TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name G1/S-specific cyclin-D1
UniProt ID CCND1_HUMAN
Gene Name CCND1
Gene ID 595
Synonyms
CCND1, BCL1, D11S287E, PRAD1, U21B31
Sequence
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
Pathway Map MAP LINK
T.C. Number 1.I.1.1.3
KEGG ID hsa595
TTD ID T12355
Pfam PF00134; PF02984
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 75
Pair Name Baicalein, Docetaxel
Phytochemical Name Baicalein
Anticancer drug Name Docetaxel
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Baicalein enhances the antitumor efficacy of docetaxel on nonsmall cell lung cancer in a β-catenin-dependent manner
Combination Pair ID: 464
Pair Name Biochanin A, SB590885
Phytochemical Name Biochanin A
Anticancer drug Name SB590885
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The results identify an effective combination therapy for the most aggressive form of HCC and provide the possibility of therapeutic improvement for patients with advanced HCC.
Combination Pair ID: 429
Pair Name Carvacrol, Sorafenib
Phytochemical Name Carvacrol
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC.
Combination Pair ID: 714
Pair Name Crocin, Fluorouracil
Phytochemical Name Crocin
Anticancer drug Name Fluorouracil
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result We demonstrated an antitumor activity of crocin in CRC and its potential role in improvement of inflammation with mucosal ulcers and high-grade dysplastic crypts, supporting the desireability of further investigations on the therapeutic potential of this approach in CRC.
Combination Pair ID: 272
Pair Name Deoxyelephantopin, Cisplatin
Phytochemical Name Deoxyelephantopin
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The CP and DET combination may be an effective intervention for melanoma with reduced side effects.
Combination Pair ID: 126
Pair Name Epigallocatechin gallate, Irinotecan
Phytochemical Name Epigallocatechin gallate
Anticancer drug Name Irinotecan
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result EGCG synergizes the therapeutic effect of irinotecan through enhanced DNA damage in human colorectal cancer cells
Combination Pair ID: 90
Pair Name Kuromanin chloride, Cisplatin
Phytochemical Name Kuromanin chloride
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells
Combination Pair ID: 114
Pair Name Narirutin, Cisplatin
Phytochemical Name Narirutin
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Based on the significant anticancer effect and high biosafety, naringin has great potential as a functional food in the adjuvant treatment of lung cancer.
Combination Pair ID: 503
Pair Name Usnic acid, Bleomycin
Phytochemical Name Usnic acid
Anticancer drug Name Bleomycin
Disease Info [ICD-11: 2F94] Ascitic tumor Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 432
Pair Name [6]-Gingerol, Cisplatin
Phytochemical [6]-Gingerol
Drug Cisplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result [6]-Gingerol enhances the cisplatin sensitivity of gastric cancer cells through inhibition of proliferation and invasion via PI3K/AKT signaling pathway
Combination Pair ID: 518
Pair Name All-trans retinoic acid, Salinomycin
Phytochemical All-trans-retinoic acid
Drug Salinomycin
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result S+RA induced differentiation by β-catenin-inhibition-mediated up-regulation of C/EBPs and PU.1 and suppression of c-Myc. S+RA triggered apoptosis through β-catenin-inhibition-regulated ΔΨm collapse and caspase-3/7 activation. Taken together, our findings may provide novel therapeutic strategies for AML patients by targeting the WNT/β-catenin pathway.
Combination Pair ID: 254
Pair Name Alpha-Hederin, Carboplatin
Phytochemical Alpha-Hederin
Drug Carboplatin
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Chemopreventive effect of α-hederin/carboplatin combination against experimental colon hyperplasia and impact on JNK signaling
Combination Pair ID: 863
Pair Name Alpha-Mangostin, Tamoxifen
Phytochemical Alpha-Mangostin
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result This study establishes the benefits of incorporating AM as a co-adjuvant for first-line ER+ breast cancer therapy.
Combination Pair ID: 72
Pair Name Baicalin, Fluorouracil
Phytochemical Baicalin
Drug Fluorouracil
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result These results indicate that HQ and its component baicalin enhance the effect of 5-fluorouracil-based chemotherapy via inhibition of CDK-RB pathway. These findings may provide the rational basis for developing agents that can overcome the development of cellular drug resistance. Video Abstract.
Combination Pair ID: 31
Pair Name Berbamine, Arcyriaflavin A
Phytochemical Berbamine
Drug Arcyriaflavin A
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells.
Combination Pair ID: 28
Pair Name Berbamine, Aspirin
Phytochemical Berbamine
Drug Aspirin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result These data demonstrate that the regulation of cAMP-PKA-CREB/ATF1 signaling represents a noncanonical function of CPS1. Targeting the PKA-CREB/ATF1 axis may be a strategy to improve the therapeutic effects of aspirin on HCC.
Combination Pair ID: 29
Pair Name Berbamine, Sorafenib
Phytochemical Berbamine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result These findings identify a new type of natural STAT3 inhibitor and provide a novel approach to the enhancement of SORA efficacy by blocking the activation of STAT3.
Combination Pair ID: 30
Pair Name Berbamine, Sorafenib
Phytochemical Berbamine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Targeting Na+/K+-ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma
Combination Pair ID: 602
Pair Name Berberine, Cisplatin
Phytochemical Berberine
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway
Combination Pair ID: 601
Pair Name Berberine, Erlotinib
Phytochemical Berberine
Drug Erlotinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our data supported use of BBR in combination with erlotinib as a novel strategy for treatment of patients with EGFR positive tumors.
Combination Pair ID: 332
Pair Name Bergamottin, Simvastatin
Phytochemical Bergamottin
Drug Simvastatin
Disease Info [ICD-11: 2A20.1] Chronic myelogenous leukemia Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Discussion and conclusion Our results provide novel insight into the role of SV and BGM in potentially preventing and treating cancer through modulation of NF-κB signalling pathway and its regulated gene products.
Combination Pair ID: 712
Pair Name Beta-Elemene, Etoposide
Phytochemical Beta-Elemene
Drug Etoposide
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result These results suggest that the combination of β-elemene and VP-16 may be a promising therapeutic option for lung cancer.
Combination Pair ID: 679
Pair Name Betulinic Acid, Sorafenib
Phytochemical Betulinic Acid
Drug Sorafenib
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result We showed that combined treatment with low concentrations of sorafenib and betulinic acid had the capacity to inhibit proliferation and abolish clonogenic activity in PDAC cell lines.
Combination Pair ID: 463
Pair Name Biochanin A, Fluorouracil
Phytochemical Biochanin A
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The synergistic antitumor effect of Bio-A/ 5-FU combination can be, at least partly, attributed to Bio-A-mediated suppression of ER-α/Akt axis and the augmentation of 5-FU-mediated proapoptotic effects.
Combination Pair ID: 112
Pair Name Butein, Cisplatin
Phytochemical Butein
Drug Cisplatin
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a
Combination Pair ID: 112
Pair Name Butein, Cisplatin
Phytochemical Butein
Drug Cisplatin
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a
Combination Pair ID: 103
Pair Name Chrysin, Metformin
Phytochemical Chrysin
Drug Metformin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The conmbination of metformin and chrysin suppressing hTERT and cyclin D1 gene expression might offer an appropriate approach for breast cancer therapy.
Combination Pair ID: 53
Pair Name Daurinoline, Sorafenib
Phytochemical Daurinoline
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our study provides insights into the molecular mechanisms underlying DS-induced inhibition of VM, which may facilitate the development of a novel clinical anti-HCC drug. Moreover, our findings suggest that the combination of DS and sorafenib constitutes a potential therapeutic strategy for HCC.
Combination Pair ID: 335
Pair Name Decursin, Doxorubicin
Phytochemical Decursin
Drug Doxorubicin
Disease Info [ICD-11: 2A83] Multiple myeloma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The combination treatment of decursin and doxorubicin can enhance apoptotic activity via mTOR and/or STAT3 signaling pathway in multiple myeloma cells.
Combination Pair ID: 590
Pair Name Delta-Tocotrienol, Cisplatin
Phytochemical Delta-Tocotrienol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis
Combination Pair ID: 47
Pair Name Dihydroberberine, Sunitinib
Phytochemical Dihydroberberine
Drug Sunitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation G1/S-specific cyclin-D1 Expression
Result DCS induced the expression of cell cycle signal molecules that are known to be affected by JNK and p38. The change of cell cycle, in turn, led to down-regulation of JNK and p38, and further reduced IL-1 secretion. Collectively, these findings highlight potential molecular mechanisms of DCS chemotherapeutic activity and suggest that DCS is an efficacious strategy in NSCLC therapy.
Combination Pair ID: 122
Pair Name Epigallocatechin gallate, Metformin
Phytochemical Epigallocatechin gallate
Drug Metformin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Anti-proliferative and anti-apoptotic potential effects of epigallocatechin-3-gallate and/or metformin on hepatocellular carcinoma cells: in vitro study
Combination Pair ID: 604
Pair Name Evening primrose oil, Tamoxifen
Phytochemical Evening primrose oil
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The most significant finding of this study was the confirmation of the anticancer activity of the natural product EPO, which potentiated the activity of the anticancer drug TAM against MCF-7 and MDA-MB-231 BC cell lines through the induction of apoptosis, inhibiting angiogenesis and halting cell proliferation.
Combination Pair ID: 926
Pair Name Gamma-Tocotrienol, Capecitabine
Phytochemical Gamma-Tocotrienol
Drug Capecitabine
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our results show that γ-tocotrienol can potentiate the effects of capecitabine through suppression of NF-κB-regulated markers of proliferation, invasion, angiogenesis, and metastasis.
Combination Pair ID: 929
Pair Name Gamma-Tocotrienol, Capecitabine
Phytochemical Gamma-Tocotrienol
Drug Capecitabine
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our findings suggest that γ-T3 inhibited the growth of human CRC and sensitised CRC to capecitabine by regulating proteins linked to tumourigenesis.
Combination Pair ID: 928
Pair Name Gamma-Tocotrienol, Gemcitabine
Phytochemical Gamma-Tocotrienol
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our findings suggest that γ-T3 can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing NF-κB-mediated inflammatory pathways linked to tumorigenesis.
Combination Pair ID: 583
Pair Name Ginger extract, Doxorubicin
Phytochemical Ginger extract
Drug Doxorubicin
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result AMPK pathway and cyclin D1 gene expression could be a molecular therapeutic target for the anticancer effect of GE in mice bearing SEC. Combining GE and DOX revealed a greater efficacy as anticancer therapeutic regimen.
Combination Pair ID: 467
Pair Name Gossypol, Fluorouracil
Phytochemical Gossypol
Drug Fluorouracil
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result These findings suggest that gossypol-mediated down-regulation of TS, cyclin D1, and the mTOR/p70S6K1 signaling pathways enhances the anti-tumor effect of 5-FU. Ultimately, our data exposed a new action for gossypol as an enhancer of 5-FU-induced cell growth suppression.
Combination Pair ID: 13
Pair Name Halofuginone, Cisplatin
Phytochemical Halofuginone
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Halofuginone Sensitizes Lung Cancer Organoids to Cisplatin via Suppressing PI3K/AKT and MAPK Signaling Pathways
Combination Pair ID: 646
Pair Name Hesperetin, Cisplatin
Phytochemical Hesperetin
Drug Cisplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Hesperetin could inhibit the phosphatidylinositol-4,5-bisphosphate 3-kinase (PI3K)/AKT signaling pathway and induce the mitochondrial pathway via upregulating PTEN expression, thereby significantly enhancing DDP's anti-tumor effect on GC
Combination Pair ID: 766
Pair Name Honokiol, Rosiglitazone
Phytochemical Honokiol
Drug Rosiglitazone
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Honokiol combined with rosiglitazone showed more effective growth inhibition in hepatoma cells mediated through the regulation of G0/G1 phase-related proteins p21, cyclin D1, cyclin E1, and Rb and cell cycle progression
Combination Pair ID: 415
Pair Name Icariin, Fluorouracil
Phytochemical Icariin
Drug Fluorouracil
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result We suggest that combination of icariin with 5-FU might offer a therapeutic benefit to the patients with CRC; however, further studies are required to ascertain this proposition.
Combination Pair ID: 48
Pair Name Jervine, Decitabine
Phytochemical Jervine
Drug Decitabine
Disease Info [ICD-11: 2A3Z] Myelodysplastic syndrome Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The Smo inhibitor jervine and its combination with decitabine have a synergistic effect on the proliferation, cell cycle, and apoptosis of MUTZ-1 cells, and its mechanism may be achieved by interfering with the Shh signaling pathway.
Combination Pair ID: 129
Pair Name Licochalcone B, TNF-related apoptosis inducing ligand
Phytochemical Licochalcone B
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC.
Combination Pair ID: 25
Pair Name Lycorine hydrochloride, Anti-CTLA-4
Phytochemical Lycorine hydrochloride
Drug Anti-CTLA-4
Disease Info [ICD-11: 2C90.0] Renal cell carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Synergistic effects of the immune checkpoint inhibitor CTLA-4 combined with the growth inhibitor lycorine in a mouse model of renal cell carcinoma
Combination Pair ID: 342
Pair Name Magnolin, B-RAF Inhibitors
Phytochemical Magnolin
Drug B-RAF Inhibitors
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway
Combination Pair ID: 222
Pair Name Maslinic acid, Gemcitabine
Phytochemical Maslinic acid
Drug Gemcitabine
Disease Info [ICD-11: 2C94] Bladder cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The results suggest that MA potentiates the antitumor effects of GEM in human GBC cell lines by suppressing the activation of NF-κB and its dowstream gene products, which are involved in survival signaling.
Combination Pair ID: 896
Pair Name Methylselenocysteine, Tamoxifen
Phytochemical Methylselenocysteine
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result These findings demonstrate synergistic growth inhibition of ERalpha positive breast cancer xenografts by combination of tamoxifen with organic selenium compounds. Organic selenium may provide added benefit when combined with tamoxifen in adjuvant therapy or prevention.
Combination Pair ID: 115
Pair Name Morusin, MAPK pathway inhibitors
Phytochemical Morusin
Drug MAPK pathway inhibitors
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our results suggested that the combination of morusin and MAPK pathway inhibitors may be a more effective treatment strategy for BRAF-mutant melanoma than MAPK pathway inhibitors alone.
Combination Pair ID: 20
Pair Name Narciclasine, Tamoxifen
Phytochemical Narciclasine
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our findings successfully highlight the STAT3 as the direct therapeutic target of Nar in ER-positive breast cancer cells, especially, Nar leaded STAT3 degradation as a promising strategy for the tamoxifen-resistant breast cancer treatment.
Combination Pair ID: 955
Pair Name Noscapine, Cisplatin
Phytochemical Noscapine
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our results suggest that Nos enhanced the anticancer activity of Cis in an additive to synergistic manner by activating multiple signaling pathways including apoptosis. These findings suggest potential benefit for use of Nos and Cis combination in treatment of lung cancer.
Combination Pair ID: 957
Pair Name Noscapine, Gemcitabine
Phytochemical Noscapine
Drug Gemcitabine
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Nos potentiated the anticancer activity of Gem in an additive to synergistic manner against lung cancer via antiangiogenic and apoptotic pathways. These findings suggest potential benefit for use of NGC chemotherapy for treatment of lung cancer.
Combination Pair ID: 246
Pair Name Oleuropein, Doxorubicin
Phytochemical Oleuropein
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The key findings clearly indicate the synergistic efficacy of DOX with natural and nontoxic OL against breast tumor xenografts.
Combination Pair ID: 1009
Pair Name Oridonin, Venetoclax
Phytochemical Oridonin
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Oridonin and venetoclax synergistically promote AML cell apoptosis by inhibiting AKT signaling.
Combination Pair ID: 370
Pair Name Oxyresveratrol, Dacarbazine
Phytochemical Oxyresveratrol
Drug Dacarbazine
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation G1/S-specific cyclin-D1 Expression
Result This combination treatment may serve as a novel therapeutic strategy for treating malignant melanoma.
Combination Pair ID: 175
Pair Name Parthenolide, Balsalazide
Phytochemical Parthenolide
Drug Balsalazide
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result These results demonstrate that parthenolide potentiates the efficacy of balsalazide through synergistic inhibition of NF-κB activation and the combination of dual agents prevents colon carcinogenesis from chronic inflammation.
Combination Pair ID: 42
Pair Name Peiminine, Doxorubicin
Phytochemical Peiminine
Drug Doxorubicin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our findings indicated that sinapine played an important role in the downregulation of MDR1 expression through suppression of fibroblast growth factor receptor (FGFR)4/FRS2α-ERK1/2 mediated NF-κB activation in MCF-7/dox cancer cells.
Combination Pair ID: 959
Pair Name Periplocin, Gemcitabine
Phytochemical Periplocin
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells
Combination Pair ID: 961
Pair Name Platycodin D, Cetuximab
Phytochemical Platycodin D
Drug Cetuximab
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our findings provide a potential strategy to inhibit CRC metastasis during cetuximab therapy by addition of platycodin D.
Combination Pair ID: 964
Pair Name Platycodin D, Sorafenib
Phytochemical Platycodin D
Drug Sorafenib
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The combination of Platycodin D and sorafenib may exert potent anti-cancer effects specifically via FOXO3a
Combination Pair ID: 804
Pair Name Pterostilbene, Sorafenib
Phytochemical Pterostilbene
Drug Sorafenib
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result PET obviously enhanced sorafenib's antitumour effects against GAC through inhibiting cell proliferation, inducing autophagy and promoting apoptosis. The combination therapy with PET and sorafenib may serve as a novel therapeutic strategy for treating GAC and deserve further clinical trials.
Combination Pair ID: 78
Pair Name Puerarin, Cisplatin
Phytochemical Puerarin
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Taking these results together, we can draw the conclusion that the PUE enhances the anti-tumor effect of DDP on the drug-resistant A549 cancer in vivo and in vitro through activation of the Wnt signaling pathway.
Combination Pair ID: 51
Pair Name Sanguinarium, Bortezomib
Phytochemical Sanguinarium
Drug Bortezomib
Disease Info [ICD-11: 2A83] Multiple myeloma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our findings demonstrate that SNG induces mitochondrial and caspase-dependent apoptosis, generates oxidative stress, and suppresses MM cell lines proliferation. In addition, co-treatment of MM cell lines with sub-toxic doses of SNG and BTZ potentiated the cytotoxic activity. These results would suggest that SNG could be developed into therapeutic agent either alone or in combination with other anticancer drugs in MM.
Combination Pair ID: 974
Pair Name Sanguinarium, Doxorubicin
Phytochemical Sanguinarium
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Cellular and molecular studies suggested adjuvant chemosensitizers SA and SN to reverse MDR in breast cancer cells.
Combination Pair ID: 286
Pair Name Shikonin, Gefitinib
Phytochemical Shikonin
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result These results provide a promising therapeutic approach for the treatment of wild-type EGFR non-small cell lung cancer.
Combination Pair ID: 725
Pair Name Shikonin, Gemcitabine
Phytochemical Shikonin
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our results suggest that shikonin can suppress the growth of human pancreatic tumors and potentiate the antitumor effects of gemcitabine through the suppression of NF-κB and NF-κB-regulated gene products.
Combination Pair ID: 460
Pair Name Shogaol, Fluorouracil
Phytochemical Shogaol
Drug Fluorouracil
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Influence of 6-shogaol potentiated on 5-fluorouracil treatment of liver cancer by promoting apoptosis and cell cycle arrest by regulating AKT/mTOR/MRP1 signalling
Combination Pair ID: 870
Pair Name Shogaol, Gemcitabine
Phytochemical Shogaol
Drug Gemcitabine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our results suggest that 6-shogaol can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing of TLR4/NF-κB-mediated inflammatory pathways linked to tumorigenesis.
Combination Pair ID: 98
Pair Name Silibinin, Metformin
Phytochemical Silibinin
Drug Metformin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The results provide evidence that synergistic antiproliferative effects of MET and SIL, linking to the down-regulation of Cyclin D1 and hTERT genes, and propose that MET+SIL may have therapeutic value in breast cancer therapy.
Combination Pair ID: 44
Pair Name Solamargine, Cisplatin
Phytochemical Solamargine
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Identification of solamargine as a cisplatin sensitizer through phenotypical screening in cisplatin-resistant NSCLC organoids
Combination Pair ID: 547
Pair Name Sulforaphane, Cisplatin
Phytochemical Sulforaphane
Drug Cisplatin
Disease Info [ICD-11: 2C28] Malignant mesothelioma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Pro-oxidant activity of sulforaphane and cisplatin potentiates apoptosis and simultaneously promotes autophagy in malignant mesothelioma cells
Combination Pair ID: 363
Pair Name Tenacissoside G, Fluorouracil
Phytochemical Tenacissoside G
Drug Fluorouracil
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result TG potentiated 5-FU's inhibitory activity to human colorectal cancer through arresting cell cycle progression and inducing p53-mediated apoptosis, which may present a novel strategy in CRC therapies and contribute to the optimizing clinical application of 5-FU.
Combination Pair ID: 752
Pair Name Thymoquinone, Cyclophosphamide
Phytochemical Thymoquinone
Drug Cyclophosphamide
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The current findings suggested that TQ can alter the cell cycle progression and induce cell death independent of FASN mediated signaling. In terms of clinical perspective, the present study clearly showed that TQ can broadly augment the effect of cyclo in breast cancer cases irrespective of Her-2+ or Her-.
Combination Pair ID: 754
Pair Name Thymoquinone, Propranolol
Phytochemical Thymoquinone
Drug Propranolol
Disease Info [ICD-11: 2C23.Z] Laryngeal cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The effect of thymoquinone and propranolol combination on epidermoid laryngeal carcinoma cell.
Combination Pair ID: 681
Pair Name Ursolic acid, Cisplatin
Phytochemical Ursolic acid
Drug Cisplatin
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The combination of UA with DDP could more effectively inhibit SiHa cells proliferation and facilitate cell apoptosis through suppressing NF-κB p65.
Combination Pair ID: 1011
Pair Name Ursolic acid, Doxorubicin
Phytochemical Ursolic acid
Drug Doxorubicin
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result UA may be a novel anticancer strategy and could be considered for investigation as a complementary chemotherapy agent in the future.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 105
Pair Name Chrysin, Fluorouracil
Phytochemical Chrysin
Drug Fluorouracil
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Up-regulation G1/S-specific cyclin-D1 Expression
Result Potentiating activities of chrysin in the therapeutic efficacy of 5-fluorouracil in gastric cancer cells
Combination Pair ID: 596
Pair Name Cordycepin, Cisplatin
Phytochemical Cordycepin
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Our results suggested that Cor in combination with DDP could be an additional therapeutic option for the treatment of DDP-resistant NSCLC.
Combination Pair ID: 931
Pair Name Gamma-Tocotrienol, Simvastatin
Phytochemical Gamma-Tocotrienol
Drug Simvastatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol
Combination Pair ID: 106
Pair Name Liquiritin, Cisplatin
Phytochemical Liquiritin
Drug Cisplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Liquiritin induces apoptosis and autophagy in cisplatin (DDP)-resistant gastric cancer cells in vitro and xenograft nude mice in vivo
Combination Pair ID: 770
Pair Name Mitocurcumin, Cytarabine
Phytochemical Mitocurcumin
Drug Cytarabine
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis.
Combination Pair ID: 609
Pair Name Noscapine, Docetaxel
Phytochemical Noscapine
Drug Docetaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-D1 Expression
Result Chemo-sensitizing effect of Nos followed by DTX regime provide a promising chemotherapeutic strategy and its significant role for the treatment of drug-resistant TNBC.
03. Reference
No. Title Href
1 Baicalein enhances the antitumor efficacy of docetaxel on nonsmall cell lung cancer in a β-catenin-dependent manner. Phytother Res. 2020 Jan;34(1):104-117. doi: 10.1002/ptr.6501. Click
2 The combination of Biochanin A and SB590885 potentiates the inhibition of tumour progression in hepatocellular carcinoma. Cancer Cell Int. 2020 Aug 5;20:371. doi: 10.1186/s12935-020-01463-w. Click
3 Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. Click
4 Crocin synergistically enhances the antiproliferative activity of 5-flurouracil through Wnt/PI3K pathway in a mouse model of colitis-associated colorectal cancer. J Cell Biochem. 2018 Dec;119(12):10250-10261. doi: 10.1002/jcb.27367. Click
5 Phyto-sesquiterpene lactone deoxyelephantopin and cisplatin synergistically suppress lung metastasis of B16 melanoma in mice with reduced nephrotoxicity. Phytomedicine. 2019 Mar 15;56:194-206. doi: 10.1016/j.phymed.2018.11.005. Click
6 EGCG synergizes the therapeutic effect of irinotecan through enhanced DNA damage in human colorectal cancer cells. J Cell Mol Med. 2021 Aug;25(16):7913-7921. doi: 10.1111/jcmm.16718. Click
7 Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells. J Food Sci. 2021 Jun;86(6):2700-2712. doi: 10.1111/1750-3841.15740. Click
8 Molecular mechanism of ion channel protein TMEM16A regulated by natural product of narirutin for lung cancer adjuvant treatment. Int J Biol Macromol. 2022 Dec 31;223(Pt A):1145-1157. doi: 10.1016/j.ijbiomac.2022.11.123. Click
9 Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. Click
10 [6]-Gingerol enhances the cisplatin sensitivity of gastric cancer cells through inhibition of proliferation and invasion via PI3K/AKT signaling pathway. Phytother Res. 2019 May;33(5):1353-1362. doi: 10.1002/ptr.6325. Click
11 Combined Application of Salinomycin and ATRA Induces Apoptosis and Differentiation of Acute Myeloid Leukemia Cells by Inhibiting WNT/β-Catenin Pathway. Anticancer Agents Med Chem. 2023;23(9):1074-1084. doi: 10.2174/1871520623666230110121629. Click
12 Chemopreventive effect of α-hederin/carboplatin combination against experimental colon hyperplasia and impact on JNK signaling. Toxicol Mech Methods. 2021 Feb;31(2):138-149. doi: 10.1080/15376516.2020.1849483. Click
13 Enhancing Tamoxifen Therapy with α-Mangostin: Synergistic Antiproliferative Effects on Breast Cancer Cells and Potential Reduced Endometrial Impact. Pharmaceuticals (Basel). 2023 Nov 8;16(11):1576. doi: 10.3390/ph16111576. Click
14 Scutellaria baicalensis enhances 5-fluorouracil-based chemotherapy via inhibition of proliferative signaling pathways. Cell Commun Signal. 2023 Jun 19;21(1):147. doi: 10.1186/s12964-023-01156-7. Click
15 Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. Click
16 Blockade of AMPK-Mediated cAMP-PKA-CREB/ATF1 Signaling Synergizes with Aspirin to Inhibit Hepatocellular Carcinoma. Cancers (Basel). 2021 Apr 6;13(7):1738. doi: 10.3390/cancers13071738. Click
17 Berbamine (BBM), a Natural STAT3 Inhibitor, Synergistically Enhances the Antigrowth and Proapoptotic Effects of Sorafenib on Hepatocellular Carcinoma Cells. ACS Omega. 2020 Sep 18;5(38):24838-24847. doi: 10.1021/acsomega.0c03527. Click
18 Targeting Na+ /K+ -ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma. Br J Pharmacol. 2021 Nov;178(21):4389-4407. doi: 10.1111/bph.15616. Click
19 Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway. Molecules. 2021 Mar 17;26(6):1666. doi: 10.3390/molecules26061666. Click
20 Antitumor effects of erlotinib in combination with berberine in A431 cells. BMC Pharmacol Toxicol. 2023 May 11;24(1):29. doi: 10.1186/s40360-023-00661-2. Click
21 Simvastatin in combination with bergamottin potentiates TNF-induced apoptosis through modulation of NF-κB signalling pathway in human chronic myelogenous leukaemia. Pharm Biol. 2016 Oct;54(10):2050-60. doi: 10.3109/13880209.2016.1141221. Click
22 Synergistic antitumor effect of β-elemene and etoposide is mediated via induction of cell apoptosis and cell cycle arrest in non-small cell lung carcinoma cells. Mol Med Rep. 2011 Nov-Dec;4(6):1189-93. doi: 10.3892/mmr.2011.537. Click
23 Sorafenib in Combination with Betulinic Acid Synergistically Induces Cell Cycle Arrest and Inhibits Clonogenic Activity in Pancreatic Ductal Adenocarcinoma Cells. Int J Mol Sci. 2018 Oct 19;19(10):3234. doi: 10.3390/ijms19103234. Click
24 The natural isoflavone Biochanin-A synergizes 5-fluorouracil anticancer activity in vitro and in vivo in Ehrlich solid-phase carcinoma model. Phytother Res. 2022 Mar;36(3):1310-1325. doi: 10.1002/ptr.7388. Click
25 Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a. Int J Mol Med. 2015 Oct;36(4):957-66. doi: 10.3892/ijmm.2015.2324. Click
26 Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a. Int J Mol Med. 2015 Oct;36(4):957-66. doi: 10.3892/ijmm.2015.2324. Click
27 Synergistic Growth Inhibitory Effects of Chrysin and Metformin Combination on Breast Cancer Cells through hTERT and Cyclin D1 Suppression. Asian Pac J Cancer Prev. 2018 Apr 25;19(4):977-982. doi: 10.22034/APJCP.2018.19.4.977. Click
28 The role of daurisoline treatment in hepatocellular carcinoma: Inhibiting vasculogenic mimicry formation and enhancing sensitivity to sorafenib. Phytomedicine. 2021 Nov;92:153740. doi: 10.1016/j.phymed.2021.153740. Click
29 Decursin and Doxorubicin Are in Synergy for the Induction of Apoptosis via STAT3 and/or mTOR Pathways in Human Multiple Myeloma Cells. Evid Based Complement Alternat Med. 2013;2013:506324. doi: 10.1155/2013/506324. Click
30 δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis. Cell Prolif. 2021 Nov;54(11):e13111. doi: 10.1111/cpr.13111. Click
31 Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178. Click
32 Anti-proliferative and anti-apoptotic potential effects of epigallocatechin-3-gallate and/or metformin on hepatocellular carcinoma cells: in vitro study. Mol Biol Rep. 2019 Apr;46(2):2039-2047. doi: 10.1007/s11033-019-04653-6. Click
33 Evening Primrose Oil Enhances Tamoxifen's Anticancer Activity against Breast Cancer Cells by Inducing Apoptosis, Inhibiting Angiogenesis, and Arresting the Cell Cycle. Molecules. 2022 Apr 7;27(8):2391. doi: 10.3390/molecules27082391 Click
34 First evidence that γ-tocotrienol inhibits the growth of human gastric cancer and chemosensitizes it to capecitabine in a xenograft mouse model through the modulation of NF-κB pathway. Clin Cancer Res. 2012 Apr 15;18(8):2220-9. doi: 10.1158/1078-0432.CCR-11-2470. Click
35 γ-Tocotrienol suppresses growth and sensitises human colorectal tumours to capecitabine in a nude mouse xenograft model by down-regulating multiple molecules. Br J Cancer. 2016 Sep 27;115(7):814-24. doi: 10.1038/bjc.2016.257. Click
36 {Gamma}-tocotrienol inhibits pancreatic tumors and sensitizes them to gemcitabine treatment by modulating the inflammatory microenvironment. Cancer Res. 2010 Nov 1;70(21):8695-705. doi: 10.1158/0008-5472.CAN-10-2318. Epub 2010 Sep 23. Click
37 Ginger extract adjuvant to doxorubicin in mammary carcinoma: study of some molecular mechanisms. Eur J Nutr. 2018 Apr;57(3):981-989. doi: 10.1007/s00394-017-1382-6. Click
38 Gossypol sensitizes the antitumor activity of 5-FU through down-regulation of thymidylate synthase in human colon carcinoma cells. Cancer Chemother Pharmacol. 2015 Sep;76(3):575-86. doi: 10.1007/s00280-015-2749-0. Click
39 Halofuginone Sensitizes Lung Cancer Organoids to Cisplatin via Suppressing PI3K/AKT and MAPK Signaling Pathways. Front Cell Dev Biol. 2021 Nov 24;9:773048. doi: 10.3389/fcell.2021.773048. Click
40 Hesperetin Promotes Cisplatin-Induced Apoptosis of Gastric Cancer In Vitro and In Vivo by Upregulating PTEN Expression. Front Pharmacol. 2020 Aug 27;11:1326. doi: 10.3389/fphar.2020.01326. Click
41 Combined effect of honokiol and rosiglitazone on cell growth inhibition through enhanced G0/G1 phase arrest in hepatoma cells. J Chin Med Assoc. 2016 Aug;79(8):415-21. doi: 10.1016/j.jcma.2016.03.003. Click
42 Icariin-mediated inhibition of NF-κB activity enhances the in vitro and in vivo antitumour effect of 5-fluorouracil in colorectal cancer. Cell Biochem Biophys. 2014 Jul;69(3):523-30. doi: 10.1007/s12013-014-9827-5. Click
43 Synergistic inhibitory effect of Smo inhibitor jervine and its combination with decitabine can target Hedgehog signaling pathway to inhibit myelodysplastic syndrome cell line. Hematology. 2021 Dec;26(1):518-528. doi: 10.1080/16078454.2021.1950897. Click
44 Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. Click
45 Synergistic effects of the immune checkpoint inhibitor CTLA-4 combined with the growth inhibitor lycorine in a mouse model of renal cell carcinoma. Oncotarget. 2017 Mar 28;8(13):21177-21186. doi: 10.18632/oncotarget.15505. Click
46 Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway. Am J Transl Res. 2019 Jun 15;11(6):3816-3824. Click
47 Maslinic acid potentiates the antitumor activities of gemcitabine in vitro and in vivo by inhibiting NF-κB-mediated survival signaling pathways in human gallbladder cancer cells. Oncol Rep. 2015 Apr;33(4):1683-90. doi: 10.3892/or.2015.3755. Click
48 Combination of methylselenocysteine with tamoxifen inhibits MCF-7 breast cancer xenografts in nude mice through elevated apoptosis and reduced angiogenesis. Breast Cancer Res Treat. 2009 Nov;118(1):33-43. doi: 10.1007/s10549-008-0216-x. Click
49 Morusin enhances the antitumor activity of MAPK pathway inhibitors in BRAF-mutant melanoma by inhibiting the feedback activation of STAT3. Eur J Cancer. 2022 Apr;165:58-70. doi: 10.1016/j.ejca.2022.01.004. Click
50 Narciclasine targets STAT3 via distinct mechanisms in tamoxifen-resistant breast cancer cells. Mol Ther Oncolytics. 2022 Jan 3;24:340-354. doi: 10.1016/j.omto.2021.12.025. Click
51 Anticancer activity of Noscapine, an opioid alkaloid in combination with Cisplatin in human non-small cell lung cancer. Lung Cancer. 2011 Mar;71(3):271-82. doi: 10.1016/j.lungcan.2010.06.002. Click
52 Enhanced anticancer activity of gemcitabine in combination with noscapine via antiangiogenic and apoptotic pathway against non-small cell lung cancer. PLoS One. 2011;6(11):e27394. doi: 10.1371/journal.pone.0027394. Click
53 Synergistic Anti-Breast-Cancer Effects of Combined Treatment With Oleuropein and Doxorubicin In Vivo. Altern Ther Health Med. 2019 May;25(3):17-24. Click
54 Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195. Click
55 Synergistic inhibitory effects of the oxyresveratrol and dacarbazine combination against melanoma cells. Oncol Lett. 2021 Sep;22(3):667. doi: 10.3892/ol.2021.12928. Click
56 Combined Parthenolide and Balsalazide Have Enhanced Antitumor Efficacy Through Blockade of NF-κB Activation. Mol Cancer Res. 2017 Feb;15(2):141-151. doi: 10.1158/1541-7786.MCR-16-0101. Click
57 Peiminine serves as an adriamycin chemosensitizer in gastric cancer by modulating the EGFR/FAK pathway. Oncol Rep. 2018 Mar;39(3):1299-1305. doi: 10.3892/or.2018.6184. Click
58 Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells. Biomed Pharmacother. 2023 Jan;157:114039. doi: 10.1016/j.biopha.2022.114039. Click
59 Platycodin D represses β-catenin to suppress metastasis of cetuximab-treated KRAS wild-type colorectal cancer cells. Clin Exp Metastasis. 2023 Aug;40(4):339-356. doi: 10.1007/s10585-023-10218-6. Click
60 Combined Anti-Cancer Effects of Platycodin D and Sorafenib on Androgen-Independent and PTEN-Deficient Prostate Cancer. Front Oncol. 2021 May 7;11:648985. doi: 10.3389/fonc.2021.648985. Click
61 Pterostilbene enhances sorafenib's anticancer effects on gastric adenocarcinoma. J Cell Mol Med. 2020 Nov;24(21):12525-12536. doi: 10.1111/jcmm.15795. Click
62 Puerarin Enhances the Anti-Tumor Effect of Cisplatin on Drug-Resistant A549 Cancer in vivo and in vitro Through Activation of the Wnt Signaling Pathway. Cancer Manag Res. 2020 Jul 24;12:6279-6289. doi: 10.2147/CMAR.S253327. Click
63 Sanguinarine Induces Apoptosis Pathway in Multiple Myeloma Cell Lines via Inhibition of the JaK2/STAT3 Signaling. Front Oncol. 2019 Apr 17;9:285. doi: 10.3389/fonc.2019.00285. Click
64 Doxorubicin-sanguinarine nanoparticles: formulation and evaluation of breast cancer cell apoptosis and cell cycle. Drug Dev Ind Pharm. 2024 Jan 5:1-15. doi: 10.1080/03639045.2024.2302557. Click
65 Shikonin enhances sensitization of gefitinib against wild-type EGFR non-small cell lung cancer via inhibition PKM2/stat3/cyclinD1 signal pathway. Life Sci. 2018 Jul 1;204:71-77. doi: 10.1016/j.lfs.2018.05.012. Click
66 Shikonin suppresses tumor growth and synergizes with gemcitabine in a pancreatic cancer xenograft model: Involvement of NF-κB signaling pathway. Biochem Pharmacol. 2014 Apr 1;88(3):322-33. doi: 10.1016/j.bcp.2014.01.041. Click
67 Influence of 6-shogaol potentiated on 5-fluorouracil treatment of liver cancer by promoting apoptosis and cell cycle arrest by regulating AKT/mTOR/MRP1 signalling. Chin J Nat Med. 2022 May;20(5):352-363. doi: 10.1016/S1875-5364(22)60174-2. Click
68 Antitumor activity of gemcitabine can be potentiated in pancreatic cancer through modulation of TLR4/NF-κB signaling by 6-shogaol. AAPS J. 2014 Mar;16(2):246-57. doi: 10.1208/s12248-013-9558-3. Click
69 Synergistic Anti-proliferative Effects of Metformin and Silibinin Combination on T47D Breast Cancer Cells via hTERT and Cyclin D1 Inhibition. Drug Res (Stuttg). 2018 Dec;68(12):710-716. doi: 10.1055/a-0631-8046. Click
70 Identification of solamargine as a cisplatin sensitizer through phenotypical screening in cisplatin-resistant NSCLC organoids. Front Pharmacol. 2022 Aug 10;13:802168. doi: 10.3389/fphar.2022.802168. Click
71 Pro-oxidant activity of sulforaphane and cisplatin potentiates apoptosis and simultaneously promotes autophagy in malignant mesothelioma cells. Mol Med Rep. 2017 Aug;16(2):2133-2141. doi: 10.3892/mmr.2017.6789. Click
72 Tenacissoside G synergistically potentiates inhibitory effects of 5-fluorouracil to human colorectal cancer. Phytomedicine. 2021 Jun;86:153553. doi: 10.1016/j.phymed.2021.153553. Click
73 Thymoquinone Augments Cyclophosphamide-Mediated Inhibition of Cell Proliferation in Breast Cancer Cells. Asian Pac J Cancer Prev. 2019 Apr 29;20(4):1153-1160. doi: 10.31557/APJCP.2019.20.4.1153. Click
74 The effect of thymoquinone and propranolol combination on epidermoid laryngeal carcinoma cell. Eur Arch Otorhinolaryngol. 2023 Jun;280(6):2849-2858. doi: 10.1007/s00405-023-07825-0. Click
75 Synergism of ursolic acid and cisplatin promotes apoptosis and enhances growth inhibition of cervical cancer cells via suppressing NF-κB p65. Oncotarget. 2017 Oct 30;8(57):97416-97427. doi: 10.18632/oncotarget.22133. Click
76 Inhibition of colorectal cancer tumorigenesis by ursolic acid and doxorubicin is mediated by targeting the Akt signaling pathway and activating the Hippo signaling pathway. Mol Med Rep. 2023 Jan;27(1):11. doi: 10.3892/mmr.2022.12898. Click
77 Potentiating activities of chrysin in the therapeutic efficacy of 5-fluorouracil in gastric cancer cells. Oncol Lett. 2021 Jan;21(1):24. doi: 10.3892/ol.2020.12285. Click
78 Cordycepin Reverses Cisplatin Resistance in Non-small Cell Lung Cancer by Activating AMPK and Inhibiting AKT Signaling Pathway. Front Cell Dev Biol. 2021 Jan 15;8:609285. doi: 10.3389/fcell.2020.609285. Click
79 Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol. Cancer Lett. 2013 Jan 28;328(2):285-96. doi: 10.1016/j.canlet.2012.10.003. Click
80 Liquiritin induces apoptosis and autophagy in cisplatin (DDP)-resistant gastric cancer cells in vitro and xenograft nude mice in vivo. Int J Oncol. 2017 Nov;51(5):1383-1394. doi: 10.3892/ijo.2017.4134. Click
81 Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004 Click
82 Reversal of drug-resistance by noscapine chemo-sensitization in docetaxel resistant triple negative breast cancer. Sci Rep. 2017 Nov 20;7(1):15824. doi: 10.1038/s41598-017-15531-1. Click
It has been 26140 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP