatinib
Phytochemical Gossypol
Drug Imatinib
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These results suggest that (-)gossypol induced apoptosis in K562 cells through a mitochondria pathway and that the combination of imatinib and (-)gossypol might be an effective treatment for CML.
Combination Pair ID: 875
Pair Name Gossypol, Zoledronic acid
Phytochemical Gossypol
Drug Zoledronic acid
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result GP significantly enhances the anti-tumor activity of ZA in hormone- and drug-resistant prostate cancer cells by targeting many pivotal apoptosis-related proteins.
Combination Pair ID: 876
Pair Name Gossypol, Doxorubicin
Phytochemical Gossypol
Drug Doxorubicin
Disease Info [ICD-11: 2B5A] Biphasic synovial sarcoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Combination therapy with L gossypol and low-concentration doxorubicin inhibited cell proliferation and induced apoptosis in SW982 HSSCs at a significantly greater level compared with either treatment alone
Combination Pair ID: 468
Pair Name Gossypol, Gefitinib
Phytochemical Gossypol
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result AT-101 enhances gefitinib sensitivity in non-small cell lung cancer with EGFR T790M mutations.
Combination Pair ID: 470
Pair Name Gossypol, Idarubicin
Phytochemical Gossypol
Drug Idarubicin
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings suggest that combinatorial therapy with AT-101 and IDA selectively eliminates leukemia stem-like cells both in vitro and in vivo, representing a potent and alternative salvage therapy for the treatment of relapsed and refractory patients with AML.
Combination Pair ID: 473
Pair Name Tea polyphenol, Paclitaxel
Phytochemical Tea polyphenol
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our results showed that the combination of green tea and PTX could be more potent than the individual drug to induce cytotoxicity and apoptosis in ovarian cancer cells.
Combination Pair ID: 475
Pair Name Protocatechualdehyde, Dacarbazine
Phytochemical Protocatechualdehyde
Drug Dacarbazine
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our study demonstrates that the bioactive compound, Protocatechuic aldehyde, synergistically promotes the cytotoxicity of DTIC to melanoma cells through destabilization of MGMT protein. It could be a potential candidate for melanoma chemotherapy.
Combination Pair ID: 476
Pair Name Quercetin, Cisplatin
Phytochemical Quercetin
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result This study provides further new data for the mechanism by which the QU pre-treatment re-sensitizes SKOV-3/CDDP cells to cisplatin.
Combination Pair ID: 479
Pair Name Bakuchiol, TNF-related apoptosis inducing ligand
Phytochemical Bakuchiol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The collective results suggest that bakuchiol facilitates TRAIL-induced apoptosis in colon cancer cells through up-regulation of the TRAIL receptors; DR4 and DR5 via ROS/JNK pathway signals.
Combination Pair ID: 480
Pair Name Tectochrysin, Cetuximab
Phytochemical Tectochrysin
Drug Cetuximab
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our results indicate that combined therapy with lower concentration of cetuximab and tectochrysin could significantly enhance the cancer cell growth inhibitory effect through the inhibition of EGFR signaling.
Combination Pair ID: 481
Pair Name Propyl gallate, Cisplatin
Phytochemical Propyl gallate
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our data provide the potential application of PG in combination chemotherapy to enhance drug sensitivity in lung cancer by targeting HO-1.
Combination Pair ID: 488
Pair Name Gambogenic acid, Fluorouracil
Phytochemical Gambogenic acid
Drug Fluorouracil
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result These mechanisms may be due to the toxicity of targeted toxin to mitochondria via the mitochondrial pathway.
Combination Pair ID: 489
Pair Name Gambogic Acid, Gemcitabine
Phytochemical Gambogic Acid
Drug Gemcitabine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These results offer a rationale to evaluate the clinical translational possibility of GA as adjuvant therapy to overcome Gem resistance. This combination regimen can be a new therapeutic concept to eradicate this devastating disease.
Combination Pair ID: 490
Pair Name Gambogic Acid, Gemcitabine
Phytochemical Gambogic Acid
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result These results demonstrate that gambogic acid sensitizes pancreatic cancer cells to gemcitabine in vitro and in vivo by inhibiting the activation of the ERK/E2F1/RRM2 signaling pathway. The results also indicate that gambogic acid treatment combined with gemcitabine might be a promising chemotherapy strategy for pancreatic cancer.
Combination Pair ID: 492
Pair Name Gambogic Acid, Paclitaxel
Phytochemical Gambogic Acid
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The combination of GA with paclitaxel may increase the antitumor effects on paclitaxel‑resistant TNBC via downregulating the SHH signaling pathway.
Combination Pair ID: 879
Pair Name Gambogic Acid, Cisplatin
Phytochemical Gambogic Acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Gambogic acid sensitises lung cancer cells to CDDP in vitro and in vivo in NSCLC through inactivation of NF-κB and MAPK/HO-1 signalling pathways, providing a rationale for the combined use of CDDP and GA in lung cancer chemotherapy.
Combination Pair ID: 881
Pair Name Gambogic Acid, TNF-related apoptosis inducing ligand
Phytochemical Gambogic Acid
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings may open a new window in the treatment of breast cancer using TRAIL in combination with GA.
Combination Pair ID: 885
Pair Name Gambogic Acid, Fluorouracil
Phytochemical Gambogic Acid
Drug Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result Our data showed that GA attenuated 5-FU-induced apoptosis by modulating metabolic enzymes of 5-FU and the antigastric cancer effect of two drugs combination was much stronger than that of GA or 5-FU alone.
Combination Pair ID: 886
Pair Name Gambogic Acid, Doxorubicin
Phytochemical Gambogic Acid
Drug Doxorubicin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These findings indicate that GA sensitizes lung cancer cells to ADM in vitro and in vivo, providing a rationale for the combined use of GA and ADM in lung cancer chemotherapy.
Combination Pair ID: 496
Pair Name Hispidin, Gemcitabine
Phytochemical Hispidin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Hispidin might be a novel chemosensitizer for gemcitabine and a potential synergistic agent for increasing the therapeutic index of gemcitabine as a treatment for pancreatic cancer.
Combination Pair ID: 497
Pair Name Medicarpin, TNF-related apoptosis inducing ligand
Phytochemical Medicarpin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B33.1] Myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway
Combination Pair ID: 500
Pair Name Bisdemethoxycucurmin, Rapamycin
Phytochemical Bisdemethoxycucurmin
Drug Rapamycin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Bisdemethoxycurcumin Promotes Apoptosis and Inhibits the Epithelial-Mesenchymal Transition through the Inhibition of the G-Protein-Coupled Receptor 161/Mammalian Target of Rapamycin Signaling Pathway in Triple Negative Breast Cancer Cells.
Combination Pair ID: 507
Pair Name Glucosinalbate, Doxorubicin
Phytochemical Glucosinalbate
Drug Doxorubicin
Disease Info [ICD-11: 2C90] Ehrlich ascites carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host.
Combination Pair ID: 511
Pair Name Phorbol 12-myristate 13-acetate, Apicularen A
Phytochemical Phorbol 12-myristate 13-acetate
Drug Apicularen A
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result These results suggest that the synergy between PMA and apicularen A is involved by PKCα activation and microtubule disruption, and that may inform the development of novel approaches to treat cancer.
Combination Pair ID: 512
Pair Name Retinoic acid, PI3K inhibitor
Phytochemical All-trans-retinoic acid
Drug PI3K inhibitor
Disease Info [ICD-11: 2D4Y] Adenoid cystic carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result We displayed the morphologically and genetic featured PDXs which recapitulated the heterogeneity of original ACC tumors, indicating that the models could be used as a platform for drug screening for therapy response. The feasibility of combination treatment approaches for dual targets were confirmed, providing new regimens for personalized therapies in ACC.
Combination Pair ID: 513
Pair Name All-trans retinoic acid, Decitabine
Phytochemical All-trans-retinoic acid
Drug Decitabine
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These results demonstrate that combining DAC and ATRA has potential for the clinical treatment of HR-MDS/AML and merits further exploration.
Combination Pair ID: 515
Pair Name All-trans retinoic acid, Midostaurin
Phytochemical All-trans-retinoic acid
Drug Midostaurin
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result Combination of midostaurin and ATRA exerts dose-dependent dual effects on acute myeloid leukemia cells with wild type FLT3
Combination Pair ID: 518
Pair Name All-trans retinoic acid, Salinomycin
Phytochemical All-trans-retinoic acid
Drug Salinomycin
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result S+RA induced differentiation by β-catenin-inhibition-mediated up-regulation of C/EBPs and PU.1 and suppression of c-Myc. S+RA triggered apoptosis through β-catenin-inhibition-regulated ΔΨm collapse and caspase-3/7 activation. Taken together, our findings may provide novel therapeutic strategies for AML patients by targeting the WNT/β-catenin pathway.
Combination Pair ID: 523
Pair Name Tannic acid, Cisplatin
Phytochemical Tannic acid
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The results obtained from the present study suggest that the combination of TA and CDDP may exert synergistic anticancer effects and may be a novel adjuvant treatment for liver cancer.
Combination Pair ID: 894
Pair Name Tannic acid, Cisplatin
Phytochemical Tannic acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The combination of TA and CDDP may produce synergistic antitumoral effects mediated by the PERK-ATF4-CHOP apoptotic axis, suggesting a novel adjuvant treatment for lung cancer.
Combination Pair ID: 525
Pair Name Se-Methylselenocysteine, Gemcitabine
Phytochemical Se-Methylselenocysteine
Drug Gemcitabine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Antitumor study in Ehrlich solid tumor model showed the efficacy of MSC combination with GEM for the enhanced antitumor activity. The proposed combination demonstrated the potential for further translational studies.
Combination Pair ID: 530
Pair Name Bixin, Dacarbazine
Phytochemical Bixin
Drug Dacarbazine
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result These data suggest that bixin exerts intrinsic antimelanoma activity by mechanisms complementary to those of dacarbazine, encouraging its use in combined therapy for cutaneous melanoma treatment.
Combination Pair ID: 535
Pair Name Vitamin C, Cimetidine
Phytochemical Vitamin C
Drug Cimetidine
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result We concluded that the synergistic combination provided a promising anti-neoplastic effect via reducing the angiogenesis, oxidative stress, increasing apoptosis,as well as inhibiting the activation of PI3K/AKT/mTOR cue, and suggesting its use as a treatment option for breast cancer.
Combination Pair ID: 538
Pair Name Vitamin C, Methotrexate
Phytochemical Vitamin C
Drug Methotrexate
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Combined low-dose vitamin C and MTX had synergistic anti-proliferative/cytotoxic effects on TNBC cells. In addition, co-treatment increased H2O2 levels and activated both caspase-3 and p38 cell death pathways.
Combination Pair ID: 540
Pair Name Vitamin C, Oxaliplatin
Phytochemical Vitamin C
Drug Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result The current study showed that GLUT1 expression was inversely correlated with sensitivity of gastric cancer cells to pharmacological ascorbate and suggested that GLUT1 expression in gastric cancer may serve as a marker for sensitivity to pharmacological ascorbate.
Combination Pair ID: 542
Pair Name Sulforaphane, MiR-15b-5p
Phytochemical Sulforaphane
Drug MiR-15b-5p
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Our data demonstrate that this combined treatment leads to a very high proportion of apoptotic HT-29 cells (over 85%), a value higher than the sum of the values of apoptotic cells obtained after singularly administered regents (either SFN or R8-PNA-a15b).
Combination Pair ID: 544
Pair Name Sulforaphane, Fluorouracil
Phytochemical Sulforaphane
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Studies of the interaction mechanism have revealed that sulforaphane and 5-fluorouracil act synergistically in the MDA-MB-231 cells by inducing autophagic cell death and premature senescence.
Combination Pair ID: 547
Pair Name Sulforaphane, Cisplatin
Phytochemical Sulforaphane
Drug Cisplatin
Disease Info [ICD-11: 2C28] Malignant mesothelioma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Pro-oxidant activity of sulforaphane and cisplatin potentiates apoptosis and simultaneously promotes autophagy in malignant mesothelioma cells
Combination Pair ID: 553
Pair Name Sulforaphane, Fluorouracil
Phytochemical Sulforaphane
Drug Fluorouracil
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Caspase-3 Expression
Result An increased cytostatic effect was observed in case of alyssin while for sulforaphane the synergistic interaction with 5-fluorouracil involved an intensification of apoptotic cell death.
Combination Pair ID: 904
Pair Name Sulforaphane, TNF-related apoptosis inducing ligand
Phytochemical Sulforaphane
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The ability of sulforaphane to inhibit tumor growth, metastasis, and angiogenesis and to enhance the therapeutic potential of TRAIL suggests that sulforaphane alone or in combination with TRAIL can be used for the management of prostate cancer.
Combination Pair ID: 911
Pair Name Allicin, Fluorouracil
Phytochemical Allicin
Drug Fluorouracil
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Allicin sensitizes hepatocellular cancer cells to anti-tumor activity of 5-fluorouracil through ROS-mediated mitochondrial pathway
Combination Pair ID: 559
Pair Name Lycopene, Doxorubicin
Phytochemical Lycopene
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our results thus show the therapeutic benefit of red guava extracts as a potential cancer treatment for TNBC in combination with doxorubicin or targeted therapy.
Combination Pair ID: 560
Pair Name Fucoxanthin, TNF-related apoptosis inducing ligand
Phytochemical Fucoxanthin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result We found that fucoxanthin- or TRAIL-induced apoptosis of human cervical cancer cells was obviously down-regulated. CONCLUSIONS Taken together, these findings suggest that fucoxanthin and TRAIL increased the apoptosis in human cervical cancer cells by targeting the PI3K/Akt/NF-κB signaling pathway.
Combination Pair ID: 561
Pair Name Fucoxanthin, Doxorubicin
Phytochemical Fucoxanthin
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result The carotenoid fucoxanthin can sensitize multidrug resistant cancer cells to doxorubicin via induction of apoptosis, inhibition of multidrug resistance proteins and metabolic enzymes
Combination Pair ID: 562
Pair Name Brassinolid, Doxorubicin
Phytochemical Brassinolid
Drug Doxorubicin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result These data indicate that EB, a natural product with widespread occurrence in plants, is pharmacologically active in both drug-sensitive and drug-resistant SCLC cells and acts through the Wnt signaling pathway.
Combination Pair ID: 564
Pair Name Hederagenin, Cisplatin
Phytochemical Hederagenin
Drug Cisplatin
Disease Info Head and neck cancer
Regulate Info Up-regulation Caspase-3 Cleavage
Result Hederagenin effectively targets cisplatin-resistant HNC cells in vitro and in vivo. Consistent with its effects in other types of cancer, hederagenin markedly induces apoptosis in HNC cells by activating the mitochondria-driven intrinsic apoptotic pathway. We demonstrated that the apoptosis-inducing effects of hederagenin are mediated by the inhibition of the Nrf2-ARE antioxidant pathway.
Combination Pair ID: 567
Pair Name 2,3,5,6-Tetramethylpyrazine, Doxorubicin
Phytochemical 2,3,5,6-Tetramethylpyrazine
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result DLJ14 and Adr combination treatment may inhibit proliferation of Adr-resistant human breast cancer cells through inhibition of the EGFR/PI3K/Akt survival pathway and induction of apoptosis via the mitochondrial-mediated apoptosis pathway.
Combination Pair ID: 568
Pair Name Zerumbone, Cisplatin
Phytochemical Zerumbone
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The current study indicates that the treatment of 4.62 μM of ZER combined with 1.93 μM of CIS in human liver cancer cells exerts synergistic effects on cell growth inhibition, apoptosis induction, angiogenesis, and invasion by modulating gene expression.
Combination Pair ID: 569
Pair Name Zerumbone, Celecoxib
Phytochemical Zerumbone
Drug Celecoxib
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our results provide novel insights into the role of ATF3 as an essential transcription factor for p53-independent DR5 induction upon both ZER and CCB treatment, and this may be a useful biomarker for TRAIL-based anticancer therapy.
Combination Pair ID: 573
Pair Name Sulforaphene, Carboplatin
Phytochemical Sulforaphene
Drug Carboplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result This study demonstrates that the duel character of this combination therapy may be an effective replacement for conventional therapy alone against NSCLC.
Combination Pair ID: 574
Pair Name Sulforaphene, Cisplatin
Phytochemical Sulforaphene
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian Cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result SFE synergistically inhibited proliferation and induced apoptosis of SKOV3 and SNU8 cells in combination with cisplatin by activating multiple apoptotic pathways. Therefore, we suggest sulforaphene as a chemo-enhancing adjuvant to improve the efficacy of cisplatin in ovarian cancer treatment.
Combination Pair ID: 576
Pair Name Sulforaphene, Photodynamic therapy
Phytochemical Sulforaphene
Drug Photodynamic therapy
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result This study could be useful in the improvement of therapies for human cervical and other types of cancers.
Combination Pair ID: 577
Pair Name Falcarindiol, Cisplatin
Phytochemical Falcarindiol
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our study illustrated that FAD is a potential anticancer drug and strengthens the chemosensitivity of HCC cells to DDP by inhibiting the STAT3/PTTG1 pathway.
Combination Pair ID: 581
Pair Name Zeylenone, Cisplatin
Phytochemical Zeylenone
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway
Combination Pair ID: 582
Pair Name Eriocalyxin B, Gemcitabine
Phytochemical Eriocalyxin B
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Gem and EriB (or Isodon extract) taken together in combination regulated PDK1/AKT1/caspase and JNK signaling and promoted apoptosis synergistically, which may contribute to the much increased anti-proliferative activity compared to either agent alone.
Combination Pair ID: 584
Pair Name Dehydrobruceine B, Cisplatin
Phytochemical Dehydrobruceine B
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These results generated a rationale for further investigation of DHB combined with CDDP as a potential therapeutic strategy in lung cancer.
Combination Pair ID: 586
Pair Name Cantharidin, TNF-related apoptosis inducing ligand
Phytochemical Cantharidin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result The results of the present study revealed that cantharidin effectively sensitized cells to TRAIL‑mediated apoptosis and its effects are likely to be mediated by autophagy, the downregulation of c‑FLIP and the upregulation of DR‑5.
Combination Pair ID: 587
Pair Name Pristimerin, Sorafenib
Phytochemical Pristimerin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway
Combination Pair ID: 590
Pair Name Delta-Tocotrienol, Cisplatin
Phytochemical Delta-Tocotrienol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis
Combination Pair ID: 592
Pair Name Delta-Tocotrienol, Docetaxel
Phytochemical Delta-Tocotrienol
Drug Docetaxel
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The ability of δ-TT to induce necroptotic cell death may represent a promising therapeutical approach to overcome DTX chemoresistance in PCa.
Combination Pair ID: 928
Pair Name Gamma-Tocotrienol, Gemcitabine
Phytochemical Gamma-Tocotrienol
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Our findings suggest that γ-T3 can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing NF-κB-mediated inflammatory pathways linked to tumorigenesis.
Combination Pair ID: 930
Pair Name Gamma-Tocotrienol, Docetaxel
Phytochemical Gamma-Tocotrienol
Drug Docetaxel
Disease Info [ICD-11: 2B66.Z] Oral cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result These findings suggest that the combination treatment with these agents may provide enhanced therapeutic response in oral cancer patients, while avoiding the toxicity associated with high-dose β-tubulin stabilization monotherapy.
Combination Pair ID: 594
Pair Name Gallic acid, Cisplatin
Phytochemical Gallic acid
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian Cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result These data suggest that GA may help overcome the resistance. Hence, the cytotoxic effects of GA, especially on chemo-resistant ovarian cancer cells merit further investigation.
Combination Pair ID: 935
Pair Name Cordycepin, Apatinib
Phytochemical Cordycepin
Drug Apatinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our findings demonstrated that the combination of cordycepin and apatinib has synergistically anticancer effect on NSCLC cells by down-regulating VEGF/PI3K/Akt signaling pathway. This result indicated that cordycepin and apatinib could be a promising drug combination against NSCLC.
Combination Pair ID: 944
Pair Name Saikosaponin D, Cisplatin
Phytochemical Saikosaponin D
Drug Cisplatin
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result These results suggest that saikosaponins sensitize cancer cells to cisplatin through ROS-mediated apoptosis, and the combination of saikosaponins with cisplatin could be an effective therapeutic strategy.
Combination Pair ID: 949
Pair Name Phenethyl isothiocyanate, Irinotecan
Phytochemical Phenethyl isothiocyanate
Drug Irinotecan
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result PEITC potentiates IRI anticancer activity by promoting cell apoptosis in the human colon HCT 116 cells. Thus, PEITC may be a potential enhancer for IRI in humans as an anticolon cancer drug in the future.
Combination Pair ID: 610
Pair Name Noscapine, Cisplatin
Phytochemical Noscapine
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Noscapine Increases the Sensitivity of Drug-Resistant Ovarian Cancer Cell Line SKOV3/DDP to Cisplatin by Regulating Cell Cycle and Activating Apoptotic Pathways
Combination Pair ID: 955
Pair Name Noscapine, Cisplatin
Phytochemical Noscapine
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our results suggest that Nos enhanced the anticancer activity of Cis in an additive to synergistic manner by activating multiple signaling pathways including apoptosis. These findings suggest potential benefit for use of Nos and Cis combination in treatment of lung cancer.
Combination Pair ID: 956
Pair Name Noscapine, Doxorubicin
Phytochemical Noscapine
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Noscapine potentiated the anticancer activity of Doxorubicin in a synergistic manner against TNBC tumors via inactivation of NF-KB and anti-angiogenic pathways while stimulating apoptosis. These findings suggest potential benefit for use of oral Noscapine and Doxorubicin combination therapy for treatment of more aggressive TNBC.
Combination Pair ID: 956
Pair Name Noscapine, Doxorubicin
Phytochemical Noscapine
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Noscapine potentiated the anticancer activity of Doxorubicin in a synergistic manner against TNBC tumors via inactivation of NF-KB and anti-angiogenic pathways while stimulating apoptosis. These findings suggest potential benefit for use of oral Noscapine and Doxorubicin combination therapy for treatment of more aggressive TNBC.
Combination Pair ID: 957
Pair Name Noscapine, Gemcitabine
Phytochemical Noscapine
Drug Gemcitabine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Nos potentiated the anticancer activity of Gem in an additive to synergistic manner against lung cancer via antiangiogenic and apoptotic pathways. These findings suggest potential benefit for use of NGC chemotherapy for treatment of lung cancer.
Combination Pair ID: 957
Pair Name Noscapine, Gemcitabine
Phytochemical Noscapine
Drug Gemcitabine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Nos potentiated the anticancer activity of Gem in an additive to synergistic manner against lung cancer via antiangiogenic and apoptotic pathways. These findings suggest potential benefit for use of NGC chemotherapy for treatment of lung cancer.
Combination Pair ID: 611
Pair Name Periplocin, TNF-related apoptosis inducing ligand
Phytochemical Periplocin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway
Combination Pair ID: 960
Pair Name Periplocin, TNF-related apoptosis inducing ligand
Phytochemical Periplocin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B70.1] Esophageal squamous cell carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our data suggest that CPP and TRAIL could be further explored as potential therapeutic approach for esophageal cancer.
Combination Pair ID: 962
Pair Name Platycodin D, Venetoclax
Phytochemical Platycodin D
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Platycodin D may be a potent therapeutic candidate for the treatment of AML
Combination Pair ID: 964
Pair Name Platycodin D, Sorafenib
Phytochemical Platycodin D
Drug Sorafenib
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The combination of Platycodin D and sorafenib may exert potent anti-cancer effects specifically via FOXO3a
Combination Pair ID: 613
Pair Name Forskolin, Paclitaxel
Phytochemical Forskolin
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our findings encourage the design of future studies aimed at further exploring the Forskolin employment in NSCLC treatment.
Combination Pair ID: 617
Pair Name Beta-Elemene, Bortezomib
Phytochemical Beta-Elemene
Drug Bortezomib
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Elemene sensitizes pancreatic cancer cells to bortezomib by enhancing proteasome inhibition via molecular patch mechanism
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 15
Pair Name Cepharanthine, Cisplatin
Phytochemical Cepharanthine
Drug Cisplatin
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals
Combination Pair ID: 34
Pair Name Vinpocetine, Sorafenib
Phytochemical Vinpocetine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Vinpocetine may be a potential candidate for sorafenib sensitization and HCC treatment, and our results may help to elucidate more effective therapeutic options for HCC patients with sorafenib resistance.
Combination Pair ID: 58
Pair Name Polyphyllin I, Palbociclib
Phytochemical Polyphyllin I
Drug Palbociclib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result We first time demonstrated PPI can disturb CDK2 function through upregulation of p21. The PPI effect on CDK2 provides a choice for a chemotherapeutic strategy for the elimination of NSCLC. Our study highlighted the clinical significance of simultaneously blocking of CDK2 and CDK4/6 for NSCLC treatment.
Combination Pair ID: 629
Pair Name Kaempferol, Cisplatin
Phytochemical Kaempferol
Drug Cisplatin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Kaempferol overcomes 5-fluorouracil resistance in human resistant LS174 colon cancer cells
Combination Pair ID: 985
Pair Name Fisetin, Paclitaxel
Phytochemical Fisetin
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Our study shows that PTX-FA and Fis-FA PBM NPs directly target platinum-resistant OvCa cells, induce cytotoxic/apoptotic effects, and reverse multi-drug resistance (MDR). These findings allow us to create new clinical applications using PTX-FA and Fis-FA combination nanoparticles to treat drug-resistant cancers.
Combination Pair ID: 644
Pair Name Scutellarin, Cisplatin
Phytochemical Scutellarin
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result This study identifies the unique role of scutellarin in reversing cisplatin resistance through apoptosis and autophagy, and suggests that combined cisplatin and scutellarin might be a novel therapeutic strategy for patients with NSCLC.
Combination Pair ID: 650
Pair Name Amentoflavone, Sorafenib
Phytochemical Amentoflavone
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Amentoflavone not only reversed sorafenib-induced anti-apoptotic protein levels but also enhanced sorafenib-induced pro-apoptotic protein expression in SK-Hep1R cells. In conclusion, amentoflavone may be used as a sorafenib sensitizer to enhance sorafenib-induced cytotoxicity and trigger sorafenib-induced apoptosis through extrinsic and intrinsic pathways in SK-Hep1R cells.
Combination Pair ID: 105
Pair Name Chrysin, Fluorouracil
Phytochemical Chrysin
Drug Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Potentiating activities of chrysin in the therapeutic efficacy of 5-fluorouracil in gastric cancer cells
Combination Pair ID: 106
Pair Name Liquiritin, Cisplatin
Phytochemical Liquiritin
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Liquiritin induces apoptosis and autophagy in cisplatin (DDP)-resistant gastric cancer cells in vitro and xenograft nude mice in vivo
Combination Pair ID: 670
Pair Name Gambogic acid, Cisplatin
Phytochemical Gambogic acid
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Our results demonstrate that GA may be a new potent therapeutic agent useful for targeting human OS cells.
Combination Pair ID: 172
Pair Name Artesunate, Venetoclax
Phytochemical Artesunate
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result We provide a new triple combination for AML treatment by targeting the Noxa/Mcl-1/Bim axis to reverse Mcl-1/p-Chk1 resistance of cytarabine therapy.
Combination Pair ID: 188
Pair Name Ursolic acid, Oxaliplatin
Phytochemical Ursolic acid
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result Our study provided evidence that ursolic acid enhances the therapeutic effects of oxaliplatin in colorectal cancer by ROS-mediated inhibition of drug resistance.
Combination Pair ID: 692
Pair Name Curcumol, TNF-related apoptosis inducing ligand
Phytochemical Curcumol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result This study characterizes the functional role of NQO2 in TRAIL resistance and the sensitizing function of curcumol by directly targeting NQO2, highlighting the potential of using curcumol as an NQO2 inhibitor for clinical treatment of TRAIL-resistant cancers.
Combination Pair ID: 229
Pair Name Tanshinone I, Epirubicin
Phytochemical Tanshinone I
Drug Epirubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our results suggested that Tan I could effectively improve the anti-tumor effect of EADM, and synergize EADM to reverse HIF-1α mediated resistance via targeting PI3K/AKT/HIF-1α signaling pathway.
Combination Pair ID: 713
Pair Name Beta-Elemene, Oxaliplatin
Phytochemical Beta-Elemene
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our findings show that β-elemene can block the reduction of CTR1 resulting from oxaliplatin treatment, and therefore has a synergistic anti-HCC effect with oxaliplatin by enhancing cellular uptake of oxaliplatin. The synergistic effects of β-elemene and oxaliplatin deserve further evaluation in clinical settings.
Combination Pair ID: 737
Pair Name Aloe emodin, Doxorubicin
Phytochemical Aloe emodin
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our study indicated that AE could be a potential reversal agent to resensitize ADR resistant in tumor chemotherapy and inhibiting autophagy might be an effective strategy to further enhance the reversal activity of AE.
Combination Pair ID: 770
Pair Name Mitocurcumin, Cytarabine
Phytochemical Mitocurcumin
Drug Cytarabine
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis.
Combination Pair ID: 337
Pair Name Decursin, Doxorubicin
Phytochemical Decursin
Drug Doxorubicin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-3 Activity
Result AGN would be a potentially novel treatment option for multidrug-resistant tumors by sensitizing to anticancer agents.
Combination Pair ID: 362
Pair Name Oleanolic Acid, Cisplatin
Phytochemical Oleanolic Acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result OLO-2 treatment also exhibited up to 4.6-fold selectivity against human lung adenocarcinoma cells. Taken together, the results of the present study shed light on the drug resistance-reversing effects of OLO-2 in lung cancer cells.
Combination Pair ID: 829
Pair Name Demethoxycurcumin, Cisplatin
Phytochemical Demethoxycurcumin
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result The findings from the present study suggested that DMC in combination with DDP may be considered as a novel combination regimen for restoring DDP sensitivity in DDP-resistant NSCLC cells.
Combination Pair ID: 871
Pair Name Shogaol, TNF-related apoptosis inducing ligand
Phytochemical Shogaol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result This study gives rise to the possibility of applying shogaol as an antitumor agent that can be used for the purpose of combination treatment with TRAIL in TRAIL-resistant colon tumor therapy.
Combination Pair ID: 552
Pair Name Sulforaphane, Temozolomide
Phytochemical Sulforaphane
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result The present study suggests that the clinical efficacy of TMZ-based chemotherapy in TMZ-resistant GBM may be improved by combination with SFN.
Combination Pair ID: 917
Pair Name 2,3,5,6-Tetramethylpyrazine, Cisplatin
Phytochemical 2,3,5,6-Tetramethylpyrazine
Drug Cisplatin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result A series of ligustrazine-derived chalcones-modified platinum(IV) complexes were synthesized and evaluated for their anti-proliferative potency and generated an optimal platinum(IV) complex 16a. The above-described results indicated that 16a obtained different anti-cancer mechanisms of CDDP, which could initiate mitochondria-dependent apoptosis and xCT-GPX4 axial-mediated ferroptosis in PANC-1/CDDP cells.
Combination Pair ID: 596
Pair Name Cordycepin, Cisplatin
Phytochemical Cordycepin
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Our results suggested that Cor in combination with DDP could be an additional therapeutic option for the treatment of DDP-resistant NSCLC.
Combination Pair ID: 609
Pair Name Noscapine, Docetaxel
Phytochemical Noscapine
Drug Docetaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-3 Expression
Result Chemo-sensitizing effect of Nos followed by DTX regime provide a promising chemotherapeutic strategy and its significant role for the treatment of drug-resistant TNBC.
Combination Pair ID: 612
Pair Name Platycodin D, Histone deacetylase inhibitor
Phytochemical Platycodin D
Drug Histone deacetylase inhibitor
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Platycodin D reverses histone deacetylase inhibitor resistance in hepatocellular carcinoma cells by repressing ERK1/2-mediated cofilin-1 phosphorylation
Combination Pair ID: 733
Pair Name Shikonin, Gefitinib
Phytochemical Shikonin
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-3 Cleavage
Result Shikonin-induced cell apoptosis is closely associated with ROS elevation in the cells. These findings indicate that Shikonin can be an effective small molecule treating gefitinib-resistant NSCLC.
03. Reference
No. Title Href
1 P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin. Biomed Res Int. 2019 Nov 6;2019:6407210. doi: 10.1155/2019/6407210. Click
2 Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells. J Food Sci. 2021 Jun;86(6):2700-2712. doi: 10.1111/1750-3841.15740. Click
3 Chrysin attenuates paclitaxel-induced hepatorenal toxicity in rats by suppressing oxidative damage, inflammation, and apoptosis. Life Sci. 2023 Nov 1;332:122096. doi: 10.1016/j.lfs.2023.122096. Click
4 The Effect of Calycosin-7-O-β-D-Glucoside and its Synergistic Augmentation of Cisplatin-induced Apoptosis in SK-OV-3 Cells. Curr Pharm Des. 2022;28(26):2161-2166. doi: 10.2174/1381612828666220610164100. Click
5 Molecular mechanism of ion channel protein TMEM16A regulated by natural product of narirutin for lung cancer adjuvant treatment. Int J Biol Macromol. 2022 Dec 31;223(Pt A):1145-1157. doi: 10.1016/j.ijbiomac.2022.11.123. Click
6 Synergistic anticancer effect of flavonoids from Sophora alopecuroides with Sorafenib against hepatocellular carcinoma. Phytother Res. 2023 Feb;37(2):592-610. doi: 10.1002/ptr.7637. Click
7 Anticancer and apoptotic activities of parthenolide in combination with epirubicin in mda-mb-468 breast cancer cells. Mol Biol Rep. 2020 Aug;47(8):5807-5815. doi: 10.1007/s11033-020-05649-3. Click
8 Oleanolic acid increases the anticancer potency of doxorubicin in pancreatic cancer cells. J Biochem Mol Toxicol. 2023 Oct;37(10):e23426. doi: 10.1002/jbt.23426. Click
9 Ilexgenin A exerts anti-inflammation and anti-angiogenesis effects through inhibition of STAT3 and PI3K pathways and exhibits synergistic effects with Sorafenib on hepatoma growth. Toxicol Appl Pharmacol. 2017 Jan 15;315:90-101. doi: 10.1016/j.taap.2016.12.008. Click
10 Effects of combined treatment with Indomethacin and Juglone on AOM/DSS induced colon carcinogenesis in Balb/c mice: Roles of inflammation and apoptosis. Life Sci. 2021 Jan 1;264:118657. doi: 10.1016/j.lfs.2020.118657. Click
11 Protective effect of Chlorogenic acid against methotrexate induced oxidative stress, inflammation and apoptosis in rat liver: An experimental approach. Chem Biol Interact. 2017 Jun 25;272:80-91. doi: 10.1016/j.cbi.2017.05.002. Click
12 The potential effect of Schisandrin-B combination with panitumumab in wild-type and mutant colorectal cancer cell lines: Role of apoptosis and autophagy. J Biochem Mol Toxicol. 2023 May;37(5):e23324. doi: 10.1002/jbt.23324. Click
13 Synergistic antitumor activity of withaferin A combined with oxaliplatin triggers reactive oxygen species-mediated inactivation of the PI3K/AKT pathway in human pancreatic cancer cells. Cancer Lett. 2015 Feb 1;357(1):219-230. doi: 10.1016/j.canlet.2014.11.026. Click
14 Exosomes released from U87 glioma cells treated with curcumin and/or temozolomide produce apoptosis in naive U87 cells. Pathol Res Pract. 2023 May;245:154427. doi: 10.1016/j.prp.2023.154427. Click
15 Enhanced antitumor activity and attenuated cardiotoxicity of Epirubicin combined with Paeonol against breast cancer. Tumour Biol. 2016 Sep;37(9):12301-12313. doi: 10.1007/s13277-016-5088-9. Click
16 Paeonol Protects Against Methotrexate-Induced Nephrotoxicity via Upregulation of P-gp Expression and Inhibition of TLR4/NF-κB Pathway. Front Pharmacol. 2022 Feb 4;13:774387. doi: 10.3389/fphar.2022.774387. Click
17 Mangiferin Ameliorates Cisplatin Induced Acute Kidney Injury by Upregulating Nrf-2 via the Activation of PI3K and Exhibits Synergistic Anticancer Activity With Cisplatin. Front Pharmacol. 2018 Jun 18;9:638. doi: 10.3389/fphar.2018.00638. Click
18 Combination of 7-hydroxycoumarin in a platinum(IV) complex derived from cisplatin enhanced cytotoxicity with multiple mechanisms of action. J Inorg Biochem. 2018 Sep;186:17-23. doi: 10.1016/j.jinorgbio.2018.05.015. Click
19 [10]-Gingerol improves doxorubicin anticancer activity and decreases its side effects in triple negative breast cancer models. Cell Oncol (Dordr). 2020 Oct;43(5):915-929. doi: 10.1007/s13402-020-00539-z. Click
20 Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. Click
21 Magnoflorine improves sensitivity to doxorubicin (DOX) of breast cancer cells via inducing apoptosis and autophagy through AKT/mTOR and p38 signaling pathways. Biomed Pharmacother. 2020 Jan;121:109139. doi: 10.1016/j.biopha.2019.109139. Click
22 Levistolide A synergistically enhances doxorubicin‑induced apoptosis of k562/dox cells by decreasing MDR1 expression through the ubiquitin pathway. Oncol Rep. 2019 Feb;41(2):1198-1208. doi: 10.3892/or.2018.6889. Click
23 Homoharringtonine and SAHA synergistically enhance apoptosis in human acute myeloid leukemia cells through upregulation of TRAIL and death receptors. Mol Med Rep. 2013 Jun;7(6):1838-44. doi: 10.3892/mmr.2013.1440. Click
24 ACC010, a novel BRD4 inhibitor, synergized with homoharringtonine in acute myeloid leukemia with FLT3-ITD. Mol Oncol. 2023 Jul;17(7):1402-1418. doi: 10.1002/1878-0261.13368. Click
25 Piperlongumine synergistically enhances the antitumour activity of sorafenib by mediating ROS-AMPK activation and targeting CPSF7 in liver cancer. Pharmacol Res. 2022 Mar;177:106140. doi: 10.1016/j.phrs.2022.106140. Click
26 The synergistic effects of oxaliplatin and piperlongumine on colorectal cancer are mediated by oxidative stress. Cell Death Dis. 2019 Aug 8;10(8):600. doi: 10.1038/s41419-019-1824-6. Click
27 Halofuginone Sensitizes Lung Cancer Organoids to Cisplatin via Suppressing PI3K/AKT and MAPK Signaling Pathways. Front Cell Dev Biol. 2021 Nov 24;9:773048. doi: 10.3389/fcell.2021.773048. Click
28 Cepharanthine sensitizes human triple negative breast cancer cells to chemotherapeutic agent epirubicin via inducing cofilin oxidation-mediated mitochondrial fission and apoptosis. Acta Pharmacol Sin. 2022 Jan;43(1):177-193. doi: 10.1038/s41401-021-00715-3. Click
29 Synergistic antitumour activity of sorafenib in combination with tetrandrine is mediated by reactive oxygen species (ROS)/Akt signaling. Br J Cancer. 2013 Jul 23;109(2):342-50. doi: 10.1038/bjc.2013.334. Click
30 Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo. Cancer Lett. 2011 May 1;304(1):21-32. doi: 10.1016/j.canlet.2011.01.022. Click
31 Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model. Cancers (Basel). 2019 Jan 7;11(1):49. doi: 10.3390/cancers11010049. Click
32 Trigonelline inhibits Nrf2 via EGFR signalling pathway and augments efficacy of Cisplatin and Etoposide in NSCLC cells. Toxicol In Vitro. 2021 Feb;70:105038. doi: 10.1016/j.tiv.2020.105038. Click
33 Berbamine (BBM), a Natural STAT3 Inhibitor, Synergistically Enhances the Antigrowth and Proapoptotic Effects of Sorafenib on Hepatocellular Carcinoma Cells. ACS Omega. 2020 Sep 18;5(38):24838-24847. doi: 10.1021/acsomega.0c03527. Click
34 Targeting Na+ /K+ -ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma. Br J Pharmacol. 2021 Nov;178(21):4389-4407. doi: 10.1111/bph.15616. Click
35 Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. Click
36 Berberine in combination with cisplatin induces necroptosis and apoptosis in ovarian cancer cells. Biol Res. 2019 Jul 18;52(1):37. doi: 10.1186/s40659-019-0243-6. Click
37 Berbamine Hydrochloride inhibits lysosomal acidification by activating Nox2 to potentiate chemotherapy-induced apoptosis via the ROS-MAPK pathway in human lung carcinoma cells. Cell Biol Toxicol. 2023 Aug;39(4):1297-1317. doi: 10.1007/s10565-022-09756-8. Click
38 5-Fluorouracil Combined with Rutaecarpine Synergistically Suppresses the Growth of Colon Cancer Cells by Inhibiting STAT3. Drug Des Devel Ther. 2023 Mar 30;17:993-1006. doi: 10.2147/DDDT.S402824. Click
39 Activation of notch 3/c-MYC/CHOP axis regulates apoptosis and promotes sensitivity of lung cancer cells to mTOR inhibitor everolimus. Biochem Pharmacol. 2020 May;175:113921. doi: 10.1016/j.bcp.2020.113921. Click
40 Leonurine Promotes Cisplatin Sensitivity in Human Cervical Cancer Cells Through Increasing Apoptosis and Inhibiting Drug-Resistant Proteins. Drug Des Devel Ther. 2020 May 15;14:1885-1895. doi: 10.2147/DDDT.S252112. Click
41 Identification of solamargine as a cisplatin sensitizer through phenotypical screening in cisplatin-resistant NSCLC organoids. Front Pharmacol. 2022 Aug 10;13:802168. doi: 10.3389/fphar.2022.802168. Click
42 Solamargine induces autophagy-mediated apoptosis and enhances bortezomib activity in multiple myeloma. Clin Exp Pharmacol Physiol. 2022 Jun;49(6):674-685. doi: 10.1111/1440-1681.13643. Click
43 Synergistic inhibitory effect of Smo inhibitor jervine and its combination with decitabine can target Hedgehog signaling pathway to inhibit myelodysplastic syndrome cell line. Hematology. 2021 Dec;26(1):518-528. doi: 10.1080/16078454.2021.1950897. Click
44 Sanguinarine Induces Apoptosis Pathway in Multiple Myeloma Cell Lines via Inhibition of the JaK2/STAT3 Signaling. Front Oncol. 2019 Apr 17;9:285. doi: 10.3389/fonc.2019.00285. Click
45 Doxorubicin-sanguinarine nanoparticles: formulation and evaluation of breast cancer cell apoptosis and cell cycle. Drug Dev Ind Pharm. 2024 Jan 5:1-15. doi: 10.1080/03639045.2024.2302557. Click
46 The role of daurisoline treatment in hepatocellular carcinoma: Inhibiting vasculogenic mimicry formation and enhancing sensitivity to sorafenib. Phytomedicine. 2021 Nov;92:153740. doi: 10.1016/j.phymed.2021.153740. Click
47 Dual pH-responsive multifunctional nanoparticles for targeted treatment of breast cancer by combining immunotherapy and chemotherapy. Acta Biomater. 2018 Jan 15;66:310-324. doi: 10.1016/j.actbio.2017.11.010. Click
48 Lentinan Enhances the Function of Oxaliplatin on the Esophageal Tumors by Persuading Immunogenic Cell Death. Comput Math Methods Med. 2023 Oct 4;2023:9827631. doi: 10.1155/2023/9827631. Click
49 Polyphyllin I and VII potentiate the chemosensitivity of A549/DDP cells to cisplatin by enhancing apoptosis, reversing EMT and suppressing the CIP2A/AKT/mTOR signaling axis. Oncol Lett. 2019 Nov;18(5):5428-5436. doi: 10.3892/ol.2019.10895. Click
50 Quercetin enhances adriamycin cytotoxicity through induction of apoptosis and regulation of mitogen-activated protein kinase/extracellular signal-regulated kinase/c-Jun N-terminal kinase signaling in multidrug-resistant leukemia K562 cells. Mol Med Rep. 2015 Jan;11(1):341-8. doi: 10.3892/mmr.2014.2734. Click
51 Quercetin-Induced Glutathione Depletion Sensitizes Colorectal Cancer Cells to Oxaliplatin. Foods. 2023 Apr 21;12(8):1733. doi: 10.3390/foods12081733. Click
52 Luteolin Shifts Oxaliplatin-Induced Cell Cycle Arrest at G₀/G₁ to Apoptosis in HCT116 Human Colorectal Carcinoma Cells. Nutrients. 2019 Apr 2;11(4):770. doi: 10.3390/nu11040770. Click
53 Luteolin Suppresses the Proliferation of Gastric Cancer Cells and Acts in Synergy with Oxaliplatin. Biomed Res Int. 2020 Feb 21;2020:9396512. doi: 10.1155/2020/9396512. Click
54 Baicalin; a promising chemopreventive agent, enhances the antitumor effect of 5-FU against breast cancer and inhibits tumor growth and angiogenesis in Ehrlich solid tumor. Biomed Pharmacother. 2022 Feb;146:112599. doi: 10.1016/j.biopha.2021.112599. Click
55 Synergistic effect of fisetin combined with sorafenib in human cervical cancer HeLa cells through activation of death receptor-5 mediated caspase-8/caspase-3 and the mitochondria-dependent apoptotic pathway. Tumour Biol. 2016 May;37(5):6987-96. doi: 10.1007/s13277-015-4526-4. Click
56 Fisetin, a phytochemical, potentiates sorafenib-induced apoptosis and abrogates tumor growth in athymic nude mice implanted with BRAF-mutated melanoma cells. Oncotarget. 2015 Sep 29;6(29):28296-311. doi: 10.18632/oncotarget.5064. Click
57 Apigenin Sensitizes Huh-7 Human Hepatocellular Carcinoma Cells to TRAIL-induced Apoptosis. Biomol Ther (Seoul). 2012 Jan;20(1):62-7. doi: 10.4062/biomolther.2012.20.1.062. Click
58 Scutellarin resensitizes oxaliplatin-resistant colorectal cancer cells to oxaliplatin treatment through inhibition of PKM2. Mol Ther Oncolytics. 2021 Mar 17;21:87-97. doi: 10.1016/j.omto.2021.03.010. Click
59 Scutellarin synergistically enhances cisplatin effect against ovarian cancer cells through enhancing the ability of cisplatin binding to DNA. Eur J Pharmacol. 2019 Feb 5;844:9-16. doi: 10.1016/j.ejphar.2018.11.040. Click
60 Tangeretin boosts the anticancer activity of metformin in breast cancer cells via curbing the energy production. Phytomedicine. 2021 Mar;83:153470. doi: 10.1016/j.phymed.2021.153470. Click
61 Hesperetin Promotes Cisplatin-Induced Apoptosis of Gastric Cancer In Vitro and In Vivo by Upregulating PTEN Expression. Front Pharmacol. 2020 Aug 27;11:1326. doi: 10.3389/fphar.2020.01326. Click
62 Administration with hyperoside sensitizes breast cancer cells to paclitaxel by blocking the TLR4 signaling. Mol Cell Probes. 2020 Oct;53:101602. doi: 10.1016/j.mcp.2020.101602. Click
63 ROS-mediated activation and mitochondrial translocation of CaMKII contributes to Drp1-dependent mitochondrial fission and apoptosis in triple-negative breast cancer cells by isorhamnetin and chloroquine. J Exp Clin Cancer Res. 2019 May 28;38(1):225. doi: 10.1186/s13046-019-1201-4. Click
64 Isorhamnetin induces cell cycle arrest and apoptosis by triggering DNA damage and regulating the AMPK/mTOR/p70S6K signaling pathway in doxorubicin-resistant breast cancer. Phytomedicine. 2023 Jun;114:154780. doi: 10.1016/j.phymed.2023.154780. Click
65 Anticancer Efficacy and Mechanism of Amentoflavone for Sensitizing Oral Squamous Cell Carcinoma to Cisplatin. Anticancer Res. 2020 Dec;40(12):6723-6732. doi: 10.21873/anticanres.14695. Click
66 Amentoflavone Enhances the Therapeutic Efficacy of Sorafenib by Inhibiting Anti-apoptotic Potential and Potentiating Apoptosis in Hepatocellular Carcinoma In Vivo. Anticancer Res. 2018 Apr;38(4):2119-2125. doi: 10.21873/anticanres.12452. Click
67 Antitumor effects and the underlying mechanism of licochalcone A combined with 5-fluorouracil in gastric cancer cells. Oncol Lett. 2017 Mar;13(3):1695-1701. doi: 10.3892/ol.2017.5614. Click
68 Combined treatment with sorafenib and silibinin synergistically targets both HCC cells and cancer stem cells by enhanced inhibition of the phosphorylation of STAT3/ERK/AKT. Eur J Pharmacol. 2018 Aug 5;832:39-49. doi: 10.1016/j.ejphar.2018.05.027. Click
69 Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines. Mol Med Rep. 2018 Aug;18(2):1835-1841. doi: 10.3892/mmr.2018.9129. Click
70 The Combination of Chrysin and Cisplatin Induces Apoptosis in HepG2 through Down-regulation of cFLIP and Activity of Caspase. Anticancer Agents Med Chem. 2023;23(4):432-439. doi: 10.2174/1871520622666220615121525. Click
71 Combination of chrysin and cisplatin promotes the apoptosis of Hep G2 cells by up-regulating p53. Chem Biol Interact. 2015 May 5;232:12-20. doi: 10.1016/j.cbi.2015.03.003. Click
72 Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation. Biomed Pharmacother. 2017 Sep;93:948-960. doi: 10.1016/j.biopha.2017.06.095. Click
73 Hispidulin Enhances Temozolomide (TMZ)-Induced Cytotoxicity against Malignant Glioma Cells In Vitro by Inhibiting Autophagy. Comput Intell Neurosci. 2022 Jun 28;2022:5266770. doi: 10.1155/2022/5266770. Click
74 Butein sensitizes human leukemia cells to apoptosis induced by tumor necrosis factor-related apoptosis inducing ligand (TRAIL). Arch Pharm Res. 2008 Sep;31(9):1179-86. doi: 10.1007/s12272-001-1286-2. Click
75 Morin enhances auranofin anticancer activity by up-regulation of DR4 and DR5 and modulation of Bcl-2 through reactive oxygen species generation in Hep3B human hepatocellular carcinoma cells. Phytother Res. 2019 May;33(5):1384-1393. doi: 10.1002/ptr.6329. Click
76 Combination treatment with flavonoid morin and telomerase inhibitor MST‑312 reduces cancer stem cell traits by targeting STAT3 and telomerase. Int J Oncol. 2016 Aug;49(2):487-98. doi: 10.3892/ijo.2016.3546. Click
77 Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253. Click
78 Anti-proliferative and anti-apoptotic potential effects of epigallocatechin-3-gallate and/or metformin on hepatocellular carcinoma cells: in vitro study. Mol Biol Rep. 2019 Apr;46(2):2039-2047. doi: 10.1007/s11033-019-04653-6. Click
79 (-)-Epigallocatechin Gallate (EGCG) Enhances the Sensitivity of Colorectal Cancer Cells to 5-FU by Inhibiting GRP78/NF-κB/miR-155-5p/MDR1 Pathway. J Agric Food Chem. 2019 Mar 6;67(9):2510-2518. doi: 10.1021/acs.jafc.8b06665. Click
80 Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63. doi: 10.1038/sj.onc.1210840. Click
81 Combinatorial effect of epigallocatechin-3-gallate and TRAIL on pancreatic cancer cell death. Int J Oncol. 2009 Jan;34(1):281-6. Click
82 EGCG sensitizes human nasopharyngeal carcinoma cells to TRAIL-mediated apoptosis by activation NF-κB. Neoplasma. 2017;64(1):74-80. doi: 10.4149/neo_2017_109. Click
83 EGCG enhances TRAIL-mediated apoptosis in human melanoma A375 cell line. J Huazhong Univ Sci Technolog Med Sci. 2009 Dec;29(6):771-5. doi: 10.1007/s11596-009-0620-4. Click
84 Combinational treatment of 5-fluorouracil and casticin induces apoptosis in mouse leukemia WEHI-3 cells in vitro. Environ Toxicol. 2020 Sep;35(9):911-921. doi: 10.1002/tox.22927. Click
85 Kurarinone Synergizes TRAIL-Induced Apoptosis in Gastric Cancer Cells. Cell Biochem Biophys. 2015 May;72(1):241-9. doi: 10.1007/s12013-014-0444-0. Click
86 Tectorigenin sensitizes paclitaxel-resistant human ovarian cancer cells through downregulation of the Akt and NFκB pathway. Carcinogenesis. 2012 Dec;33(12):2488-98. doi: 10.1093/carcin/bgs302. Click
87 Neobavaisoflavone sensitizes apoptosis via the inhibition of metastasis in TRAIL-resistant human glioma U373MG cells. Life Sci. 2014 Jan 30;95(2):101-7. doi: 10.1016/j.lfs.2013.10.035. Click
88 Irigenin sensitizes TRAIL-induced apoptosis via enhancing pro-apoptotic molecules in gastric cancer cells. Biochem Biophys Res Commun. 2018 Feb 12;496(3):998-1005. doi: 10.1016/j.bbrc.2018.01.003. Click
89 Helichrysetin and TNF‑α synergistically promote apoptosis by inhibiting overactivation of the NF‑κB and EGFR signaling pathways in HeLa and T98G cells. Int J Mol Med. 2021 Apr;47(4):49. doi: 10.3892/ijmm.2021.4882. Click
90 Combination of gambogic acid with cisplatin enhances the antitumor effects on cisplatin-resistant lung cancer cells by downregulating MRP2 and LRP expression. Onco Targets Ther. 2016 Jun 2;9:3359-68. doi: 10.2147/OTT.S100936. Click
91 Quercetin attenuates the cardiotoxicity of doxorubicin-cyclophosphamide regimen and potentiates its chemotherapeutic effect against triple-negative breast cancer. Phytother Res. 2022;36(1):551-561. doi:10.1002/ptr.7342 Click
92 Autophagy flux inhibition mediated by celastrol sensitized lung cancer cells to TRAIL‑induced apoptosis via regulation of mitochondrial transmembrane potential and reactive oxygen species. Mol Med Rep. 2019 Feb;19(2):984-993. doi: 10.3892/mmr.2018.9757. Click
93 Celastrol enhances TRAIL-induced apoptosis in human glioblastoma via the death receptor pathwayCelastrol enhances TRAIL-induced apoptosis in human glioblastoma via the death receptor pathway. Cancer Chemother Pharmacol. 2019 Oct;84(4):719-728. doi: 10.1007/s00280-019-03900-8. Click
94 Celastrol enhances tamoxifen sensitivity in the treatment of triple negative breast cancer via mitochondria mediated apoptosis pathway. Am J Transl Res. 2023 Apr 15;15(4):2703-2715. Click
95 Dihydroartemisinin enhances the anti-tumor activity of oxaliplatin in colorectal cancer cells by altering PRDX2-reactive oxygen species-mediated multiple signaling pathways. Phytomedicine. 2022 Apr;98:153932. doi: 10.1016/j.phymed.2022.153932. Click
96 Dihydroartemisinin Induced Apoptosis and Synergized With Chemotherapy in Pleural Effusion Lymphoma Cells. Anticancer Res. 2023 Mar;43(3):1139-1148. doi: 10.21873/anticanres.16259. Click
97 Resveratrol enhances the antitumor effects of temozolomide in glioblastoma via ROS-dependent AMPK-TSC-mTOR signaling pathway. CNS Neurosci Ther. 2012;18(7):536-546. doi:10.1111/j.1755-5949.2012.00319.x Click
98 Artesunate exhibits synergistic anti-cancer effects with cisplatin on lung cancer A549 cells by inhibiting MAPK pathway. Gene. 2021 Jan 15;766:145134. doi: 10.1016/j.gene.2020.145134. Click
99 Artesunate synergistically promotes sorafenib‑induced apoptosis and ferroptosis in non‑Hodgkin lymphoma cells through inhibition of the STAT3 pathway. Oncol Rep. 2023 Jul;50(1):147. doi: 10.3892/or.2023.8584. Click
100 Mesenchymal-epithelial transition and AXL inhibitor TP-0903 sensitise triple-negative breast cancer cells to the antimalarial compound, artesunate. Sci Rep. 2024 Jan 3;14(1):425. doi: 10.1038/s41598-023-50710-3. Click
101 Combined Parthenolide and Balsalazide Have Enhanced Antitumor Efficacy Through Blockade of NF-κB Activation. Mol Cancer Res. 2017 Feb;15(2):141-151. doi: 10.1158/1541-7786.MCR-16-0101. Click
102 Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195. Click
103 Astragaloside IV enhanced carboplatin sensitivity in prostate cancer by suppressing AKT/NF-κB signaling pathway. Biochem Cell Biol. 2021 Apr;99(2):214-222. doi: 10.1139/bcb-2020-0026. Click
104 Astragaloside IV enhances the sensibility of lung adenocarcinoma cells to bevacizumab by inhibiting autophagy. Drug Dev Res. 2022 Apr;83(2):461-469. doi: 10.1002/ddr.21878. Click
105 Ursolic acid enhances the antitumor effects of sorafenib associated with Mcl-1-related apoptosis and SLC7A11-dependent ferroptosis in human cancer. Pharmacol Res. 2022 Aug;182:106306. doi: 10.1016/j.phrs.2022.106306. Click
106 Ursolic acid potentiated oxaliplatin to induce apoptosis in colorectal cancer RKO cells. Pharmazie. 2020 Jun 1;75(6):246-249. doi: 10.1691/ph.2020.0417. Click
107 Synergism of ursolic acid and cisplatin promotes apoptosis and enhances growth inhibition of cervical cancer cells via suppressing NF-κB p65. Oncotarget. 2017 Oct 30;8(57):97416-97427. doi: 10.18632/oncotarget.22133. Click
108 Identification of a novel oxidative stress induced cell death by Sorafenib and oleanolic acid in human hepatocellular carcinoma cells. Biochem Pharmacol. 2016 Oct 15;118:9-17. doi: 10.1016/j.bcp.2016.08.011. Click
109 Tanshinone IIA combined with cisplatin synergistically inhibits non-small-cell lung cancer in vitro and in vivo via down-regulating the phosphatidylinositol 3-kinase/Akt signalling pathway. Phytother Res. 2019 Sep;33(9):2298-2309. doi: 10.1002/ptr.6392. Click
110 Tanshinone IIA combined with cisplatin synergistically inhibits non-small-cell lung cancer in vitro and in vivo via down-regulating the phosphatidylinositol 3-kinase/Akt signalling pathway. Phytother Res. 2019 Sep;33(9):2298-2309. doi: 10.1002/ptr.6392. Click
111 Astaxanthin decreases the growth-inhibitory dose of cytarabine and inflammatory response in the acute lymphoblastic leukemia cell line NALM-6. Mol Biol Rep. 2022 Jul;49(7):6415-6422. doi: 10.1007/s11033-022-07452-8. Click
112 The combination of gemcitabine and ginsenoside Rh2 enhances the immune function of dendritic cells against pancreatic cancer via the CARD9-BCL10-MALT1 / NF-κB pathway. Clin Immunol. 2023 Mar;248:109217. doi: 10.1016/j.clim.2022.109217. Click
113 Combined Effect of Sodium Selenite and Ginsenoside Rh2 on HCT116 Human Colorectal Carcinoma Cells. Arch Iran Med. 2016 Jan;19(1):23-9. Click
114 Synergistic anticancer activity of 20(S)-Ginsenoside Rg3 and Sorafenib in hepatocellular carcinoma by modulating PTEN/Akt signaling pathway. Biomed Pharmacother. 2018 Jan;97:1282-1288. doi: 10.1016/j.biopha.2017.11.006. Click
115 Ginsenoside Rg3 overcomes tamoxifen resistance through inhibiting glycolysis in breast cancer cells. Cell Biol Int. 2024 Jan 15. doi: 10.1002/cbin.12123. Click
116 20(s)-ginsenoside Rh2 promotes TRAIL-induced apoptosis by upregulating DR5 in human hepatocellular carcinoma cells. Med Oncol. 2022 May 15;39(5):70. doi: 10.1007/s12032-022-01663-6. Click
117 Ginsenoside RG1 augments doxorubicin-induced apoptotic cell death in MDA-MB-231 breast cancer cell lines. J Biochem Mol Toxicol. 2022 Jan;36(1):e22945. doi: 10.1002/jbt.22945. Click
118 Regorafenib and ginsenoside combination therapy: inhibition of HepG2 cell growth through modulating survivin and caspase-3 gene expression. Clin Transl Oncol. 2020 Sep;22(9):1491-1498. doi: 10.1007/s12094-019-02283-9. Click
119 Involvement of Mitochondrial Damage and Oxidative Stress in Apoptosis Induced by Betulin Plus Arsenic Trioxide in Neuroblastoma Cells. Anticancer Res. 2023 Jun;43(6):2467-2476. doi: 10.21873/anticanres.16414. Click
120 Betulinic acid restores imatinib sensitivity in BCR-ABL1 kinase-independent, imatinib-resistant chronic myeloid leukemia by increasing HDAC3 ubiquitination and degradation. Ann N Y Acad Sci. 2020 May;1467(1):77-93. doi: 10.1111/nyas.14298. Click
121 Sorafenib and CuB exert synergistic antitumor effects against hepatocellular carcinoma cells via inhibition of STAT3 phosphorylation. FEBS Open Bio. 2021 Jan;11(1):133-145. doi: 10.1002/2211-5463.13035. Click
122 Toosendanin, a late-stage autophagy inhibitor, sensitizes triple-negative breast cancer to irinotecan chemotherapy. Chin Med. 2022 May 6;17(1):55. doi: 10.1186/s13020-022-00605-8. Click
123 Synergistic Anti-Tumor Effect of Toosendanin and Paclitaxel on Triple-Negative Breast Cancer via Regulating ADORA2A-EMT Related Signaling. Adv Biol (Weinh). 2023 Aug;7(8):e2300062. doi: 10.1002/adbi.202300062. Click
124 Curcumol Synergizes with Cisplatin in Osteosarcoma by Inhibiting M2-like Polarization of Tumor-Associated Macrophages. Molecules. 2022 Jul 6;27(14):4345. doi: 10.3390/molecules27144345. Click
125 Use of Saikosaponin D and JNK inhibitor SP600125, alone or in combination, inhibits malignant properties of human osteosarcoma U2 cells. Am J Transl Res. 2019 Apr 15;11(4):2070-2080. Click
126 Carnosic acid cooperates with tamoxifen to induce apoptosis associated with Caspase-3 activation in breast cancer cells in vitro and in vivo. Biomed Pharmacother. 2017 May;89:827-837. doi: 10.1016/j.biopha.2017.01.084. Click
127 Costunolide promotes imatinib-induced apoptosis in chronic myeloid leukemia cells via the Bcr/Abl-Stat5 pathway. Phytother Res. 2018 Sep;32(9):1764-1769. doi: 10.1002/ptr.6106. Click
128 Costunolide enhances sensitivity of K562/ADR chronic myeloid leukemia cells to doxorubicin through PI3K/Akt pathway. Phytother Res. 2019 Jun;33(6):1683-1688. doi: 10.1002/ptr.6355. Click
129 β-elemene reverses the drug resistance of lung cancer A549/DDP cells via the mitochondrial apoptosis pathway. Oncol Rep. 2014 May;31(5):2131-8. doi: 10.3892/or.2014.3083. Click
130 beta-Elemene, a novel plant-derived antineoplastic agent, increases cisplatin chemosensitivity of lung tumor cells by triggering apoptosis. Oncol Rep. 2009 Jul;22(1):161-70. doi: 10.3892/or_00000420. Click
131 β-elemene enhances cisplatin-induced apoptosis in bladder cancer cells through the ROS-AMPK signaling pathway. Oncol Lett. 2020 Jan;19(1):291-300. doi: 10.3892/ol.2019.11103. Click
132 Evaluation of cisplatin in combination with β-elemene as a regimen for prostate cancer chemotherapy. Basic Clin Pharmacol Toxicol. 2010 Nov;107(5):868-76. doi: 10.1111/j.1742-7843.2010.00592.x. Click
133 β-Elemene promotes cisplatin-induced cell death in human bladder cancer and other carcinomas. Anticancer Res. 2013 Apr;33(4):1421-8. Click
134 Synergistic Cytotoxicity of β-Elemene and Cisplatin in Gingival Squamous Cell Carcinoma by Inhibition of STAT3 Signaling Pathway. Med Sci Monit. 2017 Mar 29;23:1507-1513. doi: 10.12659/msm.903783. Click
135 Enhancement of cisplatin-induced apoptosis by β-elemene in resistant human ovarian cancer cells. Med Oncol. 2013 Mar;30(1):424. doi: 10.1007/s12032-012-0424-4. Click
136 β-elemene increases the sensitivity of gastric cancer cells to TRAIL by promoting the formation of DISC in lipid rafts. Cell Biol Int. 2018 Sep;42(10):1377-1385. doi: 10.1002/cbin.11023. Click
137 Ginkgolide B Regulates CDDP Chemoresistance in Oral Cancer via the Platelet-Activating Factor Receptor Pathway. Cancers (Basel). 2021 Dec 15;13(24):6299. doi: 10.3390/cancers13246299. Click
138 Atractylenolide I inhibits EMT and enhances the antitumor effect of cabozantinib in prostate cancer via targeting Hsp27. Front Oncol. 2023 Jan 6;12:1084884. doi: 10.3389/fonc.2022.1084884. Click
139 Oleuropein potentiates anti-tumor activity of cisplatin against HepG2 through affecting proNGF/NGF balance. Life Sci. 2018 Apr 1;198:87-93. doi: 10.1016/j.lfs.2018.02.027. Click
140 Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel. Genes (Basel). 2022 Jun 24;13(7):1142. doi: 10.3390/genes13071142. Click
141 Combination of Nimbolide and TNF-α-Increases Human Colon Adenocarcinoma Cell Death through JNK-mediated DR5 Up- regulation. Asian Pac J Cancer Prev. 2016;17(5):2637-41. Click
142 Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage. Thorac Cancer. 2023 Jul;14(21):2007-2017. doi: 10.1111/1759-7714.14982. Click
143 Chemopreventive effect of α-hederin/carboplatin combination against experimental colon hyperplasia and impact on JNK signaling. Toxicol Mech Methods. 2021 Feb;31(2):138-149. doi: 10.1080/15376516.2020.1849483. Click
144 The Novel Autophagy Inhibitor Alpha-Hederin Promoted Paclitaxel Cytotoxicity by Increasing Reactive Oxygen Species Accumulation in Non-Small Cell Lung Cancer Cells. Int J Mol Sci. 2018 Oct 18;19(10):3221. doi: 10.3390/ijms19103221. Click
145 Combining α-Hederin with cisplatin increases the apoptosis of gastric cancer in vivo and in vitro via mitochondrial related apoptosis pathway. Biomed Pharmacother. 2019 Dec;120:109477. doi: 10.1016/j.biopha.2019.109477. Click
146 Combining α-Hederin with cisplatin increases the apoptosis of gastric cancer in vivo and in vitro via mitochondrial related apoptosis pathway. Biomed Pharmacother. 2019 Dec;120:109477. doi: 10.1016/j.biopha.2019.109477. Click
147 Caspase-mediated pro-apoptotic interaction of panaxadiol and irinotecan in human colorectal cancer cells. J Pharm Pharmacol. 2012 May;64(5):727-34. doi: 10.1111/j.2042-7158.2012.01463.x. Epub 2012 Feb 21. Click
148 Gypenosides Synergistically Enhances the Anti-Tumor Effect of 5-Fluorouracil on Colorectal Cancer In Vitro and In Vivo: A Role for Oxidative Stress-Mediated DNA Damage and p53 Activation. PLoS One. 2015 Sep 14;10(9):e0137888. doi: 10.1371/journal.pone.0137888. Click
149 Sclareolide enhances gemcitabine‑induced cell death through mediating the NICD and Gli1 pathways in gemcitabine‑resistant human pancreatic cancer. Mol Med Rep. 2017 Apr;15(4):1461-1470. doi: 10.3892/mmr.2017.6182. Click
150 Curcumenol Targeting YWHAG Inhibits the Pentose Phosphate Pathway and Enhances Antitumor Effects of Cisplatin. Evid Based Complement Alternat Med. 2022 Jun 26;2022:3988916. doi: 10.1155/2022/3988916. Click
151 SB365, Pulsatilla Saponin D Induces Caspase-Independent Cell Death and Augments the Anticancer Effect of Temozolomide in Glioblastoma Multiforme Cells. Molecules. 2019 Sep 5;24(18):3230. doi: 10.3390/molecules24183230. Click
152 Inactivation of AKT/NF‑κB signaling by eurycomalactone decreases human NSCLC cell viability and improves the chemosensitivity to cisplatin. Oncol Rep. 2020 Oct;44(4):1441-1454. doi: 10.3892/or.2020.7710. Click
153 Furanodiene enhances the anti-cancer effects of doxorubicin on ERα-negative breast cancer cells in vitro. Eur J Pharmacol. 2016 Mar 5;774:10-9. doi: 10.1016/j.ejphar.2015.11.039. Click
154 Britannin a Sesquiterpene Lactone from Inula aucheriana Exerted an Anti-leukemic Effect in Acute Lymphoblastic Leukemia (ALL) Cells and Enhanced the Sensitivity of the Cells to Vincristine. Nutr Cancer. 2022;74(3):965-977. doi: 10.1080/01635581.2021.1931700. Click
155 Shikonin and 4-hydroxytamoxifen synergistically inhibit the proliferation of breast cancer cells through activating apoptosis signaling pathway in vitro and in vivo. Chin Med. 2020 Mar 10;15:23. doi: 10.1186/s13020-020-00305-1. Click
156 Enhancement of cisplatin-induced colon cancer cells apoptosis by shikonin, a natural inducer of ROS in vitro and in vivo. Biochem Biophys Res Commun. 2016 Jan 22;469(4):1075-82. doi: 10.1016/j.bbrc.2015.12.100. Click
157 Shikonin sensitizes A549 cells to TRAIL-induced apoptosis through the JNK, STAT3 and AKT pathways. BMC Cell Biol. 2018 Dec 29;19(1):29. doi: 10.1186/s12860-018-0179-7. Click
158 Shikonin suppresses tumor growth and synergizes with gemcitabine in a pancreatic cancer xenograft model: Involvement of NF-κB signaling pathway. Biochem Pharmacol. 2014 Apr 1;88(3):322-33. doi: 10.1016/j.bcp.2014.01.041. Click
159 Emodin Sensitizes Cervical Cancer Cells to Vinblastine by Inducing Apoptosis and Mitotic Death. Int J Mol Sci. 2022 Jul 31;23(15):8510. doi: 10.3390/ijms23158510. Click
160 Emodin and Its Combination with Cytarabine Induce Apoptosis in Resistant Acute Myeloid Leukemia Cells in Vitro and in Vivo. Cell Physiol Biochem. 2018;48(5):2061-2073. doi: 10.1159/000492544. Click
161 Effects and mechanisms of trifluridine alone or in combination with cryptotanshinone in inhibiting malignant biological behavior of gastric cancer. Cell Cycle. 2023 Jun;22(12):1463-1477. doi: 10.1080/15384101.2023.2215678. Click
162 Cryptotanshinone strengthens the effect of gefitinib against non-small cell lung cancer through inhibiting transketolase. Eur J Pharmacol. 2021 Jan 5;890:173647. doi: 10.1016/j.ejphar.2020.173647. Click
163 Tanshinone IIA enhances the inhibitory effect of imatinib on proliferation and motility of acute leukemia cell line TIB‑152 in vivo and in vitro by inhibiting the PI3K/AKT/mTOR signaling pathway. Oncol Rep. 2020 Feb;43(2):503-515. doi: 10.3892/or.2019.7453. Click
164 Synergistic antitumor effects of rhein and doxorubicin in hepatocellular carcinoma cells. J Cell Biochem. 2020 Oct;121(10):4009-4021. doi: 10.1002/jcb.27514. Click
165 Dihydrotanshinone exerts antitumor effects and improves the effects of cisplatin in anaplastic thyroid cancer cells. Oncol Rep. 2021 Sep;46(3):204. doi: 10.3892/or.2021.8155. Click
166 Synergistic Role of Thymoquinone on Anticancer Activity of 5-Fluorouracil in Triple Negative Breast Cancer Cells. Anticancer Agents Med Chem. 2022;22(6):1111-1118. doi: 10.2174/1871520621666210624111613. Click
167 Thymoquinone Potentiates Methotrexate Mediated-Apoptosis in Saos-2 Osteosarcoma Cell Line. Drug Res (Stuttg). 2022 Sep;72(7):390-395. doi: 10.1055/a-1842-7545. Click
168 Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-κB regulated gene products in multiple myeloma xenograft mouse model. Oncotarget. 2014 Feb 15;5(3):634-48. doi: 10.18632/oncotarget.1596. Click
169 Enhanced cytotoxicity and apoptosis by thymoquinone in combination with zoledronic acid in hormone- and drug-resistant prostate cancer cell lines. J BUON. 2014 Oct-Dec;19(4):1055-61. Click
170 Antiproliferative and proapoptotic effects of topotecan in combination with thymoquinone on acute myelogenous leukemia. Clin Lymphoma Myeloma Leuk. 2014 Sep;14 Suppl:S46-55. doi: 10.1016/j.clml.2014.04.014. Erratum in: Clin Lymphoma Myeloma Leuk. 2015 Jun;15(6):384. Click
171 The effect of thymoquinone and propranolol combination on epidermoid laryngeal carcinoma cell. Eur Arch Otorhinolaryngol. 2023 Jun;280(6):2849-2858. doi: 10.1007/s00405-023-07825-0. Click
172 Thymoquinone induces apoptosis in temozolomide-resistant glioblastoma cells via the p38 mitogen-activated protein kinase signaling pathway. Environ Toxicol. 2023 Jan;38(1):90-100. doi: 10.1002/tox.23664. Click
173 Aloin and CPT-11 combination activates miRNA-133b and downregulates IGF1R- PI3K/AKT/mTOR and MEK/ERK pathways to inhibit colorectal cancer progression. Biomed Pharmacother. 2023 Dec 31;169:115911. doi: 10.1016/j.biopha.2023.115911. Click
174 Combinatorial Cytotoxic Effects of Damnacanthal and Doxorubicin against Human Breast Cancer MCF-7 Cells in Vitro. Molecules. 2016 Sep 14;21(9):1228. doi: 10.3390/molecules21091228. Click
175 Improved effects of honokiol on temozolomide-induced autophagy and apoptosis of drug-sensitive and -tolerant glioma cells. BMC Cancer. 2018 Apr 3;18(1):379. doi: 10.1186/s12885-018-4267-z. Click
176 Synergistic effect of honokiol and 5-fluorouracil on apoptosis of oral squamous cell carcinoma cells. J Oral Pathol Med. 2017 Mar;46(3):201-207. doi: 10.1111/jop.12481. Click
177 Chlorogenic Acid Enhances Doxorubicin-Mediated Cytotoxic Effect in Osteosarcoma Cells. Int J Mol Sci. 2021 Aug 10;22(16):8586. doi: 10.3390/ijms22168586. Click
178 Rosmarinic acid suppresses inflammation, angiogenesis, and improves paclitaxel induced apoptosis in a breast cancer model via NF3 κB-p53-caspase-3 pathways modulation. J Appl Biomed. 2021 Dec;19(4):202-209. doi: 10.32725/jab.2021.024. Click
179 Anti-cancer effect of combined action of anti-MUC1 and rosmarinic acid in AGS gastric cancer cells. Eur J Pharmacol. 2021 Jul 5;902:174119. doi: 10.1016/j.ejphar.2021.174119. Click
180 Caffeic Acid Phenethyl Ester as a DHODH Inhibitor and Its Synergistic Anticancer Properties in Combination with 5-Fluorouracil in a Breast Cancer Cell Line. J Exp Pharmacol. 2022 Jul 23;14:243-253. doi: 10.2147/JEP.S365159. Click
181 Caffeic acid phenethyl ester targets ubiquitin-specific protease 8 and synergizes with cisplatin in endometrioid ovarian carcinoma cells. Biochem Pharmacol. 2022 Mar;197:114900. doi: 10.1016/j.bcp.2021.114900. Click
182 Synergistic Anticancer Activity of Combined Use of Caffeic Acid with Paclitaxel Enhances Apoptosis of Non-Small-Cell Lung Cancer H1299 Cells in Vivo and in Vitro. Cell Physiol Biochem. 2018;48(4):1433-1442. doi: 10.1159/000492253. Click
183 Effect of combined treatment with lobaplatin and osthole on inducing apoptosis and inhibiting proliferation in human breast cancer MDA-MB-231 cells. Med Oncol. 2021 Nov 27;39(1):16. doi: 10.1007/s12032-021-01609-4. Click
184 Coumarins modulate the anti-glioma properties of temozolomide. Eur J Pharmacol. 2020 Aug 15;881:173207. doi: 10.1016/j.ejphar.2020.173207. Click
185 Eugenol Exerts Apoptotic Effect and Modulates the Sensitivity of HeLa Cells to Cisplatin and Radiation. Molecules. 2019 Nov 3;24(21):3979. doi: 10.3390/molecules24213979. Click
186 Eugenol potentiates cisplatin anti-cancer activity through inhibition of ALDH-positive breast cancer stem cells and the NF-κB signaling pathway. Mol Carcinog. 2018 Mar;57(3):333-346. doi: 10.1002/mc.22758. Click
187 Novel TRAIL sensitizer Taraxacum officinale F.H. Wigg enhances TRAIL-induced apoptosis in Huh7 cells. Mol Carcinog. 2016;55(4):387-396. doi:10.1002/mc.22288 Click
188 Decursin and Doxorubicin Are in Synergy for the Induction of Apoptosis via STAT3 and/or mTOR Pathways in Human Multiple Myeloma Cells. Evid Based Complement Alternat Med. 2013;2013:506324. doi: 10.1155/2013/506324. Click
189 Angelicin potentiates TRAIL-induced apoptosis in renal carcinoma Caki cells through activation of caspase 3 and down-regulation of c-FLIP expression. Drug Dev Res. 2018 Feb;79(1):3-10. doi: 10.1002/ddr.21414. Click
190 Combination Treatment of Sorafenib and Bufalin Induces Apoptosis in NCI-H292 Human Lung Cancer Cells In Vitro. In Vivo. 2022 Mar-Apr;36(2):582-595. doi: 10.21873/invivo.12741. Click
191 Bufalin induces the apoptosis of acute promyelocytic leukemia cells via the downregulation of survivin expressionBufalin induces the apoptosis of acute promyelocytic leukemia cells via the downregulation of survivin expression. Acta Haematol. 2012;128(3):144-50. doi: 10.1159/000339424. Click
192 A novel combination of withaferin A and sorafenib shows synergistic efficacy against both papillary and anaplastic thyroid cancers. Am J Surg. 2012 Dec;204(6):895-900; discussion 900-1. doi: 10.1016/j.amjsurg.2012.07.027. Click
193 OSW-1 induces apoptosis and cyto-protective autophagy, and synergizes with chemotherapy on triple negative breast cancer metastasis. Cell Oncol (Dordr). 2022 Dec;45(6):1255-1275. doi: 10.1007/s13402-022-00716-2. Click
194 Oleandrin synergizes with cisplatin in human osteosarcoma cells by enhancing cell apoptosis through activation of the p38 MAPK signaling pathway. Cancer Chemother Pharmacol. 2018 Dec;82(6):1009-1020. doi: 10.1007/s00280-018-3692-7. Click
195 Tenacissoside G synergistically potentiates inhibitory effects of 5-fluorouracil to human colorectal cancer. Phytomedicine. 2021 Jun;86:153553. doi: 10.1016/j.phymed.2021.153553. Click
196 Pterostilbene Enhances TRAIL-Induced Apoptosis through the Induction of Death Receptors and Downregulation of Cell Survival Proteins in TRAIL-Resistance Triple Negative Breast Cancer Cells. J Agric Food Chem. 2017 Dec 27;65(51):11179-11191. doi: 10.1021/acs.jafc.7b02358. Click
197 Pterostilbene enhances sorafenib's anticancer effects on gastric adenocarcinoma. J Cell Mol Med. 2020 Nov;24(21):12525-12536. doi: 10.1111/jcmm.15795. Click
198 Polydatin enhances the chemosensitivity of osteosarcoma cells to paclitaxel. J Cell Biochem. 2019 Oct;120(10):17481-17490. doi: 10.1002/jcb.29012. Click
199 Synergistic inhibitory effects of the oxyresveratrol and dacarbazine combination against melanoma cells. Oncol Lett. 2021 Sep;22(3):667. doi: 10.3892/ol.2021.12928. Click
200 ε-Viniferin and α-viniferin alone or in combination induced apoptosis and necrosis in osteosarcoma and non-small cell lung cancer cells. Food Chem Toxicol. 2021;158:112617. doi:10.1016/j.fct.2021.112617. Click
201 Resveratrol potentiates the anti-tumor effects of rapamycin in papillary thyroid cancer: PI3K/AKT/mTOR pathway involved. Arch Biochem Biophys. 2020 Aug 15;689:108461. doi: 10.1016/j.abb.2020.108461. Click
202 Resveratrol increases the sensitivity of breast cancer MDA-MB-231 cell line to cisplatin by regulating intrinsic apoptosis. Iran J Basic Med Sci. 2021 Jan;24(1):66-72. doi: 10.22038/ijbms.2020.50485.11501. Click
203 Mechanism and therapeutic prospect of resveratrol combined with TRAIL in the treatment of renal cell carcinoma. Cancer Gene Ther. 2020 Aug;27(7-8):619-623. doi: 10.1038/s41417-019-0150-6. Click
204 Resveratrol Enhances Cytotoxic Effects of Cisplatin by Inducing Cell Cycle Arrest and Apoptosis in Ovarian Adenocarcinoma SKOV-3 Cells through Activating the p38 MAPK and Suppressing AKT. Pharmaceuticals (Basel). 2023 May 17;16(5):755. doi: 10.3390/ph16050755. Click
205 Combination effect of curcumin with docetaxel on the PI3K/AKT/mTOR pathway to induce autophagy and apoptosis in esophageal squamous cell carcinoma. Am J Transl Res. 2021 Jan 15;13(1):57-72. Click
206 Curcumin Enhances the Anticancer Effects of Binimetinib on Melanoma Cells by Inducing Mitochondrial Dysfunction and Cell Apoptosis with Necroptosis. Ann Dermatol. 2023 Jun;35(3):217-228. doi: 10.5021/ad.22.200. Click
207 Curcumin Potentiates the Potent Antitumor Activity of ACNU Against Glioblastoma by Suppressing the PI3K/AKT and NF-κB/COX-2 Signaling Pathways [Retraction]. Onco Targets Ther. 2022 Dec 2;15:1479-1480. doi: 10.2147/OTT.S399704. Click
208 Morphologically transformable peptide nanocarriers coloaded with doxorubicin and curcumin inhibit the growth and metastasis of hepatocellular carcinoma. Mater Today Bio. 2023 Dec 12;24:100903. doi: 10.1016/j.mtbio.2023.100903. Click
209 Synergistic anti-proliferative and apoptotic effect of NVP-BEZ235 and curcumin on human SH-SY5Y neuroblastoma cells. Med Oncol. 2023 Dec 10;41(1):11. doi: 10.1007/s12032-023-02239-8. Click
210 Curcumin and melphalan cotreatment induces cell cycle arrest and apoptosis in MDA-MB-231 breast cancer cells. Sci Rep. 2023 Aug 18;13(1):13446. doi: 10.1038/s41598-023-40535-5. Click
211 Curcumin sensitizes human lung cancer cells to apoptosis and metastasis synergistically combined with carboplatin. Exp Biol Med (Maywood). 2015 Nov;240(11):1416-25. doi: 10.1177/1535370215571881. Click
212 Low-dose arsenic trioxide combined with aclacinomycin A synergistically enhances the cytotoxic effect on human acute myelogenous leukemia cell lines by induction of apoptosis. Leuk Lymphoma. 2015;56(11):3159-67. doi: 10.3109/10428194.2015.1011155. Click
213 Capsaicin and sorafenib combination treatment exerts synergistic anti‑hepatocellular carcinoma activity by suppressing EGFR and PI3K/Akt/mTOR signaling. Oncol Rep. 2018 Dec;40(6):3235-3248. doi: 10.3892/or.2018.6754. Click
214 Luteolin combined with low-dose paclitaxel synergistically inhibits epithelial-mesenchymal transition and induces cell apoptosis on esophageal carcinoma in vitro and in vivo. Phytother Res. 2021 Nov;35(11):6228-6240. doi: 10.1002/ptr.7267. Click
215 Anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cell line. Mol Cell Biochem. 2008 Jun;313(1-2):125-32. doi: 10.1007/s11010-008-9749-x. Click
216 Attenuating Smac mimetic compound 3-induced NF-kappaB activation by luteolin leads to synergistic cytotoxicity in cancer cells. J Cell Biochem. 2009 Dec 1;108(5):1125-31. doi: 10.1002/jcb.22346. Click
217 Luteolin enhances the antitumor efficacy of oncolytic vaccinia virus that harbors IL-24 gene in liver cancer cells. J Clin Lab Anal. 2021 Mar;35(3):e23677. doi: 10.1002/jcla.23677. Click
218 Luteolin and sorafenib combination kills human hepatocellular carcinoma cells through apoptosis potentiation and JNK activation. Oncol Lett. 2018 Jul;16(1):648-653. doi: 10.3892/ol.2018.8640. Click
219 Luteolin and 5-flurouracil act synergistically to induce cellular weapons in experimentally induced Solid Ehrlich Carcinoma: Realistic role of P53; a guardian fights in a cellular battle. Chem Biol Interact. 2019 Sep 1;310:108740. doi: 10.1016/j.cbi.2019.108740. Click
220 Luteolin and Gemcitabine Protect Against Pancreatic Cancer in an Orthotopic Mouse Model. Pancreas. 2015 Jan;44(1):144-51. doi: 10.1097/MPA.0000000000000215. Click
221 Icariin-mediated inhibition of NF-κB activity enhances the in vitro and in vivo antitumour effect of 5-fluorouracil in colorectal cancer. Cell Biochem Biophys. 2014 Jul;69(3):523-30. doi: 10.1007/s12013-014-9827-5. Click
222 Arsenic Trioxide and Icariin Show Synergistic Anti-leukemic Activity. Cell Biochem Biophys. 2015 Sep;73(1):213-9. doi: 10.1007/s12013-015-0660-2. Click
223 Icariin potentiates the antitumor activity of gemcitabine in gallbladder cancer by suppressing NF-κB. Acta Pharmacol Sin. 2013 Feb;34(2):301-8. doi: 10.1038/aps.2012.162. Click
224 Combined therapeutic effects of bortezomib and anacardic acid on multiple myeloma cells via activation of the endoplasmic reticulum stress response. Mol Med Rep. 2016 Sep;14(3):2679-84. doi: 10.3892/mmr.2016.5533. Click
225 Icaritin Sensitizes Human Glioblastoma Cells to TRAIL-Induced Apoptosis. Cell Biochem Biophys. 2015 Jun;72(2):533-42. doi: 10.1007/s12013-014-0499-y. Click
226 Targeting Lactate Dehydrogenase A with Catechin Resensitizes SNU620/5FU Gastric Cancer Cells to 5-Fluorouracil. Int J Mol Sci. 2021 May 20;22(10):5406. doi: 10.3390/ijms22105406. Click
227 Synergistic anticancer effect of acteoside and temozolomide-based glioblastoma chemotherapy. Int J Mol Med. 2019 Mar;43(3):1478-1486. doi: 10.3892/ijmm.2019.4061. Click
228 Hypericin-mediated photodynamic therapy enhances gemcitabine induced Capan-2 cell apoptosis via inhibiting NADPH level. J Pharm Pharmacol. 2022 Apr 20;74(4):596-604. doi: 10.1093/jpp/rgab073. Click
229 Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. Click
230 Garcinol Alone and in Combination With Cisplatin Affect Cellular Behavior and PI3K/AKT Protein Phosphorylation in Human Ovarian Cancer Cells. Dose Response. 2020 May 19;18(2):1559325820926732. doi: 10.1177/1559325820926732. Click
231 Vanillin downregulates NNMT and attenuates NNMT‑related resistance to 5‑fluorouracil via ROS‑induced cell apoptosis in colorectal cancer cells. Oncol Rep. 2021 Jun;45(6):110. doi: 10.3892/or.2021.8061. Click
232 Synergism between α-mangostin and TRAIL induces apoptosis in squamous cell carcinoma of the oral cavity through the mitochondrial pathway. Oncol Rep. 2017 Dec;38(6):3439-3446. doi: 10.3892/or.2017.6030. Click
233 Synergistic effect of paeonol and cisplatin on oesophageal cancer cell lines. Dig Liver Dis. 2008 Jul;40(7):531-9. doi: 10.1016/j.dld.2008.01.012. Click
234 Diosmin in combination with naringenin enhances apoptosis in colon cancer cells. Oncol Rep. 2022 Jan;47(1):4. doi: 10.3892/or.2021.8215. Click
235 Glioma progression is suppressed by Naringenin and APO2L combination therapy via the activation of apoptosis in vitro and in vivo. Invest New Drugs. 2020 Dec;38(6):1743-1754. doi: 10.1007/s10637-020-00979-2. Click
236 Enhanced anticancer effect of ABT-737 in combination with naringenin on gastric cancer cells. Exp Ther Med. 2016 Feb;11(2):669-673. doi: 10.3892/etm.2015.2912. Click
237 Synergistic effect of black tea polyphenol, theaflavin-3,3'-digallate with cisplatin against cisplatin resistant human ovarian cancer cells. J Funct Foods. 2018 Jul;46:1-11. doi: 10.1016/j.jff.2018.04.037. Click
238 Mangiferin enhances the sensitivity of human multiple myeloma cells to anticancer drugs through suppression of the nuclear factor κB pathway. Int J Oncol. 2016 Jun;48(6):2704-12. doi: 10.3892/ijo.2016.3470. Click
239 Combination treatment with oxaliplatin and mangiferin causes increased apoptosis and downregulation of NFκB in cancer cell lines. Afr J Tradit Complement Altern Med. 2011;8(2):177-84. doi: 10.4314/ajtcam.v8i2.63206. Click
240 Corylin increases the sensitivity of hepatocellular carcinoma cells to chemotherapy through long noncoding RNA RAD51-AS1-mediated inhibition of DNA repair. Cell Death Dis. 2018 May 1;9(5):543. doi: 10.1038/s41419-018-0575-0. Click
241 6-Shogaol Overcomes Gefitinib Resistance via ER Stress in Ovarian Cancer Cells. Int J Mol Sci. 2023 Jan 30;24(3):2639. doi: 10.3390/ijms24032639. Click
242 6-Shogaol enhances the anticancer effect of 5-fluorouracil, oxaliplatin, and irinotecan via increase of apoptosis and autophagy in colon cancer cells in hypoxic/aglycemic conditions. BMC Complement Med Ther. 2020 May 11;20(1):141. doi: 10.1186/s12906-020-02913-8. Click
243 Antitumor activity of gemcitabine can be potentiated in pancreatic cancer through modulation of TLR4/NF-κB signaling by 6-shogaol. AAPS J. 2014 Mar;16(2):246-57. doi: 10.1208/s12248-013-9558-3. Click
244 Gossypol sensitizes the antitumor activity of 5-FU through down-regulation of thymidylate synthase in human colon carcinoma cells. Cancer Chemother Pharmacol. 2015 Sep;76(3):575-86. doi: 10.1007/s00280-015-2749-0. Click
245 Gossypol, a phytochemical with BH3-mimetic property, sensitizes cultured thoracic cancer cells to Apo2 ligand/tumor necrosis factor-related apoptosis-inducing ligand. J Thorac Cardiovasc Surg. 2006 Dec;132(6):1356-62. doi: 10.1016/j.jtcvs.2006.07.025. Click
246 (-)Gossypol and its combination with imatinib induce apoptosis in human chronic myeloid leukemic cells. Leuk Lymphoma. 2007 Nov;48(11):2204-12. doi: 10.1080/10428190701583991. Click
247 Targeting apoptosis in the hormone- and drug-resistant prostate cancer cell line, DU-145, by gossypol/zoledronic acid combination. Cell Biol Int. 2009 Nov;33(11):1165-72. doi: 10.1016/j.cellbi.2009.08.006. Click
248 Combination of L-gossypol and low-concentration doxorubicin induces apoptosis in human synovial sarcoma cells. Mol Med Rep. 2015 Oct;12(4):5924-32. doi: 10.3892/mmr.2015.4127. Click
249 AT-101 enhances gefitinib sensitivity in non-small cell lung cancer with EGFR T790M mutations. BMC Cancer. 2016 Jul 18;16:491. doi: 10.1186/s12885-016-2519-3. Click
250 Synthetic lethality of combined AT-101 with idarubicin in acute myeloid leukemia via blockade of DNA repair and activation of intrinsic apoptotic pathway. Cancer Lett. 2019 Oct 1;461:31-43. doi: 10.1016/j.canlet.2019.07.003. Click
251 Synergistic effects of green tea extract and paclitaxel in the induction of mitochondrial apoptosis in ovarian cancer cell lines. Gene. 2021 Jun 30;787:145638. doi: 10.1016/j.gene.2021.145638. Click
252 Protocatechuic aldehyde acts synergistically with dacarbazine to augment DNA double-strand breaks and promote apoptosis in cutaneous melanoma cells. BMC Complement Med Ther. 2023 Apr 27;23(1):133. doi: 10.1186/s12906-023-03965-2. Click
253 Potentiation of Cisplatin Cytotoxicity in Resistant Ovarian Cancer SKOV3/Cisplatin Cells by Quercetin Pre-Treatment. Int J Mol Sci. 2023;24(13):10960. Published 2023 Jun 30. doi:10.3390/ijms241310960 Click
254 Bakuchiol sensitizes cancer cells to TRAIL through ROS- and JNK-mediated upregulation of death receptors and downregulation of survival proteins. Biochem Biophys Res Commun. 2016 Apr 29;473(2):586-92. doi: 10.1016/j.bbrc.2016.03.127. Click
255 Synergistic inhibitory effect of cetuximab and tectochrysin on human colon cancer cell growth via inhibition of EGFR signal. Arch Pharm Res. 2016 May;39(5):721-9. doi: 10.1007/s12272-016-0735-7. Click
256 Propyl gallate sensitizes human lung cancer cells to cisplatin-induced apoptosis by targeting heme oxygenase-1 for TRC8-mediated degradation. Eur J Pharmacol. 2016 Oct 5;788:321-327. doi: 10.1016/j.ejphar.2016.06.052. Click
257 Synergistic effects of 5-fluorouracil and gambogenic acid on A549 cells: activation of cell death caused by apoptotic and necroptotic mechanisms via the ROS-mitochondria pathway. Biol Pharm Bull. 2014;37(8):1259-68. doi: 10.1248/bpb.b13-00972. Click
258 Gambogic acid potentiates gemcitabine induced anticancer activity in non-small cell lung cancer. Eur J Pharmacol. 2020 Dec 5;888:173486. doi: 10.1016/j.ejphar.2020.173486. Click
259 Gambogic acid sensitizes gemcitabine efficacy in pancreatic cancer by reducing the expression of ribonucleotide reductase subunit-M2 (RRM2). J Exp Clin Cancer Res. 2017 Aug 10;36(1):107. doi: 10.1186/s13046-017-0579-0. Click
260 Gambogic acid increases the sensitivity to paclitaxel in drug‑resistant triple‑negative breast cancer via the SHH signaling pathway. Mol Med Rep. 2019 Nov;20(5):4515-4522. doi: 10.3892/mmr.2019.10697. Click
261 Gambogic acid synergistically potentiates cisplatin-induced apoptosis in non-small-cell lung cancer through suppressing NF-κB and MAPK/HO-1 signalling. Br J Cancer. 2014 Jan 21;110(2):341-52. doi: 10.1038/bjc.2013.752. Click
262 Gambogic acid sensitizes breast cancer cells to TRAIL-induced apoptosis by promoting the crosstalk of extrinsic and intrinsic apoptotic signalings. Food Chem Toxicol. 2018 Sep;119:334-341. doi: 10.1016/j.fct.2018.02.037. Click
263 Synergistic effect of 5-fluorouracil with gambogic acid on BGC-823 human gastric carcinoma. Toxicology. 2009 Feb 4;256(1-2):135-40. doi: 10.1016/j.tox.2008.11.014. Click
264 Suppression of NF-κB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103. doi: 10.2174/1568009613666131113100634. Click
265 Combination Effects of Hispidin and Gemcitabine via Inhibition of Stemness in Pancreatic Cancer Stem Cells. Anticancer Res. 2018 Jul;38(7):3967-3975. doi: 10.21873/anticanres.12683. Click
266 Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. Click
267 Bisdemethoxycurcumin Promotes Apoptosis and Inhibits the Epithelial-Mesenchymal Transition through the Inhibition of the G-Protein-Coupled Receptor 161/Mammalian Target of Rapamycin Signaling Pathway in Triple Negative Breast Cancer Cells. J Agric Food Chem. 2021 Dec 8;69(48):14557-14567. doi: 10.1021/acs.jafc.1c05585. Click
268 Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. Click
269 PMA synergistically enhances apicularen A-induced cytotoxicity by disrupting microtubule networks in HeLa cells. BMC Cancer. 2014 Jan 22;14:36. doi: 10.1186/1471-2407-14-36. Click
270 Establishment of patient-derived xenograft models of adenoid cystic carcinoma to assess pre-clinical efficacy of combination therapy of a PI3K inhibitor and retinoic acid. Am J Cancer Res. 2021 Mar 1;11(3):773-792. Click
271 All-trans retinoic acid enhances the cytotoxic effect of decitabine on myelodysplastic syndromes and acute myeloid leukaemia by activating the RARα-Nrf2 complex. Br J Cancer. 2023 Feb;128(4):691-701. doi: 10.1038/s41416-022-02074-0. Click
272 Combination of midostaurin and ATRA exerts dose-dependent dual effects on acute myeloid leukemia cells with wild type FLT3. BMC Cancer. 2022 Jul 9;22(1):749. doi: 10.1186/s12885-022-09828-2. Click
273 Combined Application of Salinomycin and ATRA Induces Apoptosis and Differentiation of Acute Myeloid Leukemia Cells by Inhibiting WNT/β-Catenin Pathway. Anticancer Agents Med Chem. 2023;23(9):1074-1084. doi: 10.2174/1871520623666230110121629. Click
274 Tannic acid synergistically enhances the anticancer efficacy of cisplatin on liver cancer cells through mitochondria‑mediated apoptosis. Oncol Rep. 2019 Nov;42(5):2108-2116. doi: 10.3892/or.2019.7281. Click
275 Synergistic anticancer activity of cisplatin combined with tannic acid enhances apoptosis in lung cancer through the PERK-ATF4 pathway. Eur J Med Res. 2023 Oct 27;28(1):462. doi: 10.1186/s40001-023-01420-z. Click
276 Implication of methylselenocysteine in combination chemotherapy with gemcitabine for improved anticancer efficacy. Eur J Pharm Sci. 2022 Sep 1;176:106238. doi: 10.1016/j.ejps.2022.106238. Click
277 Bixin, an apocarotenoid isolated from Bixa orellana L., sensitizes human melanoma cells to dacarbazine-induced apoptosis through ROS-mediated cytotoxicity. Food Chem Toxicol. 2019 Mar;125:549-561. doi: 10.1016/j.fct.2019.02.013. Click
278 Anti-neoplastic action of Cimetidine/Vitamin C on histamine and the PI3K/AKT/mTOR pathway in Ehrlich breast cancer. Sci Rep. 2022;12(1):11514. Published 2022 Jul 7. doi:10.1038/s41598-022-15551-6 Click
279 Combined treatment with vitamin C and methotrexate inhibits triple-negative breast cancer cell growth by increasing H2O2 accumulation and activating caspase-3 and p38 pathways. Oncol Rep. 2017 Apr;37(4):2177-2184. doi: 10.3892/or.2017.5439. Click
280 Pharmacological Ascorbate Suppresses Growth of Gastric Cancer Cells with GLUT1 Overexpression and Enhances the Efficacy of Oxaliplatin Through Redox Modulation. Theranostics. 2018 Feb 2;8(5):1312-1326. doi: 10.7150/thno.21745. Click
281 High Levels of Apoptosis Are Induced in the Human Colon Cancer HT-29 Cell Line by Co-Administration of Sulforaphane and a Peptide Nucleic Acid Targeting miR-15b-5p. Nucleic Acid Ther. 2020 Jun;30(3):164-174. doi: 10.1089/nat.2019.0825. Click
282 Autophagic cell death and premature senescence: New mechanism of 5-fluorouracil and sulforaphane synergistic anticancer effect in MDA-MB-231 triple negative breast cancer cell line. Food Chem Toxicol. 2018 Jan;111:1-8. doi: 10.1016/j.fct.2017.10.056. Click
283 Pro-oxidant activity of sulforaphane and cisplatin potentiates apoptosis and simultaneously promotes autophagy in malignant mesothelioma cells. Mol Med Rep. 2017 Aug;16(2):2133-2141. doi: 10.3892/mmr.2017.6789. Click
284 In Vitro Evaluation of Sulforaphane and a Natural Analog as Potent Inducers of 5-Fluorouracil Anticancer Activity. Molecules. 2018 Nov 21;23(11):3040. doi: 10.3390/molecules23113040. Click
285 Sulforaphane enhances the therapeutic potential of TRAIL in prostate cancer orthotopic model through regulation of apoptosis, metastasis, and angiogenesis. Clin Cancer Res. 2008 Nov 1;14(21):6855-66. doi: 10.1158/1078-0432.CCR-08-0903. Click
286 Allicin sensitizes hepatocellular cancer cells to anti-tumor activity of 5-fluorouracil through ROS-mediated mitochondrial pathway. J Pharmacol Sci. 2016 Aug;131(4):233-40. doi: 10.1016/j.jphs.2016.04.017. Click
287 Anti-cancer therapeutic benefit of red guava extracts as a potential therapy in combination with doxorubicin or targeted therapy for triple-negative breast cancer cells. Int J Med Sci. 2020 Apr 6;17(8):1015-1022. doi: 10.7150/ijms.40131. Click
288 Fucoxanthin and Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand (TRAIL) Synergistically Promotes Apoptosis of Human Cervical Cancer Cells by Targeting PI3K/Akt/NF-κB Signaling Pathway. Med Sci Monit. 2018 Jan 1;24:11-18. doi: 10.12659/msm.905360. Click
289 The carotenoid fucoxanthin can sensitize multidrug resistant cancer cells to doxorubicin via induction of apoptosis, inhibition of multidrug resistance proteins and metabolic enzymes. Phytomedicine. 2020 Oct;77:153280. doi: 10.1016/j.phymed.2020.153280. Click
290 The effect of brassinolide, a plant steroid hormone, on drug resistant small-cell lung carcinoma cells. Biochem Biophys Res Commun. 2017 Nov 4;493(1):783-787. doi: 10.1016/j.bbrc.2017.08.094. Click
291 Hederagenin Induces Apoptosis in Cisplatin-Resistant Head and Neck Cancer Cells by Inhibiting the Nrf2-ARE Antioxidant Pathway. Oxid Med Cell Longev. 2017;2017:5498908. doi:10.1155/2017/5498908 Click
292 Combination treatment of ligustrazine piperazine derivate DLJ14 and adriamycin inhibits progression of resistant breast cancer through inhibition of the EGFR/PI3K/Akt survival pathway and induction of apoptosis. Drug Discov Ther. 2014 Feb;8(1):33-41. doi: 10.5582/ddt.8.33. Click
293 Zerumbone Sensitizes the Anti-Cancer Efficacy of Cisplatin in Hepatocellular Carcinoma Cells. Anticancer Agents Med Chem. 2022 Aug 4;22(16):2885-2895. doi: 10.2174/1871520622666220324090801. Click
294 Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib. J Biol Chem. 2014 Aug 1;289(31):21544-61. doi: 10.1074/jbc.M114.558890. Click
295 Sulforaphene-Carboplatin Combination Synergistically Enhances Apoptosis by Disruption of Mitochondrial Membrane Potential and Cell Cycle Arrest in Human Non-Small Cell Lung Carcinoma. J Med Food. 2016 Sep;19(9):860-9. doi: 10.1089/jmf.2016.3675. Click
296 Sulforaphene Synergistically Sensitizes Cisplatin via Enhanced Mitochondrial Dysfunction and PI3K/PTEN Modulation in Ovarian Cancer Cells. Anticancer Res. 2015 Jul;35(7):3901-8. Click
297 Evaluation of synergistic effects of sulforaphene with photodynamic therapy in human cervical cancer cell line. Lasers Med Sci. 2016 Nov;31(8):1675-1682. doi: 10.1007/s10103-016-2037-1. Click
298 Falcarindiol Enhances Cisplatin Chemosensitivity of Hepatocellular Carcinoma via Down-Regulating the STAT3-Modulated PTTG1 Pathway. Front Pharmacol. 2021 May 7;12:656697. doi: 10.3389/fphar.2021.656697. Click
299 Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway. Phytother Res. 2021 Oct;35(10):5899-5918. doi: 10.1002/ptr.7299 Click
300 Isodon eriocalyx and its bioactive component Eriocalyxin B enhance cytotoxic and apoptotic effects of gemcitabine in pancreatic cancer. Phytomedicine. 2018 May 15;44:56-64. doi: 10.1016/j.phymed.2018.03.055. Click
301 Dehydrobruceine B enhances the cisplatin-induced cytotoxicity through regulation of the mitochondrial apoptotic pathway in lung cancer A549 cells. Biomed Pharmacother. 2017 May;89:623-631. doi: 10.1016/j.biopha.2017.02.055. Click
302 Downregulation of c‑FLIP and upregulation of DR‑5 by cantharidin sensitizes TRAIL‑mediated apoptosis in prostate cancer cells via autophagy flux. Int J Mol Med. 2020 Jul;46(1):280-288. doi: 10.3892/ijmm.2020.4566. Click
303 Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway. Phytomedicine. 2021 Jun;86:153563. doi: 10.1016/j.phymed.2021.153563. Click
304 δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis. Cell Prolif. 2021 Nov;54(11):e13111. doi: 10.1111/cpr.13111. Click
305 Necroptosis Induced by Delta-Tocotrienol Overcomes Docetaxel Chemoresistance in Prostate Cancer Cells. Int J Mol Sci. 2023 Mar 3;24(5):4923. doi: 10.3390/ijms24054923. Click
306 {Gamma}-tocotrienol inhibits pancreatic tumors and sensitizes them to gemcitabine treatment by modulating the inflammatory microenvironment. Cancer Res. 2010 Nov 1;70(21):8695-705. doi: 10.1158/0008-5472.CAN-10-2318. Epub 2010 Sep 23. Click
307 γ-tocotrienol enhances the chemosensitivity of human oral cancer cells to docetaxel through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 Click
308 Addition of Gallic Acid Overcomes Resistance to Cisplatin in Ovarian Cancer Cell Lines. Asian Pac J Cancer Prev. 2022 Aug 1;23(8):2661-2669. doi: 10.31557/APJCP.2022.23.8.2661. Click
309 Combination of Cordycepin and Apatinib Synergistically Inhibits NSCLC Cells by Down-Regulating VEGF/PI3K/Akt Signaling Pathway. Front Oncol. 2020 Sep 7;10:1732. doi: 10.3389/fonc.2020.01732. Click
310 Reactive oxygen species-mediated apoptosis contributes to chemosensitization effect of saikosaponins on cisplatin-induced cytotoxicity in cancer cells. J Exp Clin Cancer Res. 2010;29(1):159. Published 2010 Dec 9. doi:10.1186/1756-9966-29-159 Click
311 Phenethyl isothiocyanate and irinotecan synergistically induce cell apoptosis in colon cancer HCT 116 cells in vitro. Environ Toxicol. 2024 Jan;39(1):457-469. doi: 10.1002/tox.23993. Click
312 Noscapine Increases the Sensitivity of Drug-Resistant Ovarian Cancer Cell Line SKOV3/DDP to Cisplatin by Regulating Cell Cycle and Activating Apoptotic Pathways. Cell Biochem Biophys. 2015 May;72(1):203-13. doi: 10.1007/s12013-014-0438-y. Click
313 Anticancer activity of Noscapine, an opioid alkaloid in combination with Cisplatin in human non-small cell lung cancer. Lung Cancer. 2011 Mar;71(3):271-82. doi: 10.1016/j.lungcan.2010.06.002. Click
314 Antitumor activity of Noscapine in combination with Doxorubicin in triple negative breast cancer. PLoS One. 2011 Mar 15;6(3):e17733. doi: 10.1371/journal.pone.0017733. Click
315 Antitumor activity of Noscapine in combination with Doxorubicin in triple negative breast cancer. PLoS One. 2011 Mar 15;6(3):e17733. doi: 10.1371/journal.pone.0017733. Click
316 Enhanced anticancer activity of gemcitabine in combination with noscapine via antiangiogenic and apoptotic pathway against non-small cell lung cancer. PLoS One. 2011;6(11):e27394. doi: 10.1371/journal.pone.0027394. Click
317 Enhanced anticancer activity of gemcitabine in combination with noscapine via antiangiogenic and apoptotic pathway against non-small cell lung cancer. PLoS One. 2011;6(11):e27394. doi: 10.1371/journal.pone.0027394. Click
318 Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway. Mol Carcinog. 2019 Jun;58(6):1033-1045. doi: 10.1002/mc.22991. Click
319 Combination of the natural compound Periplocin and TRAIL induce esophageal squamous cell carcinoma apoptosis in vitro and in vivo: Implication in anticancer therapy. J Exp Clin Cancer Res. 2019 Dec 21;38(1):501. doi: 10.1186/s13046-019-1498-z. Click
320 Platycodin D induces apoptotic cell death through PI3K/AKT and MAPK/ERK pathways and synergizes with venetoclax in acute myeloid leukemia. Eur J Pharmacol. 2023 Oct 5;956:175957. doi: 10.1016/j.ejphar.2023.175957. Click
321 Combined Anti-Cancer Effects of Platycodin D and Sorafenib on Androgen-Independent and PTEN-Deficient Prostate Cancer. Front Oncol. 2021 May 7;11:648985. doi: 10.3389/fonc.2021.648985. Click
322 Forskolin affects proliferation, migration and Paclitaxel-mediated cytotoxicity in non-small-cell lung cancer cell lines via adenylyl cyclase/cAMP axis. Eur J Cell Biol. 2023 Jun;102(2):151292. doi: 10.1016/j.ejcb.2023.151292. Click
323 Elemene sensitizes pancreatic cancer cells to bortezomib by enhancing proteasome inhibition via molecular patch mechanism. Signal Transduct Target Ther. 2023 Feb 27;8(1):87. doi: 10.1038/s41392-023-01373-z. Click
324 Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals. Oncotarget. 2017 Nov 27;8(67):111144-111160. doi: 10.18632/oncotarget.22676. Click
325 Enhanced anticancer activity by the combination of vinpocetine and sorafenib via PI3K/AKT/GSK-3β signaling axis in hepatocellular carcinoma cells. Anticancer Drugs. 2021 Aug 1;32(7):727-733. doi: 10.1097/CAD.0000000000001056. Click
326 Polyphyllin I, a lethal partner of Palbociclib, suppresses non-small cell lung cancer through activation of p21/CDK2/Rb pathway in vitro and in vivo. Cell Cycle. 2021 Dec;20(23):2494-2506. doi: 10.1080/15384101.2021.1991121. Click
327 The Phenolic compound Kaempferol overcomes 5-fluorouracil resistance in human resistant LS174 colon cancer cells. Sci Rep. 2019 Jan 17;9(1):195. doi: 10.1038/s41598-018-36808-z. Click
328 The effect of paclitaxel- and fisetin-loaded PBM nanoparticles on apoptosis and reversal of drug resistance gene ABCG2 in ovarian cancer. J Ovarian Res. 2023 Nov 21;16(1):220. doi: 10.1186/s13048-023-01308-w. Click
329 Scutellarin Increases Cisplatin-Induced Apoptosis and Autophagy to Overcome Cisplatin Resistance in Non-small Cell Lung Cancer via ERK/p53 and c-met/AKT Signaling Pathways. Front Pharmacol. 2018 Feb 13;9:92. doi: 10.3389/fphar.2018.00092. Click
330 Amentoflavone enhances sorafenib-induced apoptosis through extrinsic and intrinsic pathways in sorafenib-resistant hepatocellular carcinoma SK-Hep1 cells in vitro. Oncol Lett. 2017 Sep;14(3):3229-3234. doi: 10.3892/ol.2017.6540. Click
331 Potentiating activities of chrysin in the therapeutic efficacy of 5-fluorouracil in gastric cancer cells. Oncol Lett. 2021 Jan;21(1):24. doi: 10.3892/ol.2020.12285. Click
332 Liquiritin induces apoptosis and autophagy in cisplatin (DDP)-resistant gastric cancer cells in vitro and xenograft nude mice in vivo. Int J Oncol. 2017 Nov;51(5):1383-1394. doi: 10.3892/ijo.2017.4134. Click
333 Hypoxia-induced resistance to cisplatin-mediated apoptosis in osteosarcoma cells is reversed by gambogic acid independently of HIF-1α. Mol Cell Biochem. 2016 Sep;420(1-2):1-8. doi: 10.1007/s11010-016-2759-1. Click
334 Artesunate improves venetoclax plus cytarabine AML cell targeting by regulating the Noxa/Bim/Mcl-1/p-Chk1 axis. Cell Death Dis. 2022 Apr 20;13(4):379. doi: 10.1038/s41419-022-04810-z. Click
335 Ursolic acid enhances the therapeutic effects of oxaliplatin in colorectal cancer by inhibition of drug resistance. Cancer Sci. 2018 Jan;109(1):94-102. doi: 10.1111/cas.13425. Click
336 Curcumol Overcomes TRAIL Resistance of Non-Small Cell Lung Cancer by Targeting NRH:Quinone Oxidoreductase 2 (NQO2). Adv Sci (Weinh). 2020 Oct 15;7(22):2002306. doi: 10.1002/advs.202002306. Click
337 Combined Treatment of Tanshinone I and Epirubicin Revealed Enhanced Inhibition of Hepatocellular Carcinoma by Targeting PI3K/AKT/HIF-1α. Drug Des Devel Ther. 2022 Sep 19;16:3197-3213. doi: 10.2147/DDDT.S360691. Click
338 β-elemene sensitizes hepatocellular carcinoma cells to oxaliplatin by preventing oxaliplatin-induced degradation of copper transporter 1. Sci Rep. 2016 Feb 12;6:21010. doi: 10.1038/srep21010. Click
339 The effects and mechanisms of aloe-emodin on reversing adriamycin-induced resistance of MCF-7/ADR cells. Phytother Res. 2021 Jul;35(7):3886-3897. doi: 10.1002/ptr.7096. Click
340 Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004 Click
341 Decursin in Angelica gigas Nakai (AGN) Enhances Doxorubicin Chemosensitivity in NCI/ADR-RES Ovarian Cancer Cells via Inhibition of P-glycoprotein Expression. Phytother Res. 2016 Dec;30(12):2020-2026. doi: 10.1002/ptr.5708. Click
342 Olean-28,13b-olide 2 plays a role in cisplatin-mediated apoptosis and reverses cisplatin resistance in human lung cancer through multiple signaling pathways. Biochem Pharmacol. 2019;170:113642. doi:10.1016/j.bcp.2019.113642 Click
343 Demethoxycurcumin increases the sensitivity of cisplatin-resistant non-small lung cancer cells to cisplatin and induces apoptosis by activating the caspase signaling pathway. Oncol Lett. 2020 Nov;20(5):209. doi: 10.3892/ol.2020.12072. Click
344 Shogaol overcomes TRAIL resistance in colon cancer cells via inhibiting of survivin. Tumour Biol. 2015 Nov;36(11):8819-29. doi: 10.1007/s13277-015-3629-2. Click
345 Sulforaphane reverses chemo-resistance to temozolomide in glioblastoma cells by NF-κB-dependent pathway downregulating MGMT expression. Int J Oncol. 2016 Feb;48(2):559-68. doi: 10.3892/ijo.2015.3271. Click
346 Ligustrazine-Derived Chalcones-Modified Platinum(IV) Complexes Intervene in Cisplatin Resistance in Pancreatic Cancer through Ferroptosis and Apoptosis. J Med Chem. 2023 Oct 12;66(19):13587-13606. doi: 10.1021/acs.jmedchem.3c00922. Click
347 Cordycepin Reverses Cisplatin Resistance in Non-small Cell Lung Cancer by Activating AMPK and Inhibiting AKT Signaling Pathway. Front Cell Dev Biol. 2021 Jan 15;8:609285. doi: 10.3389/fcell.2020.609285. Click
348 Reversal of drug-resistance by noscapine chemo-sensitization in docetaxel resistant triple negative breast cancer. Sci Rep. 2017 Nov 20;7(1):15824. doi: 10.1038/s41598-017-15531-1. Click
349 Platycodin D reverses histone deacetylase inhibitor resistance in hepatocellular carcinoma cells by repressing ERK1/2-mediated cofilin-1 phosphorylation. Phytomedicine. 2021 Feb;82:153442. doi: 10.1016/j.phymed.2020.153442. Click
350 Shikonin inhibits gefitinib-resistant non-small cell lung cancer by inhibiting TrxR and activating the EGFR proteasomal degradation pathway. Pharmacol Res. 2017;115:45-55. doi:10.1016/j.phrs.2016.11.011 Click
It has been 729106 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP