TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Apoptosis regulator BAX
UniProt ID BAX_HUMAN
Gene Name BAX
Gene ID 581
Synonyms
BAX, BCL2L4
Sequence
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
Pathway Map MAP LINK
T.C. Number 1.A.21.1.2
KEGG ID hsa581
TTD ID T89251
Pfam PF00452
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 989
Pair Name Baicalein, Epirubicin
Phytochemical Name Baicalein
Anticancer drug Name Epirubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result BTME (200μg/mL) significantly enhanced epirubicin's cytotoxicity against Hep-G2 cells and ameliorated its safety profile. BTME could exert anti-hepatocarcinoma effect by enhancing apoptosis and autophagy
Combination Pair ID: 79
Pair Name Rutin, Oxaliplatin
Phytochemical Name Rutin
Anticancer drug Name Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin
Combination Pair ID: 90
Pair Name Kuromanin chloride, Cisplatin
Phytochemical Name Kuromanin chloride
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Activity
Result Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells
Combination Pair ID: 997
Pair Name Chrysin, Paclitaxel
Phytochemical Name Chrysin
Anticancer drug Name Paclitaxel
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result CR exhibited the ability to reduce oxidative DNA damage, exert anti-apoptotic and anti-inflammatory properties, and mitigate the toxic effects of Pax-induced hepatorenal toxicity.
Combination Pair ID: 109
Pair Name Calycosin-7-O-β-D-glucoside, Cisplatin
Phytochemical Name Calycosin-7-O-β-D-glucoside
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result CG significantly increases the CDDP-induced apoptosis of the SK-OV-3 cells through the p53 pathway at the cellular level. In addition, using the drugs in combination reduces the toxicity and side effects caused by using CDDP alone.
Combination Pair ID: 173
Pair Name Parthenolide, Epirubicin
Phytochemical Name Parthenolide
Anticancer drug Name Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result According to lack of cytotoxicity of Parthenolide on normal cells that lead to reduction of drug side effects, it could be suggested as an adjuvant therapy with Epirubicin after complementary research on animal model and clinical trial.
Combination Pair ID: 1013
Pair Name Oleanolic Acid, Doxorubicin
Phytochemical Name Oleanolic Acid
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This approach may increase the efficiency of chemotherapy and reduce unintended side effects by lowering the prescribed dose of DOX.
Combination Pair ID: 1025
Pair Name Lupeol, Paclitaxel
Phytochemical Name Lupeol
Anticancer drug Name Paclitaxel
Disease Info [ICD-11: 2B66.0] Oral squamous cell carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our findings elucidated mechanistic underpinning of hypoxia induced Laminin-5γ2 driven VM formation highlighting that Lupeol-Paclitaxel combination may serve as novel therapeutic intervention in perturbation of VM in human OSCC.
Combination Pair ID: 313
Pair Name Juglone, Indomethacin
Phytochemical Name Juglone
Anticancer drug Name Indomethacin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result IND and JUG reduce the inflammatory activity and induce apoptotic cell death, while JUG effectively prevents IND induced gastric ulceration. These findings establish that a combination of IND + JUG may serve as a promising treatment regimen for colon cancer.
Combination Pair ID: 775
Pair Name Chlorogenic acid, Methotrexate
Phytochemical Name Chlorogenic acid
Anticancer drug Name Methotrexate
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results imply that CGA has perfective effect against MTX-induced liver injury. Hence CGA supplementation might be helpful in abrogation of MTX toxicity.
Combination Pair ID: 366
Pair Name Polydatin, 2-Deoxy-d-glucose
Phytochemical Name Polydatin
Anticancer drug Name 2-Deoxy-d-glucose
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our study demonstrates that PD synergised with 2-DG to enhance its anti-cancer efficacy by inhibiting the ROS/PI3K/AKT/HIF-1α/HK2 signalling axis, providing a potential anti-cancer strategy.
Combination Pair ID: 401
Pair Name Curcumin, Temozolomide
Phytochemical Name Curcumin
Anticancer drug Name Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result We showed for the first time that exosomes released from drug-treated U87 cells could be a new therapeutic approach in glioblastoma, and could reduce the side effects produced by drugs alone. This concept needs to be further examined in animal models before clinical trials could be considered.
Combination Pair ID: 413
Pair Name Puerarin, Fluorouracil
Phytochemical Name Puerarin
Anticancer drug Name Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These findings showed that puerarin and 5‑FU produced a significant synergic effect on gastric cancer cells, while there was no increase in side effects.
Combination Pair ID: 429
Pair Name Carvacrol, Sorafenib
Phytochemical Name Carvacrol
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC.
Combination Pair ID: 437
Pair Name Vanillin, Doxorubicin
Phytochemical Name Vanillin
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Vanillin can be a potential lead molecule for the development of non-toxic agents for the treatment of breast cancer either alone or combined with DOX.
Combination Pair ID: 443
Pair Name Paeonol, Epirubicin
Phytochemical Name Paeonol
Anticancer drug Name Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These findings suggest that combination of Paeonol and Epirubicin is potentially applicable for breast cancer treatment.
Combination Pair ID: 453
Pair Name Mangiferin, Cisplatin
Phytochemical Name Mangiferin
Anticancer drug Name Cisplatin
Disease Info Nephrotoxicity Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The study reveals a mechanistic basis of mangiferin action against cisplatin induced nephrotoxicity. Since Mangiferin shows synergistic anticancer activity with cisplatin, it can be considered as a promising drug candidate, to be used in combination with cisplatin.
Combination Pair ID: 464
Pair Name Biochanin A, SB590885
Phytochemical Name Biochanin A
Anticancer drug Name SB590885
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The results identify an effective combination therapy for the most aggressive form of HCC and provide the possibility of therapeutic improvement for patients with advanced HCC.
Combination Pair ID: 472
Pair Name Umbelliferone, Cisplatin
Phytochemical Name Umbelliferone
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Combination of 7-hydroxycoumarin in a platinum(IV) complex derived from cisplatin enhanced cytotoxicity with multiple mechanisms of action.
Combination Pair ID: 566
Pair Name Levistolide A, Doxorubicin
Phytochemical Name Levistolide A
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2B33.2] Chronic myeloid leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Levistolide A synergistically enhances doxorubicin‑induced apoptosis of k562/dox cells by decreasing MDR1 expression through the ubiquitin pathway
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 8
Pair Name Harmine, Paclitaxel
Phytochemical Harmine
Drug Paclitaxel
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer
Combination Pair ID: 8
Pair Name Harmine, Paclitaxel
Phytochemical Harmine
Drug Paclitaxel
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer
Combination Pair ID: 9
Pair Name Piperlongumine, Doxorubicin
Phytochemical Piperlongumine
Drug Doxorubicin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells
Combination Pair ID: 10
Pair Name Piperlongumine, Paclitaxel
Phytochemical Piperlongumine
Drug Paclitaxel
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells
Combination Pair ID: 12
Pair Name Piperlongumine, Sorafenib
Phytochemical Piperlongumine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Piperlongumine synergistically enhances the antitumour activity of sorafenib by mediating ROS-AMPK activation and targeting CPSF7 in liver cancer
Combination Pair ID: 618
Pair Name Piperlongumine, Oxaliplatin
Phytochemical Piperlongumine
Drug Oxaliplatin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This study provides a novel combination therapy for colorectal cancer, and reveals that manipulating ROS production might constitute an effective tool for developing novel treatments in colorectal cancer.
Combination Pair ID: 16
Pair Name Tetrandrine, Sorafenib
Phytochemical Tetrandrine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The antitumour activity of sorafenib plus tetrandrine may be attributed to the induction of the intrinsic apoptosis pathway through ROS/Akt signaling. This finding provides a novel approach that may broaden the clinical application of sorafenib.
Combination Pair ID: 620
Pair Name Tetrandrine, Cisplatin
Phytochemical Tetrandrine
Drug Cisplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo
Combination Pair ID: 26
Pair Name Trigonelline, Cisplatin
Phytochemical Trigonelline
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our study demonstrated that Trigonelline blocks Nrf2 activation and its nuclear translocation via inhibition of EGFR signalling pathway. It has improved responsiveness of NSCLC cells for Cisplatin and Etoposide and could be a promising choice for lung cancer therapy. Toxicol In Vitro. 2021 Feb;70:105038. doi: 10.1016/j.tiv.2020.105038.
Combination Pair ID: 972
Pair Name Berbamine, Cisplatin
Phytochemical Berbamine
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These findings indicate that Ber might be a promising adjuvant for enhancing the cancer cell killing effect of chemotherapy via the inhibition of autophagy. In this process, Nox2 might be a significant mediator of Ber-induced aberrant lysosomal acidification.
Combination Pair ID: 32
Pair Name (S)-10-Hydroxycamptothecin, Crizotinib
Phytochemical (S)-10-Hydroxycamptothecin
Drug Crizotinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells
Combination Pair ID: 33
Pair Name Sinomenium acutum, Fluorouracil
Phytochemical Sinomenium acutum
Drug Fluorouracil
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The combined effects of SIN and 5-FU on esophageal carcinoma were superior to those of the individual compounds, and the drug combination did not increase the side effects of chemotherapy.
Combination Pair ID: 35
Pair Name Amygdalin, Cisplatin
Phytochemical Amygdalin
Drug Cisplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Apoptosis regulator BAX Expression
Result Our present findings suggest that amygdalin has chemo-modulatory effect when used in co-treatment with cisplatin and is able to protect normal breast cells as well as the fibroblasts during chemotherapy treatment, indicating a strong selective chemoprotective ability and may contribute to a better quality of life for cancer patients.
Combination Pair ID: 40
Pair Name Leonurine, Cisplatin
Phytochemical Leonurine
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Leonurine and cisplatin have synergistic antitumorigenic effects on cervical cancer. Combination with leonurine may serve as a novel strategy for enhancing cisplatin sensitivity via the inhibition of the expression of MRP1 and P-Gp.
Combination Pair ID: 45
Pair Name Solamargine, Bortezomib
Phytochemical Solamargine
Drug Bortezomib
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These findings indicate that SM exerts an anti-MM effect, at least in part, by activating cell autophagy and reveal that SM alone or in combination with BTZ is a potential therapeutic strategy for treating MM.
Combination Pair ID: 51
Pair Name Sanguinarium, Bortezomib
Phytochemical Sanguinarium
Drug Bortezomib
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our findings demonstrate that SNG induces mitochondrial and caspase-dependent apoptosis, generates oxidative stress, and suppresses MM cell lines proliferation. In addition, co-treatment of MM cell lines with sub-toxic doses of SNG and BTZ potentiated the cytotoxic activity. These results would suggest that SNG could be developed into therapeutic agent either alone or in combination with other anticancer drugs in MM.
Combination Pair ID: 53
Pair Name Daurinoline, Sorafenib
Phytochemical Daurinoline
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our study provides insights into the molecular mechanisms underlying DS-induced inhibition of VM, which may facilitate the development of a novel clinical anti-HCC drug. Moreover, our findings suggest that the combination of DS and sorafenib constitutes a potential therapeutic strategy for HCC.
Combination Pair ID: 56
Pair Name Lentinan, Oxaliplatin
Phytochemical Lentinan
Drug Oxaliplatin
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These data imply that LNT increases the susceptibility of esophageal cancerous cells to Oxa by driving EC-109 cells to display immunogenic death. Therefore, LNT combined with Oxa may be an effective method in esophageal cancer management.
Combination Pair ID: 57
Pair Name Polyphyllin I, Cisplatin
Phytochemical Polyphyllin I
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The results from the present study demonstrated that PPI and PPVII may function as chemosensitizers by enhancing apoptosis via the p53 pathway, reversing EMT and suppressing the CIP2A/AKT/mTOR signaling axis, and the combination with DDP may be a promising strategy for the development of new therapeutic agents.
Combination Pair ID: 978
Pair Name Quercetin, Oxaliplatin
Phytochemical Quercetin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These findings suggest that the depletion of intracellular glutathione by quercetin and sulforaphane could strengthen the anti-cancer efficacy of oxaliplatin.
Combination Pair ID: 64
Pair Name Luteolin, Oxaliplatin
Phytochemical Luteolin
Drug Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis
Combination Pair ID: 627
Pair Name Luteolin, Oxaliplatin
Phytochemical Luteolin
Drug Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Luteolin Suppresses the Proliferation of Gastric Cancer Cells and Acts in Synergy with Oxaliplatin through the Cyt c/caspase pathway
Combination Pair ID: 65
Pair Name Kaempferol, Fluorouracil
Phytochemical Kaempferol
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The present study demonstrated that kaempferol has a synergistic effect with 5‑FU by inhibiting cell proliferation and inducing apoptosis in colorectal cancer cells via suppression of TS or attenuation of p‑Akt activation. The combination of kaempferol and 5‑FU may be used as an effective therapeutic strategy for colorectal cancer.
Combination Pair ID: 66
Pair Name Kaempferol, Erlotinib
Phytochemical Kaempferol
Drug Erlotinib
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These data imply that KAE may be a valid therapeutic candidate to potentiate PC cell sensitivity to ERL via inhibiting PI3K/AKT and EGFR signaling.
Combination Pair ID: 70
Pair Name Baicalin, Fluorouracil
Phytochemical Baicalin
Drug Fluorouracil
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result BA is a promising preventive or adjuvant therapy in breast cancer treatment with 5-FU mainly via cooperative inhibition of inflammation, angiogenesis, and triggering apoptotic cell death.
Combination Pair ID: 633
Pair Name Fisetin, Sorafenib
Phytochemical Fisetin
Drug Sorafenib
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The combination of fisetin and sorafenib exerted better synergistic effects in vitro and in vivo than either agent used alone against human cervical cancer, and this synergism was based on apoptotic potential through a mitochondrial- and DR5-dependent caspase-8/caspase-3 signaling pathway
Combination Pair ID: 634
Pair Name Fisetin, Sorafenib
Phytochemical Fisetin
Drug Sorafenib
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Fisetin potentiates sorafenib-induced apoptosis and abrogates tumor growth in athymic nude mice implanted with BRAF-mutated melanoma cells.
Combination Pair ID: 76
Pair Name Apigenin, Doxorubicin
Phytochemical Apigenin
Drug Doxorubicin
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells
Combination Pair ID: 639
Pair Name Apigenin, TNF-related apoptosis inducing ligand
Phytochemical Apigenin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Apigenin enhances TRAIL-induced antitumor activity in NSCLC cells by APG via inhibition of the NF-kappaB, AKT and ERK prosurvival regulators
Combination Pair ID: 82
Pair Name Nobiletin, Palbociclib
Phytochemical Nobiletin
Drug Palbociclib
Disease Info [ICD-11: 2C90.0] Renal cell carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Nobiletin downregulates the SKP2-p21/p27-CDK2 axis to inhibit tumor progression and shows synergistic effects with palbociclib on renal cell carcinoma
Combination Pair ID: 642
Pair Name Nobiletin, Sorafenib
Phytochemical Nobiletin
Drug Sorafenib
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result NOB and SOR combination was more effective than SOR and NOB alone and reduced the exposure time for SOR and NOB in PC-3 cells. Combination strategy is a therapeutic potential to improve efficacy and reduce side-effect of SOR for the treatment of metastatic prostate cancer cells.
Combination Pair ID: 991
Pair Name Nobiletin, Vorinostat
Phytochemical Nobiletin
Drug Vorinostat
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The combination of nobiletin with vorinostat increased histone H3K9 and H3K27 acetylation levels in SCLC mouse tumor tissue and enhanced the expression of the BH3-only proteins BIM and BID. We conclude that nobiletin is a novel natural BH3 mimetic that can cooperate with vorinostat to induce apoptosis and autophagy in SCLC.
Combination Pair ID: 84
Pair Name Isoliquiritigenin, TNF-related apoptosis inducing ligand
Phytochemical Isoliquiritigenin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Isoliquiritigenin has the potential to overcome resistance to TRAIL in cancer cells and its chemopreventive effects may depend on TRAIL function
Combination Pair ID: 645
Pair Name Tangeretin, Fluorouracil
Phytochemical Tangeretin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result To our knowledge gained from literature, this study is the first to describe synergistic activity of TAN and 5-FU against colorectal cancer cells.
Combination Pair ID: 646
Pair Name Hesperetin, Cisplatin
Phytochemical Hesperetin
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Hesperetin could inhibit the phosphatidylinositol-4,5-bisphosphate 3-kinase (PI3K)/AKT signaling pathway and induce the mitochondrial pathway via upregulating PTEN expression, thereby significantly enhancing DDP's anti-tumor effect on GC
Combination Pair ID: 88
Pair Name Hyperoside, Paclitaxel
Phytochemical Hyperoside
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Hyperoside may elevate breast cancer cell sensitivity to paclitaxel by blocking TLR4 activation-mediated pro-inflammatory and pro-survival approaches, thereby endorsing its usefulness as a promising therapeutic combination to overcome chemosensitivity in breast cancer.
Combination Pair ID: 647
Pair Name Daidzein, Topotecan
Phytochemical Daidzein
Drug Topotecan
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Daidzein enhances the anticancer effect of topotecan and reverses BCRP-mediated drug resistance in breast cancer.
Combination Pair ID: 648
Pair Name Kuromanin chloride, Cisplatin
Phytochemical Kuromanin chloride
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results expanded our understanding of the role of C3G in a cervical cancer cell model, and provided a potential new treatment strategy for this cancer, as well as a theoretical basis for the development of new drugs in the future.
Combination Pair ID: 94
Pair Name Amentoflavone, Cisplatin
Phytochemical Amentoflavone
Drug Cisplatin
Disease Info [ICD-11: 2B66.0] Oral squamous cell carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Inactivation of NF-κB and induction of apoptosis through intrinsic caspase-dependent and independent apoptotic pathways are associated with amentoflavone enhanced anti-OSCC efficacy of cisplatin.
Combination Pair ID: 651
Pair Name Licochalcone A, Fluorouracil
Phytochemical Licochalcone A
Drug Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result LCA alone or in combination with 5-FU may have significant anticancer effects on gastric cancer cells
Combination Pair ID: 100
Pair Name Silibinin, Paclitaxel
Phytochemical Silibinin
Drug Paclitaxel
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines
Combination Pair ID: 655
Pair Name Chrysin, Cisplatin
Phytochemical Chrysin
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our results suggest that combination of chrysin and cisplatin is a promising strategy for chemotherapy of human cancers that are resistant to cisplatin.
Combination Pair ID: 107
Pair Name Liquiritin, TNF-related apoptosis inducing ligand
Phytochemical Liquiritin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation
Combination Pair ID: 108
Pair Name Hispidulin, Temozolomide
Phytochemical Hispidulin
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results collectively suggested that the combination of hispidulin and TMZ could improve the antitumor efficiency of TMZ against malignant gliomas.
Combination Pair ID: 657
Pair Name Norizalpinin, Cisplatin
Phytochemical Norizalpinin
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our data indicated a novel therapeutic strategy to potentiate DDP-induced anti-tumor effect in lung cancer cells with DDP resistance by GG through inactivating p-STAT3/p65 and Bcl-2 pathways.
Combination Pair ID: 112
Pair Name Butein, Cisplatin
Phytochemical Butein
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a
Combination Pair ID: 116
Pair Name Morin, Auranofin
Phytochemical Morin
Drug Auranofin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This study provides evidence that morin can enhance the anticancer activity of AF in Hep3B human hepatocellular carcinoma cells, indicating that its combination could be an alternative treatment strategy for the hepatocellular carcinoma.
Combination Pair ID: 119
Pair Name Morin Hydrate, Cisplatin
Phytochemical Morin Hydrate
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our findings indicate that CP-Mh in combination served as a prominent regulator of autophagy and significant inducer of apoptosis that maintains a homeostatic balance towards HepG2 cells and the subcutaneous tumor model.
Combination Pair ID: 661
Pair Name Epigallocatechin gallate, TNF-related apoptosis inducing ligand
Phytochemical Epigallocatechin gallate
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis
Combination Pair ID: 134
Pair Name Flavokawain A, Herceptin
Phytochemical Flavokawain A
Drug Herceptin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our results suggest FKA as a promising and novel apoptosis inducer and G2 blocking agent that, in combination with Herceptin, enhances for the treatment of HER2-overexpressing breast cancer.
Combination Pair ID: 138
Pair Name Neobavaisoflavone, TNF-related apoptosis inducing ligand
Phytochemical Neobavaisoflavone
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Taken together, our results suggest that NBIF reduces the resistance of cancer cells to TRAIL and that the combination of NBIF and TRAIL may be a new therapeutic strategy for treating TRAIL-resistant glioma cells.
Combination Pair ID: 142
Pair Name Irigenin, TNF-related apoptosis inducing ligand
Phytochemical Irigenin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our present study gave new insights into the effects of Iri on potentiating TRAIL-sensitivity, and suggested that Iri could be a potential candidate for sensitizer of TRAIL-resistant cancer cell treatment.
Combination Pair ID: 150
Pair Name Gambogic acid, NaI*131
Phytochemical Gambogic acid
Drug NaI*131
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The two drugs appear to have a synergistic effect on apoptosis of A549/DDP cells.
Combination Pair ID: 667
Pair Name Gambogic acid, Cisplatin
Phytochemical Gambogic acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Combination of GA with cisplatin enhances the antitumor effects on cisplatin-resistant lung cancer cells by downregulating MRP2 and LRP expression.
Combination Pair ID: 1000
Pair Name Celastrol, Tamoxifen
Phytochemical Celastrol
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result CEL can promote apoptosis and enhance the TAM sensitivity in TNBC treatment through a mitochondria-mediated pathway.
Combination Pair ID: 168
Pair Name Resveratrol, Temozolomide
Phytochemical Resveratrol
Drug Temozolomide
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result TMZ in combination with resveratrol remarkably increased reactive oxygen species (ROS) production, which serves as an upstream signal for AMP-activated protein kinase (AMPK) activation. Subsequently, activated AMPK inhibited mTOR signaling and downregulated antiapoptosis protein Bcl-2, which was contributed to the additive antiproliferation effects of combination treatment. In an orthotopic xenograft model of GBM, TMZ plus resveratrol treatment significantly reduced the volume of tumor, which was confirmed by decreased expression of Ki-67, a marker of proliferation index
Combination Pair ID: 674
Pair Name Artesunate, Cisplatin
Phytochemical Artesunate
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result ART exhibited significant anti-tumor effect on A549 cells and this efficiency could be enhanced by combination with CIS
Combination Pair ID: 675
Pair Name Brusatol, Cisplatin
Phytochemical Brusatol
Drug Cisplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results strongly suggested that the combination of CDDP and BR was able to produce a synergistic antitumor effect in CRC cells, thus providing a solid foundation for further development of this combination regimen into an effective therapeutic method for CRC.
Combination Pair ID: 676
Pair Name Oridonin, Imatinib
Phytochemical Oridonin
Drug Imatinib
Disease Info [ICD-11: 2B33.3] Acute lymphoblastic leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our data showed that oridonin remarkably suppressed activations of Akt/mTOR, Raf/MEK and STAT5 pathway in these primary specimens and oridonin with imatinib exerted synergetic suppressive effects on mTOR, STAT5 and LYN signaling in one imatinib resistant patient specimen. Additional evaluation of oridonin as a potential therapeutic agent for Ph+ ALL seems warranted.
Combination Pair ID: 1009
Pair Name Oridonin, Venetoclax
Phytochemical Oridonin
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Oridonin and venetoclax synergistically promote AML cell apoptosis by inhibiting AKT signaling.
Combination Pair ID: 186
Pair Name Astragaloside IV, Bevacizumab
Phytochemical Astragaloside IV
Drug Bevacizumab
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This paper demonstrates that AST-IV enhances the effect of BV on inhibiting proliferation and promoting apoptosis of lung adenocarcinoma cells through inhibiting autophagy pathway.
Combination Pair ID: 678
Pair Name Betulinic Acid, Sorafenib
Phytochemical Betulinic Acid
Drug Sorafenib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result We showed that combination therapy with low concentrations of sorafenib and betulinic acid had the capacity to induce high levels of cell death and abolish clonogenic activity in some NSCLC cell lines regardless of KRAS mutations.
Combination Pair ID: 681
Pair Name Ursolic acid, Cisplatin
Phytochemical Ursolic acid
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The combination of UA with DDP could more effectively inhibit SiHa cells proliferation and facilitate cell apoptosis through suppressing NF-κB p65.
Combination Pair ID: 199
Pair Name Tanshinone IIA, Cisplatin
Phytochemical Tanshinone IIA
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The combination of Tan IIA and cisplatin exhibited the most significant difference. Tanshinone IIA may function as a novel option for combination therapy for non-small-cell lung cancer treatment.
Combination Pair ID: 1015
Pair Name Astaxanthin, Sorafenib
Phytochemical Astaxanthin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Astaxanthin Augmented the Anti-Hepatocellular Carcinoma Efficacy of Sorafenib Through the Inhibition of the JAK2/STAT3 Signaling Pathway and Mitigation of Hypoxia within the Tumor Microenvironment
Combination Pair ID: 202
Pair Name Ginsenoside Rh2, Gemcitabine
Phytochemical Ginsenoside Rh2
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Rh2 activation of DCs may remodel the cold TIME and optimize GEM chemotherapy for future therapeutic use.
Combination Pair ID: 685
Pair Name Ginsenoside Rh2, Sodium selenite
Phytochemical Ginsenoside Rh2
Drug Sodium selenite
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Sodium selenite and G-Rh2 combination have a synergistic effect on cell growth inhibition (57%) compared with sodium selenite (25%) and G-Rh2 alone (28%) after 24 hours of treatment
Combination Pair ID: 204
Pair Name Ginsenoside Rg3, Sorafenib
Phytochemical Ginsenoside Rg3
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These findings suggest a promising strategy for HCC treatment, which could be performed in a sufficiently frequent manner.
Combination Pair ID: 208
Pair Name Ginsenoside Rg1, Doxorubicin
Phytochemical Ginsenoside Rg1
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The present results support the chemosensitizing property of ginsenoside Rg1 in triple-negative breast cancer cell lines.
Combination Pair ID: 1021
Pair Name Betulin, Arsenic oxide (As2O3)
Phytochemical Betulin
Drug Arsenic oxide (As2O3)
Disease Info [ICD-11: 2D11.Y] Neuroblastoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The novel combination of As2O3 plus betulin has the potential to serve as a practical anti-neuroblastoma drug.
Combination Pair ID: 213
Pair Name Betulinic acid, Imatinib
Phytochemical Betulinic acid
Drug Imatinib
Disease Info [ICD-11: 2B33.2] Chronic myeloid leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our findings demonstrated that HDAC3 is an essential factor in BCR-ABL1 kinase-independent IM resistance, and that BA in combination with IM may be a novel treatment strategy for overcoming IM resistance in CML.
Combination Pair ID: 217
Pair Name Cucurbitacin B, Cisplatin
Phytochemical Cucurbitacin B
Drug Cisplatin
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our results showed that CuB may be a new agent that can support conventional treatment in bladder cancer. Our study is important in terms of enlightening new pathways and developing new treatment methods in the treatment of bladder cancer.
Combination Pair ID: 222
Pair Name Maslinic acid, Gemcitabine
Phytochemical Maslinic acid
Drug Gemcitabine
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Down-regulation Apoptosis regulator BAX Expression
Result The results suggest that MA potentiates the antitumor effects of GEM in human GBC cell lines by suppressing the activation of NF-κB and its dowstream gene products, which are involved in survival signaling.
Combination Pair ID: 1027
Pair Name Lupeol, Fluorouracil
Phytochemical Lupeol
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These data lay the foundation for the clinical validation of this combination therapy for TNBC patients.
Combination Pair ID: 693
Pair Name Saikosaponin D, 1,9-Pyrazoloanthrone
Phytochemical Saikosaponin D
Drug 1,9-Pyrazoloanthrone
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result A dramatic inhibition of cellular proliferation, invasion, and migration in cells treated with Ssd alone or in combination with SP600125 was observed
Combination Pair ID: 694
Pair Name Carnosic acid, Tamoxifen
Phytochemical Carnosic acid
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our study supplies a novel therapeutic strategy to induce apoptosis for suppressing breast cancer, which was relied on Caspase-3/TRAIL activation.
Combination Pair ID: 230
Pair Name Tanshinone I, Paclitaxel
Phytochemical Tanshinone I
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Natural compound Tan-I enhances the efficacy of ovarian cancer to Paclitaxel chemotherapy. The results will help to supply the potential clinical use of ovarian carcinoma cells.
Combination Pair ID: 698
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our data provide a rationale for developing a combination of beta-elemene and cisplatin as a regimen for the treatment of lung carcinoma and other cisplatin-resistant tumors.
Combination Pair ID: 699
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The results of the present study suggested that β-ELE inhibited the proliferation of bladder cancer cells in vitro and enhanced cisplatin-induced mitochondria-dependent apoptosis via the ROS-AMPK signaling pathway. Combination therapy with β-ELE requires further investigation as a potential treatment of bladder cancer.
Combination Pair ID: 703
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2B63] Gingival squamous cell carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The results indicated that β-elemene promoted the anti-proliferative and apoptotic effect of cisplatin by inhibiting STAT3 and blocking the JAK2-STAT3 signaling pathway in GSCC in vitro and in vivo.
Combination Pair ID: 704
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These data indicate that β-elemene sensitizes chemoresistant ovarian carcinoma cells to cisplatin-induced apoptosis and that the augmented effect of β-elemene on cisplatin cytotoxicity and sensitivity in resistant ovarian tumor cells is mediated through a mitochondria- and caspase-dependent cell death pathway.
Combination Pair ID: 712
Pair Name Beta-Elemene, Etoposide
Phytochemical Beta-Elemene
Drug Etoposide
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results suggest that the combination of β-elemene and VP-16 may be a promising therapeutic option for lung cancer.
Combination Pair ID: 739
Pair Name Crocin, Sorafenib
Phytochemical Crocin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result CR potentiates the suppressive effects of SB on tumor growth and provides the opportunity to strengthen the therapeutic effects of SB in the treatment of HCC.
Combination Pair ID: 1031
Pair Name Atractylenolide I, Cabozantinib
Phytochemical Atractylenolide I
Drug Cabozantinib
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Silencing Hsp27 inhibits EMT. ATL-1 can inhibit the malignant evolution of prostate cancer cells by inhibiting Hsp27/eIF4E. ATL-1 also enhanced chemosensitization of cabozantinib in prostate cancer.
Combination Pair ID: 250
Pair Name Ginsenoside Rg5, Paclitaxel
Phytochemical Ginsenoside Rg5
Drug Paclitaxel
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel
Combination Pair ID: 1033
Pair Name Patchouli alcohol, Vincristine
Phytochemical Patchouli alcohol
Drug Vincristine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage
Combination Pair ID: 258
Pair Name Raddeanin A, Cisplatin
Phytochemical Raddeanin A
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result All these consequences reflect RA plays an important role in enhancing the therapeutic effect of cisplatin in HCC. This finding may guide for the drug usage of cisplatin in clinic practice.
Combination Pair ID: 278
Pair Name Furanodiene, Doxorubicin
Phytochemical Furanodiene
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results indicate that furanodiene may be a promising and safety natural agent for cancer adjuvant therapy in the future.
Combination Pair ID: 719
Pair Name Furanodiene, Germacrone
Phytochemical Furanodiene
Drug Germacrone
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Unpredictable and complex interactions among different components in Curcuma WenyujinY.H.Chenet C Ling may exist. The intra-herb interactions should be taken into consideration when attempts are made to interpret the art of TCM formulation or other similar recipes.
Combination Pair ID: 280
Pair Name Britannin, Vincristine
Phytochemical Britannin
Drug Vincristine
Disease Info [ICD-11: 2B33.3] Acute lymphoblastic leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our results proposed a mechanism for the cytotoxic effect of Britannin, either as a single agent or in combination with Vincristine, in NALM-6 cells.
Combination Pair ID: 281
Pair Name Britannin, Vincristine
Phytochemical Britannin
Drug Vincristine
Disease Info [ICD-11: 2B33.3] Acute lymphoblastic leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The results of this study showed for the first time that Britannin, as a natural Sesquiterpene Lactone, has cytotoxic effects that could be considered as an anti-leukemic agent in the treatment of ALL. However, there is still a demand for further studies that examine the efficacy and the safety of this purified compound.
Combination Pair ID: 284
Pair Name Shikonin, 4-hydroxytamoxifen
Phytochemical Shikonin
Drug 4-hydroxytamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The combination of SK and 4-OHT shows highly efficient anticancer effects on breast cancer therapy. SK may be a promising candidate as an adjuvant to 4-OHT for breast cancer treatments, especially for ER- breast cancer.
Combination Pair ID: 720
Pair Name Shikonin, Cisplatin
Phytochemical Shikonin
Drug Cisplatin
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Shikonin as a synergistic agent to cisplatin could be a highly efficient way to achieve anticancer synergism by inducing intracellular oxidative stress
Combination Pair ID: 729
Pair Name Emodin, Cytarabine
Phytochemical Emodin
Drug Cytarabine
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Emodin and its combination with Ara-C may be considered a promising therapeutic approach in AML and worthy of further investigation.
Combination Pair ID: 306
Pair Name Thymoquinone, Fluorouracil
Phytochemical Thymoquinone
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result TQ and 5-FU probably showed synergistic effect on both of cell cycle and apoptosis of tested TNBC cell lines. Our study reveals that TQ can synergise 5-FU action, and increase its anticancer efficiency against TNBC cells, which might be good choice in drug development for TNBC treatment.
Combination Pair ID: 307
Pair Name Thymoquinone, Methotrexate
Phytochemical Thymoquinone
Drug Methotrexate
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The co-treatment of TQ and MTX is associated with the up-regulation of apoptotic factors and down-regulation of anti-apoptotic factors, conducting apoptosis aggravation and OS cell death.
Combination Pair ID: 309
Pair Name Thymoquinone, Methotrexate
Phytochemical Thymoquinone
Drug Methotrexate
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The findings of the present study highlight new insights into understanding the role of TQ as a potential therapeutic agent in osteosarcoma by increasing MTX-induced apoptosis.
Combination Pair ID: 749
Pair Name Thymoquinone, Topotecan
Phytochemical Thymoquinone
Drug Topotecan
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Thymoquinone, when combined with topotecan in noncytotoxic doses, produced synergistic antiproliferative and proapoptotic effects in AML cells
Combination Pair ID: 754
Pair Name Thymoquinone, Propranolol
Phytochemical Thymoquinone
Drug Propranolol
Disease Info [ICD-11: 2C23.Z] Laryngeal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The effect of thymoquinone and propranolol combination on epidermoid laryngeal carcinoma cell.
Combination Pair ID: 311
Pair Name Juglone, Indomethacin
Phytochemical Juglone
Drug Indomethacin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result A combination of both was shown to be more effective, suggesting that juglone may be considered for therapeutic intervention of colon cancer.
Combination Pair ID: 315
Pair Name Damnacanthal, Doxorubicin
Phytochemical Damnacanthal
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Combinatorial Cytotoxic Effects of Damnacanthal and Doxorubicin against Human Breast Cancer MCF-7 Cells in Vitro
Combination Pair ID: 773
Pair Name Chlorogenic acid, Regorafenib
Phytochemical Chlorogenic acid
Drug Regorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This drug combination could be considered as a safe and more effective approach in HCC therapy.
Combination Pair ID: 319
Pair Name Rosmarinic acid, Paclitaxel
Phytochemical Rosmarinic acid
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Rosmarinic acid exerted chemo-preventive and therapeutic potential alone or in combination with Paclitaxel. Moreover, rosmarinic acid targets numerous signaling pathways associated with breast cancer.
Combination Pair ID: 322
Pair Name Caffeic acid phenethyl ester, Fluorouracil
Phytochemical Caffeic acid phenethyl ester
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This study demonstrated the cytotoxicity of CAPE potential to induce apoptosis of breast cancer MCF-7 cell line single and cytotoxic-cytostatic combination with 5-FU. Therefore, further studies to develop CAPE and its derivatives will be required to discover new candidates for breast cancer agents.
Combination Pair ID: 327
Pair Name Caffeic acid, Paclitaxel
Phytochemical Caffeic acid
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our results indicated that CA inhibited NSCLC H1299 cell growth by inducing apoptosis and CA and PTX combined produced a synergistic anti-cancer effect in H1299 cells.
Combination Pair ID: 328
Pair Name Osthol, Lobaplatin
Phytochemical Osthol
Drug Lobaplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result OST enhanced the apoptosis-mediated growth inhibitory effect of lobaplatin on breast cancer cells and has potential for the treatment of breast cancer in the future.
Combination Pair ID: 331
Pair Name Eugenol, Cisplatin
Phytochemical Eugenol
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Eugenol showed antiproliferative and cytotoxic effects via apoptosis and also synergism with cisplatin and ionizing radiation in the human cervical cancer cell line.
Combination Pair ID: 782
Pair Name Eugenol, Cisplatin
Phytochemical Eugenol
Drug Cisplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results provide strong preclinical justification for combining cisplatin with eugenol as therapeutic approach for triple-negative breast cancers through targeting the resistant ALDH-positive cells and inhibiting the NF-κB pathway.
Combination Pair ID: 783
Pair Name Eugenol, 2-methoxyestradiol
Phytochemical Eugenol
Drug 2-methoxyestradiol
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Combining these agents may allow ameliorating any adverse effects of either 2-ME(2) or eugenol alone by reducing their individual concentrations should these two agents be developed for human use.
Combination Pair ID: 342
Pair Name Magnolin, B-RAF Inhibitors
Phytochemical Magnolin
Drug B-RAF Inhibitors
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway
Combination Pair ID: 347
Pair Name Matairesinol, Fluorouracil
Phytochemical Matairesinol
Drug Fluorouracil
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Matairesinol Induces Mitochondrial Dysfunction and Exerts Synergistic Anticancer Effects with 5-Fluorouracil in Pancreatic Cancer Cells
Combination Pair ID: 348
Pair Name Beta-Sitosterol, Gemcitabine
Phytochemical Beta-Sitosterol
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result β-Sitosterol and Gemcitabine Exhibit Synergistic Anti-pancreatic Cancer Activity by Modulating Apoptosis and Inhibiting Epithelial-Mesenchymal Transition by Deactivating Akt/GSK-3β Signaling
Combination Pair ID: 351
Pair Name Bufalin, Sorafenib
Phytochemical Bufalin
Drug Sorafenib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Sorafenib in combination with bufalin shows more potent cytotoxic effects and cell apoptosis than sorafenib or bufalin treatment alone in NCI-H292 cells. The combined treatment significantly enhanced apoptotic cell death in NCI-H292 lung cancer cells by activating ROS-, mitochondria-, and caspase-signaling pathways in vitro.
Combination Pair ID: 352
Pair Name Bufalin, Fluorouracil
Phytochemical Bufalin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Bufalin in combination with 5-FU may induce a higher level of apoptosis compared with monotherapy, and the combination mat be a potential therapeutic strategy for the treatment of colorectal cancer.
Combination Pair ID: 353
Pair Name Bufalin, Hydroxycamptothecin
Phytochemical Bufalin
Drug Hydroxycamptothecin
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The present study suggested that the combination of bufalin and hydroxycampothecin improved the inhibitory effects of both drugs on CRPC tumors in vivo, potentially via the regulation of the PI3K/AKT/GSK-3β and p53-dependent apoptosis signaling pathways.
Combination Pair ID: 791
Pair Name Bufalin, Doxorubicin
Phytochemical Bufalin
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results suggested that the combination of cinobufacini and doxorubicin may provide a new strategy for inhibiting the proliferation of HCC cells.
Combination Pair ID: 360
Pair Name OSW-1, Carboplatin
Phytochemical OSW-1
Drug Carboplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our data revealed the mode of action and molecular mechanism underlying the effect of OSW-1 against TNBC, and provided a useful guidance for improving the sensitivity of TNBC cells to conventional chemotherapeutic drugs, which warrants further investigation.
Combination Pair ID: 361
Pair Name Oleandrin, Cisplatin
Phytochemical Oleandrin
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The combination of oleandrin with cisplatin exerts a synergistic antitumor effect in osteosarcoma, which relates to the activation of the p38 MAPK pathway.
Combination Pair ID: 364
Pair Name Piceatannol, Everolimus
Phytochemical Piceatannol
Drug Everolimus
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The findings of this study strongly support the application of combinatorial piceatannol and everolimus therapy in future clinical trials for gastric cancer patients.
Combination Pair ID: 805
Pair Name Pterostilbene, Fluorouracil
Phytochemical Pterostilbene
Drug Fluorouracil
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results provide a rationale for novel combination treatment strategies, especially for patients with 5-FU-resistant tumors expressing ER-β protein.
Combination Pair ID: 368
Pair Name Resveratrol, ABT-737
Phytochemical Resveratrol
Drug ABT-737
Disease Info [ICD-11: 2B33.3] Acute lymphoblastic leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The obtained data indicate that the combination of ABT-737 and resveratrol is a promising approach for acute lymphoblastic leukemia treatment that should be further explored.
Combination Pair ID: 370
Pair Name Oxyresveratrol, Dacarbazine
Phytochemical Oxyresveratrol
Drug Dacarbazine
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Apoptosis regulator BAX Expression
Result This combination treatment may serve as a novel therapeutic strategy for treating malignant melanoma.
Combination Pair ID: 375
Pair Name Resveratrol, Cisplatin
Phytochemical Resveratrol
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results indicated that RES is a promising adjuvant for DDP during GC chemotherapy.
Combination Pair ID: 378
Pair Name Resveratrol, Rapamycin
Phytochemical Resveratrol
Drug Rapamycin
Disease Info [ICD-11: 2D10.1] Papillary thyroid cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The present study suggests that the combination of rapamycin and resveratrol may be a promising strategy for the treatment of papillary thyroid cancer.
Combination Pair ID: 379
Pair Name Resveratrol, Olaparib
Phytochemical Resveratrol
Drug Olaparib
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result RES + OLA combination treatment enhanced breast cancer cell death by causing excessive DNA damage and also simultaneously inhibiting the HR pathway.
Combination Pair ID: 812
Pair Name Resveratrol, Sorafenib
Phytochemical Resveratrol
Drug Sorafenib
Disease Info [ICD-11: 2C90.0] Renal cell carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result PEGylated resveratrol combined with sorafenib can achieve synergistic anti-RCC activity, and the mechanism may be related to the inhibition of Akt/mTOR/p70S6k-4EBP-1 and c-Raf7MEK/ERK signaling pathways.
Combination Pair ID: 388
Pair Name Curcumin, Apatinib
Phytochemical Curcumin
Drug Apatinib
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Apa-Cur combination therapy exerts more profound anti-proliferation effects on breast cancer cell than Apatinib or Curcumin monotherapy. However, further studies are required to identify other possible signaling pathways and mechanisms involved in the anticancer effects of Apatinib, Curcumin, and Apa-Cur.
Combination Pair ID: 389
Pair Name Curcumin, Docetaxel
Phytochemical Curcumin
Drug Docetaxel
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result CUR combined with DTX induced apoptosis and autophagy of ESCC and probably worked through the PI3K/AKT/mTOR signaling pathway. The combination of the autophagy inhibitor, CUR and DTX may become a new treatment strategy for esophageal cancer.
Combination Pair ID: 390
Pair Name Curcumin, Arsenic oxide (As2O3)
Phytochemical Curcumin
Drug Arsenic oxide (As2O3)
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Apoptosis regulator BAX Expression
Result The antitumor effects of combination therapy with As2O3 and Curcumin have been displayed on prostate cancer cell lines (LNCaP and PC3), which probably originates from their potential to induce apoptosis and inhibit the growth of prostate cancer cells simultaneously.
Combination Pair ID: 400
Pair Name Curcumin, Arsenic trioxide
Phytochemical Curcumin
Drug Arsenic trioxide
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our results suggested that curcumin and As2O3 combination therapy exerts more significant anti-leukemia effects in the treatment of AML than curcumin or As2O3 monotherapy by up-regulating p53 pathway and down-regulating the JAK2/STAT3 pathway.
Combination Pair ID: 403
Pair Name Curcumin, Binimetinib
Phytochemical Curcumin
Drug Binimetinib
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our data demonstrates that curcumin exerts significant synergistic anticancer effects on MM cells by inducing ROS and necroptosis when combined with binimetinib. Therefore, a strategy of adding curcumin to conventional anticancer agents holds promise for treating MM.
Combination Pair ID: 825
Pair Name Curcumin, Dactolisib
Phytochemical Curcumin
Drug Dactolisib
Disease Info [ICD-11: 2D11.Y] Neuroblastoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Synergistic anti-proliferative and apoptotic effect of NVP-BEZ235 and curcumin on human SH-SY5Y neuroblastoma cells.
Combination Pair ID: 827
Pair Name Curcumin, TNF-related apoptosis inducing ligand
Phytochemical Curcumin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Combined treatment with curcumin and carboplatin inhibited tumor cell growth, migration, and invasion compared with either drug alone. The synergistic antitumor activity of curcumin combined with carboplatin is mediated by multiple mechanisms involving suppression of NF-kappaB via inhibition of the Akt/IKKalpha pathway and enhanced ERK1/2 activity
Combination Pair ID: 831
Pair Name Capsaicin, 3,3'-diindolylmethane
Phytochemical Capsaicin
Drug 3,3'-diindolylmethane
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The present study suggests capsaicin and DIM work synergistically to inhibit cell proliferation and induce apoptosis in colorectal cancer through modulating transcriptional activity of NF-κB, p53, and target genes associated with apoptosis.
Combination Pair ID: 834
Pair Name Capsaicin, Sorafenib
Phytochemical Capsaicin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These data confirm that capsaicin and sorafenib combination treatment inhibits the growth, invasion and metastasis of HCC cells and induces autophagy in a synergistic manner, supporting its potential as a therapeutic option for HCC.
Combination Pair ID: 409
Pair Name Luteolin, Paclitaxel
Phytochemical Luteolin
Drug Paclitaxel
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The molecular mechanism of inhibiting cell migration and EMT processes may be related to the inhibition of SIRT1, and the mechanism of apoptosis induction is associated with the reactive oxygen species (ROS)/c-Jun N-terminal kinase (JNK) pathway-mediated activation of mitochondrial apoptotic pathway.
Combination Pair ID: 840
Pair Name Luteolin, Cisplatin
Phytochemical Luteolin
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These findings indicate the anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cells and luteolin may be a promising candidate agent used in the treatment of gastric cancer.
Combination Pair ID: 847
Pair Name Luteolin, Celecoxib
Phytochemical Luteolin
Drug Celecoxib
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results demonstrate the synergistic anti-tumor effect of the celecoxib and luteolin combination treatment in different four breast cancer cell lines, thus introducing the possibility of this combination as a new treatment modality.
Combination Pair ID: 849
Pair Name Luteolin, Gemcitabine
Phytochemical Luteolin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Luteolin + Gem promoted apoptotic cell death in pancreatic tumor cells in vivo through inhibition of the K-ras/GSK-3β/NF-κB signaling pathway, leading to a reduction in the Bcl-2/Bax ratio, release of cytochrome c, and activation of caspase 3.
Combination Pair ID: 415
Pair Name Icariin, Fluorouracil
Phytochemical Icariin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result We suggest that combination of icariin with 5-FU might offer a therapeutic benefit to the patients with CRC; however, further studies are required to ascertain this proposition.
Combination Pair ID: 424
Pair Name Cianidanol, Fluorouracil
Phytochemical Cianidanol
Drug Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result We suggest catechin as a candidate for the development of a novel adjuvant drug that reduces chemoresistance to 5FU by restricting LDHA.
Combination Pair ID: 426
Pair Name Acteoside, Temozolomide
Phytochemical Acteoside
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result It was also determined that TMZ + acteoside induced apoptosis and autophagy through the mitogen‑activated protein kinase signaling pathway. These findings suggest that acteoside has beneficial effects on TMZ‑based glioblastoma therapy.
Combination Pair ID: 861
Pair Name Glabridin, Paclitaxel
Phytochemical Glabridin
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Glabridin plays dual action to intensify anti-metastatic potential of paclitaxel via impeding CYP2C8 in liver and CYP2J2/EETs in tumor of an orthotopic mouse model of breast cancer
Combination Pair ID: 431
Pair Name Hypericin, Gemcitabine
Phytochemical Hypericin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result We demonstrated that Gem combined HY-PDT could inhibit the proliferation of Capan-2 cells and induce cell apoptosis. HY-PDT combined with Gem had a great potential on pancreatic cancer treatment clinically.
Combination Pair ID: 433
Pair Name [6]-Gingerol, Cisplatin
Phytochemical [6]-Gingerol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The findings of the present study demonstrated that the cisplatin and 6-gingerol combination is more effective in inducing apoptosis and suppressing the angiogenesis of ovarian cancer cells than using each drug alone.
Combination Pair ID: 434
Pair Name [6]-Gingerol, Paclitaxel
Phytochemical [6]-Gingerol
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Anticancer Efficacy of 6-Gingerol with Paclitaxel against Wild Type of Human Breast Adenocarcinoma
Combination Pair ID: 440
Pair Name alpha-Mangostin, Gemcitabine
Phytochemical alpha-Mangostin
Drug Gemcitabine
Disease Info [ICD-11: 2C13] Gallbladder cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result α-Mangostin suppresses the de novo lipogenesis and enhances the chemotherapeutic response to gemcitabine in gallbladder carcinoma cells via targeting the AMPK/SREBP1 cascades.
Combination Pair ID: 864
Pair Name Paeonol, Cisplatin
Phytochemical Paeonol
Drug Cisplatin
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Paeonol, in combination with cisplatin, had a significantly synergistic growth-inhibitory effect on oesophageal cell line, which may be related to apoptosis induction
Combination Pair ID: 448
Pair Name Naringenin, Diosmin
Phytochemical Naringenin
Drug Diosmin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Diosmin in combination with naringenin enhances apoptosis in colon cancer cells
Combination Pair ID: 867
Pair Name Theaflavin 3,3'-digallate, Cisplatin
Phytochemical Theaflavin 3,3'-digallate
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result TF3 may be used as an adjuvant for the treatment of advanced ovarian cancer.
Combination Pair ID: 869
Pair Name Shogaol, Fluorouracil
Phytochemical Shogaol
Drug Fluorouracil
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our data suggest that the addition of 6-shogaol to established chemotherapeutic regimens could potentially be a remarkable therapeutic strategy for colorectal cancer.
Combination Pair ID: 465
Pair Name Gossypol, Ponatinib
Phytochemical Gossypol
Drug Ponatinib
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Gossypol could be used as an adjuvant medication for ponatinib in cancer treatment, possibly leading to successful dose reductions and fewer side effects; however, further research is needed before a clinical application could be feasible.
Combination Pair ID: 875
Pair Name Gossypol, Zoledronic acid
Phytochemical Gossypol
Drug Zoledronic acid
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result GP significantly enhances the anti-tumor activity of ZA in hormone- and drug-resistant prostate cancer cells by targeting many pivotal apoptosis-related proteins.
Combination Pair ID: 876
Pair Name Gossypol, Doxorubicin
Phytochemical Gossypol
Drug Doxorubicin
Disease Info [ICD-11: 2B5A] Biphasic synovial sarcoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Combination therapy with L gossypol and low-concentration doxorubicin inhibited cell proliferation and induced apoptosis in SW982 HSSCs at a significantly greater level compared with either treatment alone
Combination Pair ID: 473
Pair Name Tea polyphenol, Paclitaxel
Phytochemical Tea polyphenol
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our results showed that the combination of green tea and PTX could be more potent than the individual drug to induce cytotoxicity and apoptosis in ovarian cancer cells.
Combination Pair ID: 474
Pair Name Oxidized tea polyphenol, Nimotuzumab
Phytochemical Oxidized tea polyphenol
Drug Nimotuzumab
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result OTP-3 can also serve as an effective therapeutic agent in NSCLC where it can augment the effects of nimotuzumab, a valuable property for combination agents.
Combination Pair ID: 485
Pair Name 10-Gingerol, Paclitaxel
Phytochemical 10-Gingerol
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This data suggests that 10-G may be used as a new chemotherapeutic synergist in combination with paclitaxel to enhance anticancer activity. The potential value of ADRB2 as a target for improving chemotherapy sensitivity was also emphasized.
Combination Pair ID: 486
Pair Name Gambogenic acid, Doxorubicin
Phytochemical Gambogenic acid
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Gambogenic Acid Inhibits Basal Autophagy of Drug-Resistant Hepatoma Cells and Improves Its Sensitivity to Adriamycin.
Combination Pair ID: 488
Pair Name Gambogenic acid, Fluorouracil
Phytochemical Gambogenic acid
Drug Fluorouracil
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These mechanisms may be due to the toxicity of targeted toxin to mitochondria via the mitochondrial pathway.
Combination Pair ID: 490
Pair Name Gambogic Acid, Gemcitabine
Phytochemical Gambogic Acid
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results demonstrate that gambogic acid sensitizes pancreatic cancer cells to gemcitabine in vitro and in vivo by inhibiting the activation of the ERK/E2F1/RRM2 signaling pathway. The results also indicate that gambogic acid treatment combined with gemcitabine might be a promising chemotherapy strategy for pancreatic cancer.
Combination Pair ID: 491
Pair Name Wogonin, Cisplatin
Phytochemical Wogonin
Drug Cisplatin
Disease Info Head and neck cancer
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Wogonin induced selective cell death by targeting the antioxidant defense mechanisms enhanced in the resistant HNC cells and activating cell death pathways involving PUMA and PARP. Hence, wogonin significantly sensitized resistant HNC cells to cisplatin both in vitro and in vivo. Wogonin is a promising anticancer candidate that induces ROS accumulation and selective cytotoxicity in HNC cells and can help to overcome cisplatin-resistance in this cancer.
Combination Pair ID: 492
Pair Name Gambogic Acid, Paclitaxel
Phytochemical Gambogic Acid
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The combination of GA with paclitaxel may increase the antitumor effects on paclitaxel‑resistant TNBC via downregulating the SHH signaling pathway.
Combination Pair ID: 879
Pair Name Gambogic Acid, Cisplatin
Phytochemical Gambogic Acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Gambogic acid sensitises lung cancer cells to CDDP in vitro and in vivo in NSCLC through inactivation of NF-κB and MAPK/HO-1 signalling pathways, providing a rationale for the combined use of CDDP and GA in lung cancer chemotherapy.
Combination Pair ID: 886
Pair Name Gambogic Acid, Doxorubicin
Phytochemical Gambogic Acid
Drug Doxorubicin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These findings indicate that GA sensitizes lung cancer cells to ADM in vitro and in vivo, providing a rationale for the combined use of GA and ADM in lung cancer chemotherapy.
Combination Pair ID: 497
Pair Name Medicarpin, TNF-related apoptosis inducing ligand
Phytochemical Medicarpin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B33.1] Myeloid leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway
Combination Pair ID: 507
Pair Name Glucosinalbate, Doxorubicin
Phytochemical Glucosinalbate
Drug Doxorubicin
Disease Info [ICD-11: 2C90] Ehrlich ascites carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host.
Combination Pair ID: 519
Pair Name Taurine, Temozolomide
Phytochemical Taurine
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The study showed that the combination between TMZ and TAU has a potential in anticancer properties against U-251 MG manifested by the induction of G2/M arrest and apoptosis. These results suggest that this combination may be useful to enhance the efficacy and reduce some adverse events of GBM treatment in the future.
Combination Pair ID: 523
Pair Name Tannic acid, Cisplatin
Phytochemical Tannic acid
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The results obtained from the present study suggest that the combination of TA and CDDP may exert synergistic anticancer effects and may be a novel adjuvant treatment for liver cancer.
Combination Pair ID: 543
Pair Name Sulforaphane, Metformin
Phytochemical Sulforaphane
Drug Metformin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our data indicate that SLFN and MTFN can reduce cancer cell viability via both collaborative and differential effects and suggest that MTFN increases SLFN effectiveness by targeting common molecules/pathways downstream of HER2 and key for CSC signaling.
Combination Pair ID: 544
Pair Name Sulforaphane, Fluorouracil
Phytochemical Sulforaphane
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Studies of the interaction mechanism have revealed that sulforaphane and 5-fluorouracil act synergistically in the MDA-MB-231 cells by inducing autophagic cell death and premature senescence.
Combination Pair ID: 547
Pair Name Sulforaphane, Cisplatin
Phytochemical Sulforaphane
Drug Cisplatin
Disease Info [ICD-11: 2C28] Malignant mesothelioma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Pro-oxidant activity of sulforaphane and cisplatin potentiates apoptosis and simultaneously promotes autophagy in malignant mesothelioma cells
Combination Pair ID: 551
Pair Name Sulforaphane, PP242
Phytochemical Sulforaphane
Drug PP242
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our findings demonstrate that PP242 enhances the anti-tumor activity of SFN by blocking SFN-induced activation of Akt/mTOR pathway in ESCC, which provides a rationale for treating ESCC using SFN combined with Akt/mTOR pathway inhibitors.
Combination Pair ID: 902
Pair Name Sulforaphane, Gemcitabine
Phytochemical Sulforaphane
Drug Gemcitabine
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Sulforaphane Potentiates Gemcitabine-Mediated Anti-Cancer Effects against Intrahepatic Cholangiocarcinoma by Inhibiting HDAC Activity
Combination Pair ID: 904
Pair Name Sulforaphane, TNF-related apoptosis inducing ligand
Phytochemical Sulforaphane
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The ability of sulforaphane to inhibit tumor growth, metastasis, and angiogenesis and to enhance the therapeutic potential of TRAIL suggests that sulforaphane alone or in combination with TRAIL can be used for the management of prostate cancer.
Combination Pair ID: 558
Pair Name Lycopene, Cisplatin
Phytochemical Lycopene
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Lycopene increases the sensitization of cervical cancer cells to cisplatin via inhibition of cell viability, up-regulation of Bax expression, and down-regulation of Bcl-2 expression. Furthermore, the anticancer effect of lycopene might be also associated with suppression of NF-κB-mediated inflammatory responses, and modulation of Nrf2-mediated oxidative stress. The results of the present study suggest that lycopene and concurrent cisplatin chemotherapy might have a role in improving the treatment of cervical cancer.
Combination Pair ID: 912
Pair Name Lycopene, Eicosapentaenoic acid
Phytochemical Lycopene
Drug Eicosapentaenoic acid
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our novel findings suggest that lycopene and EPA synergistically inhibited the growth of human colon cancer HT-29 cells even at low concentration. The inhibitory effects of lycopene and EPA on cell proliferation of human colon cancer HT-29 cells were, in part, associated with the down-regulation of the PI-3K/Akt/mTOR signaling pathway.
Combination Pair ID: 560
Pair Name Fucoxanthin, TNF-related apoptosis inducing ligand
Phytochemical Fucoxanthin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result We found that fucoxanthin- or TRAIL-induced apoptosis of human cervical cancer cells was obviously down-regulated. CONCLUSIONS Taken together, these findings suggest that fucoxanthin and TRAIL increased the apoptosis in human cervical cancer cells by targeting the PI3K/Akt/NF-κB signaling pathway.
Combination Pair ID: 564
Pair Name Hederagenin, Cisplatin
Phytochemical Hederagenin
Drug Cisplatin
Disease Info Head and neck cancer
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Hederagenin effectively targets cisplatin-resistant HNC cells in vitro and in vivo. Consistent with its effects in other types of cancer, hederagenin markedly induces apoptosis in HNC cells by activating the mitochondria-driven intrinsic apoptotic pathway. We demonstrated that the apoptosis-inducing effects of hederagenin are mediated by the inhibition of the Nrf2-ARE antioxidant pathway.
Combination Pair ID: 567
Pair Name 2,3,5,6-Tetramethylpyrazine, Doxorubicin
Phytochemical 2,3,5,6-Tetramethylpyrazine
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result DLJ14 and Adr combination treatment may inhibit proliferation of Adr-resistant human breast cancer cells through inhibition of the EGFR/PI3K/Akt survival pathway and induction of apoptosis via the mitochondrial-mediated apoptosis pathway.
Combination Pair ID: 568
Pair Name Zerumbone, Cisplatin
Phytochemical Zerumbone
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The current study indicates that the treatment of 4.62 μM of ZER combined with 1.93 μM of CIS in human liver cancer cells exerts synergistic effects on cell growth inhibition, apoptosis induction, angiogenesis, and invasion by modulating gene expression.
Combination Pair ID: 570
Pair Name Zerumbone, Paclitaxel
Phytochemical Zerumbone
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The prooxidant properties of zerumbone potentially resensitize breast cancer cells to PTX by enhancing intracellular ROS-mediated oxidative stress.
Combination Pair ID: 918
Pair Name Zerumbone, Gefitinib
Phytochemical Zerumbone
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our study suggested that zerumbone combined with gefitinib could effectively inhibit lung cancer for multi-model therapies, including the inhibition of tumor growth, angiogenesis, induce cell apoptosis, and ferroptosis.
Combination Pair ID: 921
Pair Name Baicalin, Doxorubicin
Phytochemical Baicalin
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This study demonstrate that the effect of baicalin on Dox treatment could enhance cytotoxicity toward breast cancer cells via the ROS/[Ca2+]i-mediated intrinsic apoptosis pathway-thus potentially lessening the required dosage of doxorubicin, and further exploring associated mechanisms in combined treatments for breast cancer clinical interventions in the future.
Combination Pair ID: 573
Pair Name Sulforaphene, Carboplatin
Phytochemical Sulforaphene
Drug Carboplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This study demonstrates that the duel character of this combination therapy may be an effective replacement for conventional therapy alone against NSCLC.
Combination Pair ID: 576
Pair Name Sulforaphene, Photodynamic therapy
Phytochemical Sulforaphene
Drug Photodynamic therapy
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This study could be useful in the improvement of therapies for human cervical and other types of cancers.
Combination Pair ID: 577
Pair Name Falcarindiol, Cisplatin
Phytochemical Falcarindiol
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our study illustrated that FAD is a potential anticancer drug and strengthens the chemosensitivity of HCC cells to DDP by inhibiting the STAT3/PTTG1 pathway.
Combination Pair ID: 581
Pair Name Zeylenone, Cisplatin
Phytochemical Zeylenone
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway
Combination Pair ID: 584
Pair Name Dehydrobruceine B, Cisplatin
Phytochemical Dehydrobruceine B
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These results generated a rationale for further investigation of DHB combined with CDDP as a potential therapeutic strategy in lung cancer.
Combination Pair ID: 587
Pair Name Pristimerin, Sorafenib
Phytochemical Pristimerin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway
Combination Pair ID: 590
Pair Name Delta-Tocotrienol, Cisplatin
Phytochemical Delta-Tocotrienol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis
Combination Pair ID: 934
Pair Name Gallic acid, Cisplatin
Phytochemical Gallic acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result GA enhanced the anticancer effect of Pira on K562 and K562/Dox cancer cells through cellular energy status impairment, and was able to reverse drug resistance in living K562/Dox cancer cells by inhibiting the function of P‑glycoprotein.
Combination Pair ID: 597
Pair Name Cordycepin, Cisplatin
Phytochemical Cordycepin
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This study provides comprehensive evidence that cordycepin inhibits osteosarcoma cell growth and invasion and induces osteosarcoma cell apoptosis by activating AMPK and inhibiting the AKT/mTOR signaling pathway and enhances the sensitivity of osteosarcoma cells to cisplatin, suggesting that cordycepin is a promising treatment for osteosarcoma.
Combination Pair ID: 935
Pair Name Cordycepin, Apatinib
Phytochemical Cordycepin
Drug Apatinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our findings demonstrated that the combination of cordycepin and apatinib has synergistically anticancer effect on NSCLC cells by down-regulating VEGF/PI3K/Akt signaling pathway. This result indicated that cordycepin and apatinib could be a promising drug combination against NSCLC.
Combination Pair ID: 601
Pair Name Berberine, Erlotinib
Phytochemical Berberine
Drug Erlotinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our data supported use of BBR in combination with erlotinib as a novel strategy for treatment of patients with EGFR positive tumors.
Combination Pair ID: 602
Pair Name Berberine, Cisplatin
Phytochemical Berberine
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway
Combination Pair ID: 946
Pair Name Guggulsterone, Gemcitabine
Phytochemical Guggulsterone
Drug Gemcitabine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The combination of guggulsterone to gemcitabine enhanced antitumor efficacy through apoptosis induction by suppressing Akt and nuclear factor KappaB activity and by modulating apoptosis-related protein expression in pancreatic cancer
Combination Pair ID: 604
Pair Name Evening primrose oil, Tamoxifen
Phytochemical Evening primrose oil
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The most significant finding of this study was the confirmation of the anticancer activity of the natural product EPO, which potentiated the activity of the anticancer drug TAM against MCF-7 and MDA-MB-231 BC cell lines through the induction of apoptosis, inhibiting angiogenesis and halting cell proliferation.
Combination Pair ID: 608
Pair Name Noscapine, Paclitaxel
Phytochemical Noscapine
Drug Paclitaxel
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This study provides a novel concept of combination treatment of paclitaxel and noscapine to improve efficiency in human prostate cancer treatment.
Combination Pair ID: 955
Pair Name Noscapine, Cisplatin
Phytochemical Noscapine
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our results suggest that Nos enhanced the anticancer activity of Cis in an additive to synergistic manner by activating multiple signaling pathways including apoptosis. These findings suggest potential benefit for use of Nos and Cis combination in treatment of lung cancer.
Combination Pair ID: 956
Pair Name Noscapine, Doxorubicin
Phytochemical Noscapine
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Noscapine potentiated the anticancer activity of Doxorubicin in a synergistic manner against TNBC tumors via inactivation of NF-KB and anti-angiogenic pathways while stimulating apoptosis. These findings suggest potential benefit for use of oral Noscapine and Doxorubicin combination therapy for treatment of more aggressive TNBC.
Combination Pair ID: 957
Pair Name Noscapine, Gemcitabine
Phytochemical Noscapine
Drug Gemcitabine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Nos potentiated the anticancer activity of Gem in an additive to synergistic manner against lung cancer via antiangiogenic and apoptotic pathways. These findings suggest potential benefit for use of NGC chemotherapy for treatment of lung cancer.
Combination Pair ID: 962
Pair Name Platycodin D, Venetoclax
Phytochemical Platycodin D
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Platycodin D may be a potent therapeutic candidate for the treatment of AML
Combination Pair ID: 1041
Pair Name Plumbagin, rsTRAIL
Phytochemical Plumbagin
Drug rsTRAIL
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our results suggest that both plumbagin and rsTRAIL could be used as a single agent or synergistical agents to induce apoptosis of leukemic Kasumi‑1 cells in vitro and in vivo.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 15
Pair Name Cepharanthine, Cisplatin
Phytochemical Cepharanthine
Drug Cisplatin
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals
Combination Pair ID: 60
Pair Name Quercetin, Docetaxel
Phytochemical Quercetin
Drug Docetaxel
Disease Info [ICD-11: 2E02] Metastatic prostate cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Quercetin reverses docetaxel resistance in prostate cancer via androgen receptor and PI3K/Akt signaling pathways
Combination Pair ID: 628
Pair Name Sanguinarium, Gefitinib
Phytochemical Sanguinarium
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Targeting EGFR by elevating ROS and redox imbalance is a potential new strategy to develop a new EGFR inhibitor for TKI-resistant patients with a wide therapeutic window between EGFR(T790M) and EGFR(WT)
Combination Pair ID: 105
Pair Name Chrysin, Fluorouracil
Phytochemical Chrysin
Drug Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Potentiating activities of chrysin in the therapeutic efficacy of 5-fluorouracil in gastric cancer cells
Combination Pair ID: 176
Pair Name Parthenolide, Temozolomide
Phytochemical Parthenolide
Drug Temozolomide
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result These findings suggest that NF-κB is a potential target for inducing cell death in gliomas. A targeted combination strategy in which the response to TMZ is synergistically enhanced by the addition of parthenolide which may be useful, especially in chemoresistant gliomas with high MGMT expression.
Combination Pair ID: 829
Pair Name Demethoxycurcumin, Cisplatin
Phytochemical Demethoxycurcumin
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result The findings from the present study suggested that DMC in combination with DDP may be considered as a novel combination regimen for restoring DDP sensitivity in DDP-resistant NSCLC cells.
Combination Pair ID: 871
Pair Name Shogaol, TNF-related apoptosis inducing ligand
Phytochemical Shogaol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result This study gives rise to the possibility of applying shogaol as an antitumor agent that can be used for the purpose of combination treatment with TRAIL in TRAIL-resistant colon tumor therapy.
Combination Pair ID: 888
Pair Name Gambogic Acid, Gefitinib
Phytochemical Gambogic Acid
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Gefitinib in combination with GA resulted in antitumor growth in the EGFR-T790M secondary mutation NCI-H1975 tumor model due to an enhanced apoptotic effect. This novel therapeutic strategy may be a practical approach for the treatment of patients who show gefitinib resistance.
Combination Pair ID: 917
Pair Name 2,3,5,6-Tetramethylpyrazine, Cisplatin
Phytochemical 2,3,5,6-Tetramethylpyrazine
Drug Cisplatin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result A series of ligustrazine-derived chalcones-modified platinum(IV) complexes were synthesized and evaluated for their anti-proliferative potency and generated an optimal platinum(IV) complex 16a. The above-described results indicated that 16a obtained different anti-cancer mechanisms of CDDP, which could initiate mitochondria-dependent apoptosis and xCT-GPX4 axial-mediated ferroptosis in PANC-1/CDDP cells.
Combination Pair ID: 596
Pair Name Cordycepin, Cisplatin
Phytochemical Cordycepin
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Our results suggested that Cor in combination with DDP could be an additional therapeutic option for the treatment of DDP-resistant NSCLC.
Combination Pair ID: 733
Pair Name Shikonin, Gefitinib
Phytochemical Shikonin
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Apoptosis regulator BAX Expression
Result Shikonin-induced cell apoptosis is closely associated with ROS elevation in the cells. These findings indicate that Shikonin can be an effective small molecule treating gefitinib-resistant NSCLC.
03. Reference
No. Title Href
1 Chemotherapeutic effect of baicalein/epirubicin combination against liver cell carcinoma in-vitro: Inducing apoptosis and autophagy. Toxicol In Vitro. 2024 Mar;95:105744. doi: 10.1016/j.tiv.2023.105744. Click
2 P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin. Biomed Res Int. 2019 Nov 6;2019:6407210. doi: 10.1155/2019/6407210. Click
3 Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells. J Food Sci. 2021 Jun;86(6):2700-2712. doi: 10.1111/1750-3841.15740. Click
4 Chrysin attenuates paclitaxel-induced hepatorenal toxicity in rats by suppressing oxidative damage, inflammation, and apoptosis. Life Sci. 2023 Nov 1;332:122096. doi: 10.1016/j.lfs.2023.122096. Click
5 The Effect of Calycosin-7-O-β-D-Glucoside and its Synergistic Augmentation of Cisplatin-induced Apoptosis in SK-OV-3 Cells. Curr Pharm Des. 2022;28(26):2161-2166. doi: 10.2174/1381612828666220610164100. Click
6 Anticancer and apoptotic activities of parthenolide in combination with epirubicin in mda-mb-468 breast cancer cells. Mol Biol Rep. 2020 Aug;47(8):5807-5815. doi: 10.1007/s11033-020-05649-3. Click
7 Oleanolic acid increases the anticancer potency of doxorubicin in pancreatic cancer cells. J Biochem Mol Toxicol. 2023 Oct;37(10):e23426. doi: 10.1002/jbt.23426. Click
8 Lupeol and Paclitaxel cooperate in hindering hypoxia induced vasculogenic mimicry via suppression of HIF-1α-EphA2-Laminin-5γ2 network in human oral cancer. J Cell Commun Signal. 2023 Sep;17(3):591-608. doi: 10.1007/s12079-022-00693-z. Click
9 Effects of combined treatment with Indomethacin and Juglone on AOM/DSS induced colon carcinogenesis in Balb/c mice: Roles of inflammation and apoptosis. Life Sci. 2021 Jan 1;264:118657. doi: 10.1016/j.lfs.2020.118657. Click
10 Protective effect of Chlorogenic acid against methotrexate induced oxidative stress, inflammation and apoptosis in rat liver: An experimental approach. Chem Biol Interact. 2017 Jun 25;272:80-91. doi: 10.1016/j.cbi.2017.05.002. Click
11 Targeting the ROS/PI3K/AKT/HIF-1α/HK2 axis of breast cancer cells: Combined administration of Polydatin and 2-Deoxy-d-glucose. J Cell Mol Med. 2019 May;23(5):3711-3723. doi: 10.1111/jcmm.14276. Click
12 Exosomes released from U87 glioma cells treated with curcumin and/or temozolomide produce apoptosis in naive U87 cells. Pathol Res Pract. 2023 May;245:154427. doi: 10.1016/j.prp.2023.154427. Click
13 Synergistic antitumor effect of puerarin combined with 5-fluorouracil on gastric carcinoma. Mol Med Rep. 2015 Apr;11(4):2562-8. doi: 10.3892/mmr.2014.3016. Click
14 Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. Click
15 The synergistic effect between vanillin and doxorubicin in ehrlich ascites carcinoma solid tumor and MCF-7 human breast cancer cell line. Pathol Res Pract. 2016 Sep;212(9):767-77. doi: 10.1016/j.prp.2016.06.004. Click
16 Enhanced antitumor activity and attenuated cardiotoxicity of Epirubicin combined with Paeonol against breast cancer. Tumour Biol. 2016 Sep;37(9):12301-12313. doi: 10.1007/s13277-016-5088-9. Click
17 Mangiferin Ameliorates Cisplatin Induced Acute Kidney Injury by Upregulating Nrf-2 via the Activation of PI3K and Exhibits Synergistic Anticancer Activity With Cisplatin. Front Pharmacol. 2018 Jun 18;9:638. doi: 10.3389/fphar.2018.00638. Click
18 The combination of Biochanin A and SB590885 potentiates the inhibition of tumour progression in hepatocellular carcinoma. Cancer Cell Int. 2020 Aug 5;20:371. doi: 10.1186/s12935-020-01463-w. Click
19 Combination of 7-hydroxycoumarin in a platinum(IV) complex derived from cisplatin enhanced cytotoxicity with multiple mechanisms of action. J Inorg Biochem. 2018 Sep;186:17-23. doi: 10.1016/j.jinorgbio.2018.05.015. Click
20 Levistolide A synergistically enhances doxorubicin‑induced apoptosis of k562/dox cells by decreasing MDR1 expression through the ubiquitin pathway. Oncol Rep. 2019 Feb;41(2):1198-1208. doi: 10.3892/or.2018.6889. Click
21 Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer. Oncol Lett. 2016 Aug;12(2):983-988. doi: 10.3892/ol.2016.4696. Click
22 Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer. Oncol Lett. 2016 Aug;12(2):983-988. doi: 10.3892/ol.2016.4696. Click
23 Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells. Chem Biol Interact. 2022 Feb 25;354:109832. doi: 10.1016/j.cbi.2022.109832. Click
24 Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells. Biomed Pharmacother. 2020 Aug;128:110243. doi: 10.1016/j.biopha.2020.110243. Click
25 Piperlongumine synergistically enhances the antitumour activity of sorafenib by mediating ROS-AMPK activation and targeting CPSF7 in liver cancer. Pharmacol Res. 2022 Mar;177:106140. doi: 10.1016/j.phrs.2022.106140. Click
26 The synergistic effects of oxaliplatin and piperlongumine on colorectal cancer are mediated by oxidative stress. Cell Death Dis. 2019 Aug 8;10(8):600. doi: 10.1038/s41419-019-1824-6. Click
27 Synergistic antitumour activity of sorafenib in combination with tetrandrine is mediated by reactive oxygen species (ROS)/Akt signaling. Br J Cancer. 2013 Jul 23;109(2):342-50. doi: 10.1038/bjc.2013.334. Click
28 Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo. Cancer Lett. 2011 May 1;304(1):21-32. doi: 10.1016/j.canlet.2011.01.022. Click
29 Trigonelline inhibits Nrf2 via EGFR signalling pathway and augments efficacy of Cisplatin and Etoposide in NSCLC cells. Toxicol In Vitro. 2021 Feb;70:105038. doi: 10.1016/j.tiv.2020.105038. Click
30 Berbamine Hydrochloride inhibits lysosomal acidification by activating Nox2 to potentiate chemotherapy-induced apoptosis via the ROS-MAPK pathway in human lung carcinoma cells. Cell Biol Toxicol. 2023 Aug;39(4):1297-1317. doi: 10.1007/s10565-022-09756-8. Click
31 Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells. J Enzyme Inhib Med Chem. 2023 Dec;38(1):1-11. doi: 10.1080/14756366.2022.2132487. Click
32 Cooperative inhibitory effect of sinomenine combined with 5-fluorouracil on esophageal carcinoma. World J Gastroenterol. 2013 Dec 7;19(45):8292-300. doi: 10.3748/wjg.v19.i45.8292. Click
33 Amygdalin as a chemoprotective agent in co-treatment with cisplatin. Front Pharmacol. 2022 Sep 20;13:1013692. doi: 10.3389/fphar.2022.1013692. Click
34 Leonurine Promotes Cisplatin Sensitivity in Human Cervical Cancer Cells Through Increasing Apoptosis and Inhibiting Drug-Resistant Proteins. Drug Des Devel Ther. 2020 May 15;14:1885-1895. doi: 10.2147/DDDT.S252112. Click
35 Solamargine induces autophagy-mediated apoptosis and enhances bortezomib activity in multiple myeloma. Clin Exp Pharmacol Physiol. 2022 Jun;49(6):674-685. doi: 10.1111/1440-1681.13643. Click
36 Sanguinarine Induces Apoptosis Pathway in Multiple Myeloma Cell Lines via Inhibition of the JaK2/STAT3 Signaling. Front Oncol. 2019 Apr 17;9:285. doi: 10.3389/fonc.2019.00285. Click
37 The role of daurisoline treatment in hepatocellular carcinoma: Inhibiting vasculogenic mimicry formation and enhancing sensitivity to sorafenib. Phytomedicine. 2021 Nov;92:153740. doi: 10.1016/j.phymed.2021.153740. Click
38 Lentinan Enhances the Function of Oxaliplatin on the Esophageal Tumors by Persuading Immunogenic Cell Death. Comput Math Methods Med. 2023 Oct 4;2023:9827631. doi: 10.1155/2023/9827631. Click
39 Polyphyllin I and VII potentiate the chemosensitivity of A549/DDP cells to cisplatin by enhancing apoptosis, reversing EMT and suppressing the CIP2A/AKT/mTOR signaling axis. Oncol Lett. 2019 Nov;18(5):5428-5436. doi: 10.3892/ol.2019.10895. Click
40 Quercetin-Induced Glutathione Depletion Sensitizes Colorectal Cancer Cells to Oxaliplatin. Foods. 2023 Apr 21;12(8):1733. doi: 10.3390/foods12081733. Click
41 Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis. Oncol Lett. 2022 Jan;23(1):16. doi: 10.3892/ol.2021.13134. Click
42 Luteolin Suppresses the Proliferation of Gastric Cancer Cells and Acts in Synergy with Oxaliplatin. Biomed Res Int. 2020 Feb 21;2020:9396512. doi: 10.1155/2020/9396512. Click
43 Synergistic effect of kaempferol and 5‑fluorouracil on the growth of colorectal cancer cells by regulating the PI3K/Akt signaling pathway. Mol Med Rep. 2019 Jul;20(1):728-734. doi: 10.3892/mmr.2019.10296. Click
44 Kaempferol potentiates the sensitivity of pancreatic cancer cells to erlotinib via inhibition of the PI3K/AKT signaling pathway and epidermal growth factor receptor. Inflammopharmacology. 2021 Oct;29(5):1587-1601. doi: 10.1007/s10787-021-00848-1. Click
45 Baicalin; a promising chemopreventive agent, enhances the antitumor effect of 5-FU against breast cancer and inhibits tumor growth and angiogenesis in Ehrlich solid tumor. Biomed Pharmacother. 2022 Feb;146:112599. doi: 10.1016/j.biopha.2021.112599. Click
46 Synergistic effect of fisetin combined with sorafenib in human cervical cancer HeLa cells through activation of death receptor-5 mediated caspase-8/caspase-3 and the mitochondria-dependent apoptotic pathway. Tumour Biol. 2016 May;37(5):6987-96. doi: 10.1007/s13277-015-4526-4. Click
47 Fisetin, a phytochemical, potentiates sorafenib-induced apoptosis and abrogates tumor growth in athymic nude mice implanted with BRAF-mutated melanoma cells. Oncotarget. 2015 Sep 29;6(29):28296-311. doi: 10.18632/oncotarget.5064. Click
48 Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells. Exp Oncol. 2021 Jun;43(2):125-134. doi: 10.32471/exp-oncology.2312-8852.vol-43-no-2.16096. Click
49 Apigenin potentiates TRAIL therapy of non-small cell lung cancer via upregulating DR4/DR5 expression in a p53-dependent manner. Sci Rep. 2016 Oct 18;6:35468. doi: 10.1038/srep35468. Click
50 Nobiletin downregulates the SKP2-p21/p27-CDK2 axis to inhibit tumor progression and shows synergistic effects with palbociclib on renal cell carcinoma. Cancer Biol Med. 2021 Feb 15;18(1):227-244. doi: 10.20892/j.issn.2095-3941.2020.0186. Click
51 Synergistic Effects of Nobiletin and Sorafenib Combination on Metastatic Prostate Cancer Cells. Nutr Cancer. 2019;71(8):1299-1312. doi: 10.1080/01635581.2019.1601237. Click
52 The novel small molecule BH3 mimetic nobiletin synergizes with vorinostat to induce apoptosis and autophagy in small cell lung cancer. Biochem Pharmacol. 2023 Oct;216:115807. doi: 10.1016/j.bcp.2023.115807. Click
53 Combination of isoliquiritigenin and tumor necrosis factor-related apoptosis-inducing ligand induces apoptosis in colon cancer HT29 cells. Environ Health Prev Med. 2008 Sep;13(5):281-7. doi: 10.1007/s12199-008-0041-1. Click
54 Synergistic therapy with tangeretin and 5-fluorouracil accelerates the ROS/JNK mediated apoptotic pathway in human colorectal cancer cell. Food Chem Toxicol. 2020 Sep;143:111529. doi: 10.1016/j.fct.2020.111529. Click
55 Hesperetin Promotes Cisplatin-Induced Apoptosis of Gastric Cancer In Vitro and In Vivo by Upregulating PTEN Expression. Front Pharmacol. 2020 Aug 27;11:1326. doi: 10.3389/fphar.2020.01326. Click
56 Administration with hyperoside sensitizes breast cancer cells to paclitaxel by blocking the TLR4 signaling. Mol Cell Probes. 2020 Oct;53:101602. doi: 10.1016/j.mcp.2020.101602. Click
57 Functional daidzein enhances the anticancer effect of topotecan and reverses BCRP-mediated drug resistance in breast cancer. Pharmacol Res. 2019 Sep;147:104387. doi: 10.1016/j.phrs.2019.104387. Click
58 Combination of cyanidin-3-O-glucoside and cisplatin induces oxidative stress and apoptosis in HeLa cells by reducing activity of endogenous antioxidants, increasing bax/bcl-2 mRNA expression ratio, and downregulating Nrf2 expression. J Food Biochem. 2021 Jul;45(7):e13806. doi: 10.1111/jfbc.13806. Click
59 Anticancer Efficacy and Mechanism of Amentoflavone for Sensitizing Oral Squamous Cell Carcinoma to Cisplatin. Anticancer Res. 2020 Dec;40(12):6723-6732. doi: 10.21873/anticanres.14695. Click
60 Antitumor effects and the underlying mechanism of licochalcone A combined with 5-fluorouracil in gastric cancer cells. Oncol Lett. 2017 Mar;13(3):1695-1701. doi: 10.3892/ol.2017.5614. Click
61 Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines. Mol Med Rep. 2018 Aug;18(2):1835-1841. doi: 10.3892/mmr.2018.9129. Click
62 Combination of chrysin and cisplatin promotes the apoptosis of Hep G2 cells by up-regulating p53. Chem Biol Interact. 2015 May 5;232:12-20. doi: 10.1016/j.cbi.2015.03.003. Click
63 Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation. Biomed Pharmacother. 2017 Sep;93:948-960. doi: 10.1016/j.biopha.2017.06.095. Click
64 Hispidulin Enhances Temozolomide (TMZ)-Induced Cytotoxicity against Malignant Glioma Cells In Vitro by Inhibiting Autophagy. Comput Intell Neurosci. 2022 Jun 28;2022:5266770. doi: 10.1155/2022/5266770. Click
65 Galangin (GG) combined with cisplatin (DDP) to suppress human lung cancer by inhibition of STAT3-regulated NF-κB and Bcl-2/Bax signaling pathways. Biomed Pharmacother. 2018 Jan;97:213-224. doi: 10.1016/j.biopha.2017.10.059. Click
66 Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a. Int J Mol Med. 2015 Oct;36(4):957-66. doi: 10.3892/ijmm.2015.2324. Click
67 Morin enhances auranofin anticancer activity by up-regulation of DR4 and DR5 and modulation of Bcl-2 through reactive oxygen species generation in Hep3B human hepatocellular carcinoma cells. Phytother Res. 2019 May;33(5):1384-1393. doi: 10.1002/ptr.6329. Click
68 Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253. Click
69 Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63. doi: 10.1038/sj.onc.1210840. Click
70 Induction of G2M Arrest by Flavokawain A, a Kava Chalcone, Increases the Responsiveness of HER2-Overexpressing Breast Cancer Cells to Herceptin. Molecules. 2017 Mar 14;22(3):462. doi: 10.3390/molecules22030462. Click
71 Neobavaisoflavone sensitizes apoptosis via the inhibition of metastasis in TRAIL-resistant human glioma U373MG cells. Life Sci. 2014 Jan 30;95(2):101-7. doi: 10.1016/j.lfs.2013.10.035. Click
72 Irigenin sensitizes TRAIL-induced apoptosis via enhancing pro-apoptotic molecules in gastric cancer cells. Biochem Biophys Res Commun. 2018 Feb 12;496(3):998-1005. doi: 10.1016/j.bbrc.2018.01.003. Click
73 Role of gambogic acid and NaI131 in A549/DDP cells. Oncol Lett. 2017 Jan;13(1):37-44. doi: 10.3892/ol.2016.5435. Click
74 Combination of gambogic acid with cisplatin enhances the antitumor effects on cisplatin-resistant lung cancer cells by downregulating MRP2 and LRP expression. Onco Targets Ther. 2016 Jun 2;9:3359-68. doi: 10.2147/OTT.S100936. Click
75 Celastrol enhances tamoxifen sensitivity in the treatment of triple negative breast cancer via mitochondria mediated apoptosis pathway. Am J Transl Res. 2023 Apr 15;15(4):2703-2715. Click
76 Resveratrol enhances the antitumor effects of temozolomide in glioblastoma via ROS-dependent AMPK-TSC-mTOR signaling pathway. CNS Neurosci Ther. 2012;18(7):536-546. doi:10.1111/j.1755-5949.2012.00319.x Click
77 Artesunate exhibits synergistic anti-cancer effects with cisplatin on lung cancer A549 cells by inhibiting MAPK pathway. Gene. 2021 Jan 15;766:145134. doi: 10.1016/j.gene.2020.145134. Click
78 Synergistic antitumor effect of brusatol combined with cisplatin on colorectal cancer cells. Int J Mol Med. 2018 Mar;41(3):1447-1454. doi: 10.3892/ijmm.2018.3372. Click
79 Oridonin in combination with imatinib exerts synergetic anti-leukemia effect in Ph+ acute lymphoblastic leukemia cells in vitro by inhibiting activation of LYN/mTOR signaling pathway. Cancer Biol Ther. 2012 Nov;13(13):1244-54. doi: 10.4161/cbt.21460. Click
80 Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195. Click
81 Astragaloside IV enhances the sensibility of lung adenocarcinoma cells to bevacizumab by inhibiting autophagy. Drug Dev Res. 2022 Apr;83(2):461-469. doi: 10.1002/ddr.21878. Click
82 Synergistic activity of sorafenib and betulinic acid against clonogenic activity of non-small cell lung cancer cells. Cancer Sci. 2017 Nov;108(11):2265-2272. doi: 10.1111/cas.13386. Click
83 Synergism of ursolic acid and cisplatin promotes apoptosis and enhances growth inhibition of cervical cancer cells via suppressing NF-κB p65. Oncotarget. 2017 Oct 30;8(57):97416-97427. doi: 10.18632/oncotarget.22133. Click
84 Tanshinone IIA combined with cisplatin synergistically inhibits non-small-cell lung cancer in vitro and in vivo via down-regulating the phosphatidylinositol 3-kinase/Akt signalling pathway. Phytother Res. 2019 Sep;33(9):2298-2309. doi: 10.1002/ptr.6392. Click
85 Astaxanthin Augmented the Anti-Hepatocellular Carcinoma Efficacy of Sorafenib Through the Inhibition of the JAK2/STAT3 Signaling Pathway and Mitigation of Hypoxia within the Tumor Microenvironment. Mol Nutr Food Res. 2024 Jan;68(2):e2300569. doi: 10.1002/mnfr.202300569. Click
86 The combination of gemcitabine and ginsenoside Rh2 enhances the immune function of dendritic cells against pancreatic cancer via the CARD9-BCL10-MALT1 / NF-κB pathway. Clin Immunol. 2023 Mar;248:109217. doi: 10.1016/j.clim.2022.109217. Click
87 Combined Effect of Sodium Selenite and Ginsenoside Rh2 on HCT116 Human Colorectal Carcinoma Cells. Arch Iran Med. 2016 Jan;19(1):23-9. Click
88 Synergistic anticancer activity of 20(S)-Ginsenoside Rg3 and Sorafenib in hepatocellular carcinoma by modulating PTEN/Akt signaling pathway. Biomed Pharmacother. 2018 Jan;97:1282-1288. doi: 10.1016/j.biopha.2017.11.006. Click
89 Ginsenoside RG1 augments doxorubicin-induced apoptotic cell death in MDA-MB-231 breast cancer cell lines. J Biochem Mol Toxicol. 2022 Jan;36(1):e22945. doi: 10.1002/jbt.22945. Click
90 Involvement of Mitochondrial Damage and Oxidative Stress in Apoptosis Induced by Betulin Plus Arsenic Trioxide in Neuroblastoma Cells. Anticancer Res. 2023 Jun;43(6):2467-2476. doi: 10.21873/anticanres.16414. Click
91 Betulinic acid restores imatinib sensitivity in BCR-ABL1 kinase-independent, imatinib-resistant chronic myeloid leukemia by increasing HDAC3 ubiquitination and degradation. Ann N Y Acad Sci. 2020 May;1467(1):77-93. doi: 10.1111/nyas.14298. Click
92 Cucurbitacin B and cisplatin induce the cell death pathways in MB49 mouse bladder cancer model. Exp Biol Med (Maywood). 2020 May;245(9):805-814. doi: 10.1177/1535370220917367. Click
93 Maslinic acid potentiates the antitumor activities of gemcitabine in vitro and in vivo by inhibiting NF-κB-mediated survival signaling pathways in human gallbladder cancer cells. Oncol Rep. 2015 Apr;33(4):1683-90. doi: 10.3892/or.2015.3755. Click
94 Lupeol synergizes with 5-fluorouracil to combat c-MET/EphA2 mediated chemoresistance in triple negative breast cancer. iScience. 2023 Nov 4;26(12):108395. doi: 10.1016/j.isci.2023.108395. Click
95 Use of Saikosaponin D and JNK inhibitor SP600125, alone or in combination, inhibits malignant properties of human osteosarcoma U2 cells. Am J Transl Res. 2019 Apr 15;11(4):2070-2080. Click
96 Carnosic acid cooperates with tamoxifen to induce apoptosis associated with Caspase-3 activation in breast cancer cells in vitro and in vivo. Biomed Pharmacother. 2017 May;89:827-837. doi: 10.1016/j.biopha.2017.01.084. Click
97 Natural compound Tan-I enhances the efficacy of Paclitaxel chemotherapy in ovarian cancer. Ann Transl Med. 2020 Jun;8(12):752. doi: 10.21037/atm-20-4072. Click
98 beta-Elemene, a novel plant-derived antineoplastic agent, increases cisplatin chemosensitivity of lung tumor cells by triggering apoptosis. Oncol Rep. 2009 Jul;22(1):161-70. doi: 10.3892/or_00000420. Click
99 β-elemene enhances cisplatin-induced apoptosis in bladder cancer cells through the ROS-AMPK signaling pathway. Oncol Lett. 2020 Jan;19(1):291-300. doi: 10.3892/ol.2019.11103. Click
100 Synergistic Cytotoxicity of β-Elemene and Cisplatin in Gingival Squamous Cell Carcinoma by Inhibition of STAT3 Signaling Pathway. Med Sci Monit. 2017 Mar 29;23:1507-1513. doi: 10.12659/msm.903783. Click
101 Enhancement of cisplatin-induced apoptosis by β-elemene in resistant human ovarian cancer cells. Med Oncol. 2013 Mar;30(1):424. doi: 10.1007/s12032-012-0424-4. Click
102 Synergistic antitumor effect of β-elemene and etoposide is mediated via induction of cell apoptosis and cell cycle arrest in non-small cell lung carcinoma cells. Mol Med Rep. 2011 Nov-Dec;4(6):1189-93. doi: 10.3892/mmr.2011.537. Click
103 Combining Crocin and Sorafenib Improves Their Tumor-Inhibiting Effects in a Rat Model of Diethylnitrosamine-Induced Cirrhotic-Hepatocellular Carcinoma. Cancers (Basel). 2023 Aug 11;15(16):4063. doi: 10.3390/cancers15164063. Click
104 Atractylenolide I inhibits EMT and enhances the antitumor effect of cabozantinib in prostate cancer via targeting Hsp27. Front Oncol. 2023 Jan 6;12:1084884. doi: 10.3389/fonc.2022.1084884. Click
105 Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel. Genes (Basel). 2022 Jun 24;13(7):1142. doi: 10.3390/genes13071142. Click
106 Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage. Thorac Cancer. 2023 Jul;14(21):2007-2017. doi: 10.1111/1759-7714.14982. Click
107 Synergy of Raddeanin A and cisplatin induced therapeutic effect enhancement in human hepatocellular carcinoma. Biochem Biophys Res Commun. 2017 Apr 1;485(2):335-341. doi: 10.1016/j.bbrc.2017.02.079. Click
108 Furanodiene enhances the anti-cancer effects of doxorubicin on ERα-negative breast cancer cells in vitro. Eur J Pharmacol. 2016 Mar 5;774:10-9. doi: 10.1016/j.ejphar.2015.11.039. Click
109 Impact of fixed-dose combination of germacrone, curdione, and furanodiene on breast cancer cell proliferation. Cell J. 2013 Summer;15(2):160-5. Click
110 Britannin, a sesquiterpene lactone induces ROS-dependent apoptosis in NALM-6, REH, and JURKAT cell lines and produces a synergistic effect with vincristine. Mol Biol Rep. 2021 Sep;48(9):6249-6258. doi: 10.1007/s11033-021-06572-x. Click
111 Britannin a Sesquiterpene Lactone from Inula aucheriana Exerted an Anti-leukemic Effect in Acute Lymphoblastic Leukemia (ALL) Cells and Enhanced the Sensitivity of the Cells to Vincristine. Nutr Cancer. 2022;74(3):965-977. doi: 10.1080/01635581.2021.1931700. Click
112 Shikonin and 4-hydroxytamoxifen synergistically inhibit the proliferation of breast cancer cells through activating apoptosis signaling pathway in vitro and in vivo. Chin Med. 2020 Mar 10;15:23. doi: 10.1186/s13020-020-00305-1. Click
113 Enhancement of cisplatin-induced colon cancer cells apoptosis by shikonin, a natural inducer of ROS in vitro and in vivo. Biochem Biophys Res Commun. 2016 Jan 22;469(4):1075-82. doi: 10.1016/j.bbrc.2015.12.100. Click
114 Emodin and Its Combination with Cytarabine Induce Apoptosis in Resistant Acute Myeloid Leukemia Cells in Vitro and in Vivo. Cell Physiol Biochem. 2018;48(5):2061-2073. doi: 10.1159/000492544. Click
115 Synergistic Role of Thymoquinone on Anticancer Activity of 5-Fluorouracil in Triple Negative Breast Cancer Cells. Anticancer Agents Med Chem. 2022;22(6):1111-1118. doi: 10.2174/1871520621666210624111613. Click
116 Thymoquinone Augments Methotrexate-Induced Apoptosis on Osteosarcoma Cells. Drug Res (Stuttg). 2022 Apr;72(4):220-225. doi: 10.1055/a-1775-7908. Click
117 Thymoquinone Potentiates Methotrexate Mediated-Apoptosis in Saos-2 Osteosarcoma Cell Line. Drug Res (Stuttg). 2022 Sep;72(7):390-395. doi: 10.1055/a-1842-7545. Click
118 Antiproliferative and proapoptotic effects of topotecan in combination with thymoquinone on acute myelogenous leukemia. Clin Lymphoma Myeloma Leuk. 2014 Sep;14 Suppl:S46-55. doi: 10.1016/j.clml.2014.04.014. Erratum in: Clin Lymphoma Myeloma Leuk. 2015 Jun;15(6):384. Click
119 The effect of thymoquinone and propranolol combination on epidermoid laryngeal carcinoma cell. Eur Arch Otorhinolaryngol. 2023 Jun;280(6):2849-2858. doi: 10.1007/s00405-023-07825-0. Click
120 Indomethacin and juglone inhibit inflammatory molecules to induce apoptosis in colon cancer cells. J Biochem Mol Toxicol. 2020 Feb;34(2):e22433. doi: 10.1002/jbt.22433. Click
121 Combinatorial Cytotoxic Effects of Damnacanthal and Doxorubicin against Human Breast Cancer MCF-7 Cells in Vitro. Molecules. 2016 Sep 14;21(9):1228. doi: 10.3390/molecules21091228. Click
122 Chlorogenic Acid Improves the Regorafenib Effects in Human Hepatocellular Carcinoma Cells. Int J Mol Sci. 2018 May 19;19(5):1518. doi: 10.3390/ijms19051518. Click
123 Rosmarinic acid suppresses inflammation, angiogenesis, and improves paclitaxel induced apoptosis in a breast cancer model via NF3 κB-p53-caspase-3 pathways modulation. J Appl Biomed. 2021 Dec;19(4):202-209. doi: 10.32725/jab.2021.024. Click
124 Caffeic Acid Phenethyl Ester as a DHODH Inhibitor and Its Synergistic Anticancer Properties in Combination with 5-Fluorouracil in a Breast Cancer Cell Line. J Exp Pharmacol. 2022 Jul 23;14:243-253. doi: 10.2147/JEP.S365159. Click
125 Synergistic Anticancer Activity of Combined Use of Caffeic Acid with Paclitaxel Enhances Apoptosis of Non-Small-Cell Lung Cancer H1299 Cells in Vivo and in Vitro. Cell Physiol Biochem. 2018;48(4):1433-1442. doi: 10.1159/000492253. Click
126 Effect of combined treatment with lobaplatin and osthole on inducing apoptosis and inhibiting proliferation in human breast cancer MDA-MB-231 cells. Med Oncol. 2021 Nov 27;39(1):16. doi: 10.1007/s12032-021-01609-4. Click
127 Eugenol Exerts Apoptotic Effect and Modulates the Sensitivity of HeLa Cells to Cisplatin and Radiation. Molecules. 2019 Nov 3;24(21):3979. doi: 10.3390/molecules24213979. Click
128 Eugenol potentiates cisplatin anti-cancer activity through inhibition of ALDH-positive breast cancer stem cells and the NF-κB signaling pathway. Mol Carcinog. 2018 Mar;57(3):333-346. doi: 10.1002/mc.22758. Click
129 Combination of 2-methoxyestradiol (2-ME2) and eugenol for apoptosis induction synergistically in androgen independent prostate cancer cells. J Steroid Biochem Mol Biol. 2009 Jan;113(1-2):25-35. doi: 10.1016/j.jsbmb.2008.11.002. Click
130 Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway. Am J Transl Res. 2019 Jun 15;11(6):3816-3824. Click
131 Matairesinol Induces Mitochondrial Dysfunction and Exerts Synergistic Anticancer Effects with 5-Fluorouracil in Pancreatic Cancer Cells. Mar Drugs. 2022 Jul 25;20(8):473. doi: 10.3390/md20080473. Click
132 β-Sitosterol and Gemcitabine Exhibit Synergistic Anti-Pancreatic Cancer Activity by Modulating Apoptosis and Inhibiting Epithelial-Mesenchymal Transition by Deactivating Akt/GSK-3β Signaling. Front Pharmacol. 2020 Nov 20;11:565535. doi: 10.3389/fphar.2020.565535. Click
133 Combination Treatment of Sorafenib and Bufalin Induces Apoptosis in NCI-H292 Human Lung Cancer Cells In Vitro. In Vivo. 2022 Mar-Apr;36(2):582-595. doi: 10.21873/invivo.12741. Click
134 Bufalin and 5-fluorouracil synergistically induce apoptosis in colorectal cancer cells. Oncol Lett. 2018 May;15(5):8019-8026. doi: 10.3892/ol.2018.8332. Click
135 Effects of low-dose bufalin combined with hydroxycamptothecin on human castration-resistant prostate cancer xenografts in nude mice. Exp Ther Med. 2021 Sep;22(3):1015. doi: 10.3892/etm.2021.10447. Click
136 Combination of Cinobufacini and Doxorubicin Increases Apoptosis of Hepatocellular Carcinoma Cells through the Fas- and Mitochondria-Mediated Pathways. Am J Chin Med. 2017;45(7):1537-1556. doi: 10.1142/S0192415X17500835. Click
137 OSW-1 induces apoptosis and cyto-protective autophagy, and synergizes with chemotherapy on triple negative breast cancer metastasis. Cell Oncol (Dordr). 2022 Dec;45(6):1255-1275. doi: 10.1007/s13402-022-00716-2. Click
138 Oleandrin synergizes with cisplatin in human osteosarcoma cells by enhancing cell apoptosis through activation of the p38 MAPK signaling pathway. Cancer Chemother Pharmacol. 2018 Dec;82(6):1009-1020. doi: 10.1007/s00280-018-3692-7. Click
139 Piceatannol enhances Beclin-1 activity to suppress tumor progression and its combination therapy strategy with everolimus in gastric cancer. Sci China Life Sci. 2023 Feb;66(2):298-312. doi: 10.1007/s11427-022-2185-9. Click
140 Pterostilbine, an active component of blueberries, sensitizes colon cancer cells to 5-fluorouracil cytotoxicity. Sci Rep. 2015 Oct 16;5:15239. doi: 10.1038/srep15239. Click
141 Combination of ABT-737 and resveratrol enhances DNA damage and apoptosis in human T-cell acute lymphoblastic leukemia MOLT-4 cells. Toxicol In Vitro. 2017 Aug;42:38-46. doi: 10.1016/j.tiv.2017.03.013. Click
142 Synergistic inhibitory effects of the oxyresveratrol and dacarbazine combination against melanoma cells. Oncol Lett. 2021 Sep;22(3):667. doi: 10.3892/ol.2021.12928. Click
143 Resveratrol synergizes with cisplatin in antineoplastic effects against AGS gastric cancer cells by inducing endoplasmic reticulum stress‑mediated apoptosis and G2/M phase arrest. Oncol Rep. 2020 Oct;44(4):1605-1615. doi: 10.3892/or.2020.7708. Click
144 Resveratrol potentiates the anti-tumor effects of rapamycin in papillary thyroid cancer: PI3K/AKT/mTOR pathway involved. Arch Biochem Biophys. 2020 Aug 15;689:108461. doi: 10.1016/j.abb.2020.108461. Click
145 Olaparib enhances the Resveratrol-mediated apoptosis in breast cancer cells by inhibiting the homologous recombination repair pathway. Exp Cell Res. 2022 Nov 1;420(1):113338. doi: 10.1016/j.yexcr.2022.113338. Click
146 Synergistic anti-tumour activity of sorafenib in combination with pegylated resveratrol is mediated by Akt/mTOR/p70S6k-4EBP-1 and c-Raf7MEK/ERK signaling pathways. Heliyon. 2023 Aug 19;9(8):e19154. doi: 10.1016/j.heliyon.2023.e19154. Click
147 Anti-proliferation effects of Apatinib in combination with Curcumin in breast cancer cells. Horm Mol Biol Clin Investig. 2022 Sep 5;44(1):27-32. doi: 10.1515/hmbci-2022-0036. Click
148 Combination effect of curcumin with docetaxel on the PI3K/AKT/mTOR pathway to induce autophagy and apoptosis in esophageal squamous cell carcinoma. Am J Transl Res. 2021 Jan 15;13(1):57-72. Click
149 Human prostate cancer cell epithelial-to-mesenchymal transition as a novel target of arsenic trioxide and curcumin therapeutic approach. Tissue Cell. 2022 Jun;76:101805. doi: 10.1016/j.tice.2022.101805. Click
150 Curcumin combined with arsenic trioxide in the treatment of acute myeloid leukemia: network pharmacology analysis and experimental validation. J Cancer Res Clin Oncol. 2023 Jan;149(1):219-230. doi: 10.1007/s00432-022-04463-7. Click
151 Curcumin Enhances the Anticancer Effects of Binimetinib on Melanoma Cells by Inducing Mitochondrial Dysfunction and Cell Apoptosis with Necroptosis. Ann Dermatol. 2023 Jun;35(3):217-228. doi: 10.5021/ad.22.200. Click
152 Synergistic anti-proliferative and apoptotic effect of NVP-BEZ235 and curcumin on human SH-SY5Y neuroblastoma cells. Med Oncol. 2023 Dec 10;41(1):11. doi: 10.1007/s12032-023-02239-8. Click
153 Curcumin sensitizes human lung cancer cells to apoptosis and metastasis synergistically combined with carboplatin. Exp Biol Med (Maywood). 2015 Nov;240(11):1416-25. doi: 10.1177/1535370215571881. Click
154 Synergistic anticancer activity of capsaicin and 3,3'-diindolylmethane in human colorectal cancer. J Agric Food Chem. 2015 May 6;63(17):4297-304. doi: 10.1021/jf506098s. Click
155 Capsaicin and sorafenib combination treatment exerts synergistic anti‑hepatocellular carcinoma activity by suppressing EGFR and PI3K/Akt/mTOR signaling. Oncol Rep. 2018 Dec;40(6):3235-3248. doi: 10.3892/or.2018.6754. Click
156 Luteolin combined with low-dose paclitaxel synergistically inhibits epithelial-mesenchymal transition and induces cell apoptosis on esophageal carcinoma in vitro and in vivo. Phytother Res. 2021 Nov;35(11):6228-6240. doi: 10.1002/ptr.7267. Click
157 Anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cell line. Mol Cell Biochem. 2008 Jun;313(1-2):125-32. doi: 10.1007/s11010-008-9749-x. Click
158 Synergistic effect between celecoxib and luteolin is dependent on estrogen receptor in human breast cancer cells. Tumour Biol. 2015 Aug;36(8):6349-59. doi: 10.1007/s13277-015-3322-5. Click
159 Luteolin and Gemcitabine Protect Against Pancreatic Cancer in an Orthotopic Mouse Model. Pancreas. 2015 Jan;44(1):144-51. doi: 10.1097/MPA.0000000000000215. Click
160 Icariin-mediated inhibition of NF-κB activity enhances the in vitro and in vivo antitumour effect of 5-fluorouracil in colorectal cancer. Cell Biochem Biophys. 2014 Jul;69(3):523-30. doi: 10.1007/s12013-014-9827-5. Click
161 Targeting Lactate Dehydrogenase A with Catechin Resensitizes SNU620/5FU Gastric Cancer Cells to 5-Fluorouracil. Int J Mol Sci. 2021 May 20;22(10):5406. doi: 10.3390/ijms22105406. Click
162 Synergistic anticancer effect of acteoside and temozolomide-based glioblastoma chemotherapy. Int J Mol Med. 2019 Mar;43(3):1478-1486. doi: 10.3892/ijmm.2019.4061. Click
163 Glabridin plays dual action to intensify anti-metastatic potential of paclitaxel via impeding CYP2C8 in liver and CYP2J2/EETs in tumor of an orthotopic mouse model of breast cancer. Chem Biol Interact. 2023 Sep 1;382:110605. doi: 10.1016/j.cbi.2023.110605. Click
164 Hypericin-mediated photodynamic therapy enhances gemcitabine induced Capan-2 cell apoptosis via inhibiting NADPH level. J Pharm Pharmacol. 2022 Apr 20;74(4):596-604. doi: 10.1093/jpp/rgab073. Click
165 The inhibitory effect of 6-gingerol and cisplatin on ovarian cancer and antitumor activity: In silico, in vitro, and in vivo. Front Oncol. 2023 Mar 3;13:1098429. doi: 10.3389/fonc.2023.1098429. Click
166 Anticancer Efficacy of 6-Gingerol with Paclitaxel against Wild Type of Human Breast Adenocarcinoma. Molecules. 2022 Apr 22;27(9):2693. doi: 10.3390/molecules27092693. Click
167 α-Mangostin suppresses the de novo lipogenesis and enhances the chemotherapeutic response to gemcitabine in gallbladder carcinoma cells via targeting the AMPK/SREBP1 cascades. J Cell Mol Med. 2020 Jan;24(1):760-771. doi: 10.1111/jcmm.14785. Click
168 Synergistic effect of paeonol and cisplatin on oesophageal cancer cell lines. Dig Liver Dis. 2008 Jul;40(7):531-9. doi: 10.1016/j.dld.2008.01.012. Click
169 Diosmin in combination with naringenin enhances apoptosis in colon cancer cells. Oncol Rep. 2022 Jan;47(1):4. doi: 10.3892/or.2021.8215. Click
170 Synergistic effect of black tea polyphenol, theaflavin-3,3'-digallate with cisplatin against cisplatin resistant human ovarian cancer cells. J Funct Foods. 2018 Jul;46:1-11. doi: 10.1016/j.jff.2018.04.037. Click
171 6-Shogaol enhances the anticancer effect of 5-fluorouracil, oxaliplatin, and irinotecan via increase of apoptosis and autophagy in colon cancer cells in hypoxic/aglycemic conditions. BMC Complement Med Ther. 2020 May 11;20(1):141. doi: 10.1186/s12906-020-02913-8. Click
172 The ponatinib/gossypol novel combination provides enhanced anticancer activity against murine solid Ehrlich carcinoma via triggering apoptosis and inhibiting proliferation/angiogenesis. Toxicol Appl Pharmacol. 2021 Dec 1;432:115767. doi: 10.1016/j.taap.2021.115767. Click
173 Targeting apoptosis in the hormone- and drug-resistant prostate cancer cell line, DU-145, by gossypol/zoledronic acid combination. Cell Biol Int. 2009 Nov;33(11):1165-72. doi: 10.1016/j.cellbi.2009.08.006. Click
174 Combination of L-gossypol and low-concentration doxorubicin induces apoptosis in human synovial sarcoma cells. Mol Med Rep. 2015 Oct;12(4):5924-32. doi: 10.3892/mmr.2015.4127. Click
175 Synergistic effects of green tea extract and paclitaxel in the induction of mitochondrial apoptosis in ovarian cancer cell lines. Gene. 2021 Jun 30;787:145638. doi: 10.1016/j.gene.2021.145638. Click
176 Oxidized tea polyphenol (OTP-3) targets EGFR synergistic nimotuzumab at inhibition of non-small cell lung tumor growth. Bioorg Chem. 2022 Nov;128:106084. doi: 10.1016/j.bioorg.2022.106084. Click
177 10-Gingerol Enhances the Effect of Taxol in Triple-Negative Breast Cancer via Targeting ADRB2 Signaling. Drug Des Devel Ther. 2023 Jan 20;17:129-142. doi: 10.2147/DDDT.S390602. Click
178 Gambogenic Acid Inhibits Basal Autophagy of Drug-Resistant Hepatoma Cells and Improves Its Sensitivity to Adriamycin. Biol Pharm Bull. 2022;45(1):63-70. doi: 10.1248/bpb.b21-00511. Click
179 Synergistic effects of 5-fluorouracil and gambogenic acid on A549 cells: activation of cell death caused by apoptotic and necroptotic mechanisms via the ROS-mitochondria pathway. Biol Pharm Bull. 2014;37(8):1259-68. doi: 10.1248/bpb.b13-00972. Click
180 Gambogic acid sensitizes gemcitabine efficacy in pancreatic cancer by reducing the expression of ribonucleotide reductase subunit-M2 (RRM2). J Exp Clin Cancer Res. 2017 Aug 10;36(1):107. doi: 10.1186/s13046-017-0579-0. Click
181 Targeting Nrf2 with wogonin overcomes cisplatin resistance in head and neck cancer. Apoptosis. 2016;21(11):1265-1278. doi:10.1007/s10495-016-1284-8 Click
182 Gambogic acid increases the sensitivity to paclitaxel in drug‑resistant triple‑negative breast cancer via the SHH signaling pathway. Mol Med Rep. 2019 Nov;20(5):4515-4522. doi: 10.3892/mmr.2019.10697. Click
183 Gambogic acid synergistically potentiates cisplatin-induced apoptosis in non-small-cell lung cancer through suppressing NF-κB and MAPK/HO-1 signalling. Br J Cancer. 2014 Jan 21;110(2):341-52. doi: 10.1038/bjc.2013.752. Click
184 Suppression of NF-κB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103. doi: 10.2174/1568009613666131113100634. Click
185 Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. Click
186 Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. Click
187 Synergistic Effects of Taurine and Temozolomide Via Cell Proliferation Inhibition and Apoptotic Induction on U-251 MG Human Glioblastoma Cells. Asian Pac J Cancer Prev. 2021 Dec 1;22(12):4001-4009. doi: 10.31557/APJCP.2021.22.12.4001. Click
188 Tannic acid synergistically enhances the anticancer efficacy of cisplatin on liver cancer cells through mitochondria‑mediated apoptosis. Oncol Rep. 2019 Nov;42(5):2108-2116. doi: 10.3892/or.2019.7281. Click
189 Co-Treatment with Sulforaphane and Nano-Metformin Molecules Accelerates Apoptosis in HER2+ Breast Cancer Cells by Inhibiting Key Molecules. Nutr Cancer. 2020;72(5):835-848. doi: 10.1080/01635581.2019.1655073. Click
190 Autophagic cell death and premature senescence: New mechanism of 5-fluorouracil and sulforaphane synergistic anticancer effect in MDA-MB-231 triple negative breast cancer cell line. Food Chem Toxicol. 2018 Jan;111:1-8. doi: 10.1016/j.fct.2017.10.056. Click
191 Pro-oxidant activity of sulforaphane and cisplatin potentiates apoptosis and simultaneously promotes autophagy in malignant mesothelioma cells. Mol Med Rep. 2017 Aug;16(2):2133-2141. doi: 10.3892/mmr.2017.6789. Click
192 mTOR inhibitor PP242 increases antitumor activity of sulforaphane by blocking Akt/mTOR pathway in esophageal squamous cell carcinoma. Mol Biol Rep. 2022 Jan;49(1):451-461. doi: 10.1007/s11033-021-06895-9. Click
193 Sulforaphane Potentiates Gemcitabine-Mediated Anti-Cancer Effects against Intrahepatic Cholangiocarcinoma by Inhibiting HDAC Activity. Cells. 2023 Feb 22;12(5):687. doi: 10.3390/cells12050687. Click
194 Sulforaphane enhances the therapeutic potential of TRAIL in prostate cancer orthotopic model through regulation of apoptosis, metastasis, and angiogenesis. Clin Cancer Res. 2008 Nov 1;14(21):6855-66. doi: 10.1158/1078-0432.CCR-08-0903. Click
195 Lycopene sensitizes the cervical cancer cells to cisplatin via targeting nuclear factor- kappa B (NF-κB) pathway. Turk J Med Sci. 2021 Feb 26;51(1):368-374. doi: 10.3906/sag-2005-413. Click
196 Concomitant supplementation of lycopene and eicosapentaenoic acid inhibits the proliferation of human colon cancer cells. J Nutr Biochem. 2009 Jun;20(6):426-34. doi: 10.1016/j.jnutbio.2008.05.001. Click
197 Fucoxanthin and Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand (TRAIL) Synergistically Promotes Apoptosis of Human Cervical Cancer Cells by Targeting PI3K/Akt/NF-κB Signaling Pathway. Med Sci Monit. 2018 Jan 1;24:11-18. doi: 10.12659/msm.905360. Click
198 Hederagenin Induces Apoptosis in Cisplatin-Resistant Head and Neck Cancer Cells by Inhibiting the Nrf2-ARE Antioxidant Pathway. Oxid Med Cell Longev. 2017;2017:5498908. doi:10.1155/2017/5498908 Click
199 Combination treatment of ligustrazine piperazine derivate DLJ14 and adriamycin inhibits progression of resistant breast cancer through inhibition of the EGFR/PI3K/Akt survival pathway and induction of apoptosis. Drug Discov Ther. 2014 Feb;8(1):33-41. doi: 10.5582/ddt.8.33. Click
200 Zerumbone Sensitizes the Anti-Cancer Efficacy of Cisplatin in Hepatocellular Carcinoma Cells. Anticancer Agents Med Chem. 2022 Aug 4;22(16):2885-2895. doi: 10.2174/1871520622666220324090801. Click
201 Zerumbone-induced reactive oxygen species-mediated oxidative stress re-sensitizes breast cancer cells to paclitaxel. Biotechnol Appl Biochem. 2023 Feb;70(1):28-37. doi: 10.1002/bab.2326. Click
202 Zerumbone combined with gefitinib alleviates lung cancer cell growth through the AKT/STAT3/SLC7A11 axis. Neoplasma. 2023 Feb;70(1):58-70. doi: 10.4149/neo_2022_220418N423. Click
203 Baicalin Enhances Chemosensitivity to Doxorubicin in Breast Cancer Cells via Upregulation of Oxidative Stress-Mediated Mitochondria-Dependent Apoptosis. Antioxidants (Basel). 2021;10(10):1506. Published 2021 Sep 23. doi:10.3390/antiox10101506 Click
204 Sulforaphene-Carboplatin Combination Synergistically Enhances Apoptosis by Disruption of Mitochondrial Membrane Potential and Cell Cycle Arrest in Human Non-Small Cell Lung Carcinoma. J Med Food. 2016 Sep;19(9):860-9. doi: 10.1089/jmf.2016.3675. Click
205 Evaluation of synergistic effects of sulforaphene with photodynamic therapy in human cervical cancer cell line. Lasers Med Sci. 2016 Nov;31(8):1675-1682. doi: 10.1007/s10103-016-2037-1. Click
206 Falcarindiol Enhances Cisplatin Chemosensitivity of Hepatocellular Carcinoma via Down-Regulating the STAT3-Modulated PTTG1 Pathway. Front Pharmacol. 2021 May 7;12:656697. doi: 10.3389/fphar.2021.656697. Click
207 Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway. Phytother Res. 2021 Oct;35(10):5899-5918. doi: 10.1002/ptr.7299 Click
208 Dehydrobruceine B enhances the cisplatin-induced cytotoxicity through regulation of the mitochondrial apoptotic pathway in lung cancer A549 cells. Biomed Pharmacother. 2017 May;89:623-631. doi: 10.1016/j.biopha.2017.02.055. Click
209 Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway. Phytomedicine. 2021 Jun;86:153563. doi: 10.1016/j.phymed.2021.153563. Click
210 δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis. Cell Prolif. 2021 Nov;54(11):e13111. doi: 10.1111/cpr.13111. Click
211 Gallic acid has anticancer activity and enhances the anticancer effects of cisplatin in non‑small cell lung cancer A549 cells via the JAK/STAT3 signaling pathway. Oncol Rep. 2019 Mar;41(3):1779-1788. doi: 10.3892/or.2019.6976. Click
212 Cordycepin augments the chemosensitivity of osteosarcoma to cisplatin by activating AMPK and suppressing the AKT signaling pathway. Cancer Cell Int. 2021 Dec 25;21(1):706. doi: 10.1186/s12935-021-02411-y. Click
213 Combination of Cordycepin and Apatinib Synergistically Inhibits NSCLC Cells by Down-Regulating VEGF/PI3K/Akt Signaling Pathway. Front Oncol. 2020 Sep 7;10:1732. doi: 10.3389/fonc.2020.01732. Click
214 Antitumor effects of erlotinib in combination with berberine in A431 cells. BMC Pharmacol Toxicol. 2023 May 11;24(1):29. doi: 10.1186/s40360-023-00661-2. Click
215 Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway. Molecules. 2021 Mar 17;26(6):1666. doi: 10.3390/molecules26061666. Click
216 Enhanced antitumor effect of combination therapy with gemcitabine and guggulsterone in pancreatic cancer. Pancreas. 2012 Oct;41(7):1048-57. doi: 10.1097/MPA.0b013e318249d62e. Click
217 Evening Primrose Oil Enhances Tamoxifen's Anticancer Activity against Breast Cancer Cells by Inducing Apoptosis, Inhibiting Angiogenesis, and Arresting the Cell Cycle. Molecules. 2022 Apr 7;27(8):2391. doi: 10.3390/molecules27082391 Click
218 Synergistic Anticancer Effect of Paclitaxel and Noscapine on Human Prostate Cancer Cell Lines. Iran J Pharm Res. 2017 Fall;16(4):1432-1442. Click
219 Anticancer activity of Noscapine, an opioid alkaloid in combination with Cisplatin in human non-small cell lung cancer. Lung Cancer. 2011 Mar;71(3):271-82. doi: 10.1016/j.lungcan.2010.06.002. Click
220 Antitumor activity of Noscapine in combination with Doxorubicin in triple negative breast cancer. PLoS One. 2011 Mar 15;6(3):e17733. doi: 10.1371/journal.pone.0017733. Click
221 Enhanced anticancer activity of gemcitabine in combination with noscapine via antiangiogenic and apoptotic pathway against non-small cell lung cancer. PLoS One. 2011;6(11):e27394. doi: 10.1371/journal.pone.0027394. Click
222 Platycodin D induces apoptotic cell death through PI3K/AKT and MAPK/ERK pathways and synergizes with venetoclax in acute myeloid leukemia. Eur J Pharmacol. 2023 Oct 5;956:175957. doi: 10.1016/j.ejphar.2023.175957. Click
223 Plumbagin enhances TRAIL-induced apoptosis of human leukemic Kasumi‑1 cells through upregulation of TRAIL death receptor expression, activation of caspase-8 and inhibition of cFLIP. Oncol Rep. 2017;37(6):3423-3432. doi:10.3892/or.2017.5627 Click
224 Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals. Oncotarget. 2017 Nov 27;8(67):111144-111160. doi: 10.18632/oncotarget.22676. Click
225 Quercetin reverses docetaxel resistance in prostate cancer via androgen receptor and PI3K/Akt signaling pathways. Int J Biol Sci. 2020 Feb 10;16(7):1121-1134. doi: 10.7150/ijbs.41686. Click
226 Targeting Tyrosine Kinase Inhibitor-Resistant Non-Small Cell Lung Cancer by Inducing Epidermal Growth Factor Receptor Degradation via Methionine 790 Oxidation. Antioxid Redox Signal. 2016;24(5):263-279. doi:10.1089/ars.2015.6420 Click
227 Potentiating activities of chrysin in the therapeutic efficacy of 5-fluorouracil in gastric cancer cells. Oncol Lett. 2021 Jan;21(1):24. doi: 10.3892/ol.2020.12285. Click
228 Inhibition of NF-κB results in anti-glioma activity and reduces temozolomide-induced chemoresistance by down-regulating MGMT gene expression. Cancer Lett. 2018 Aug 1;428:77-89. doi: 10.1016/j.canlet.2018.04.033. Click
229 Demethoxycurcumin increases the sensitivity of cisplatin-resistant non-small lung cancer cells to cisplatin and induces apoptosis by activating the caspase signaling pathway. Oncol Lett. 2020 Nov;20(5):209. doi: 10.3892/ol.2020.12072. Click
230 Shogaol overcomes TRAIL resistance in colon cancer cells via inhibiting of survivin. Tumour Biol. 2015 Nov;36(11):8819-29. doi: 10.1007/s13277-015-3629-2. Click
231 Combined therapy with EGFR TKI and gambogic acid for overcoming resistance in EGFR-T790M mutant lung cancer. Oncol Lett. 2015 Oct;10(4):2063-2066. doi: 10.3892/ol.2015.3599. Click
232 Ligustrazine-Derived Chalcones-Modified Platinum(IV) Complexes Intervene in Cisplatin Resistance in Pancreatic Cancer through Ferroptosis and Apoptosis. J Med Chem. 2023 Oct 12;66(19):13587-13606. doi: 10.1021/acs.jmedchem.3c00922. Click
233 Cordycepin Reverses Cisplatin Resistance in Non-small Cell Lung Cancer by Activating AMPK and Inhibiting AKT Signaling Pathway. Front Cell Dev Biol. 2021 Jan 15;8:609285. doi: 10.3389/fcell.2020.609285. Click
234 Shikonin inhibits gefitinib-resistant non-small cell lung cancer by inhibiting TrxR and activating the EGFR proteasomal degradation pathway. Pharmacol Res. 2017;115:45-55. doi:10.1016/j.phrs.2016.11.011 Click
It has been 705682 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP