Name | G1/S-specific cyclin-D1 | ||
UniProt ID | CCND1_HUMAN | ||
Gene Name | CCND1 | ||
Gene ID | 595 | ||
Synonyms |
CCND1, BCL1, D11S287E, PRAD1, U21B31
|
||
Sequence |
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI |
||
Pathway Map | MAP LINK | ||
T.C. Number | 1.I.1.1.3 | ||
KEGG ID | hsa595 | ||
TTD ID | T12355 | ||
Pfam | PF00134; PF02984 |
Pair Name | Baicalein, Docetaxel | |||
Phytochemical Name | Baicalein | |||
Anticancer drug Name | Docetaxel | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Baicalein enhances the antitumor efficacy of docetaxel on nonsmall cell lung cancer in a β-catenin-dependent manner |
Pair Name | Kuromanin chloride, Cisplatin | |||
Phytochemical Name | Kuromanin chloride | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2C77.Z] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells |
Pair Name | Narirutin, Cisplatin | |||
Phytochemical Name | Narirutin | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Based on the significant anticancer effect and high biosafety, naringin has great potential as a functional food in the adjuvant treatment of lung cancer. |
Pair Name | Epigallocatechin gallate, Irinotecan | |||
Phytochemical Name | Epigallocatechin gallate | |||
Anticancer drug Name | Irinotecan | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | EGCG synergizes the therapeutic effect of irinotecan through enhanced DNA damage in human colorectal cancer cells |
Pair Name | Crocin, Fluorouracil | |||
Phytochemical Name | Crocin | |||
Anticancer drug Name | Fluorouracil | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | We demonstrated an antitumor activity of crocin in CRC and its potential role in improvement of inflammation with mucosal ulcers and high-grade dysplastic crypts, supporting the desireability of further investigations on the therapeutic potential of this approach in CRC. |
Pair Name | Deoxyelephantopin, Cisplatin | |||
Phytochemical Name | Deoxyelephantopin | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The CP and DET combination may be an effective intervention for melanoma with reduced side effects. |
Pair Name | Carvacrol, Sorafenib | |||
Phytochemical Name | Carvacrol | |||
Anticancer drug Name | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC. |
Pair Name | Biochanin A, SB590885 | |||
Phytochemical Name | Biochanin A | |||
Anticancer drug Name | SB590885 | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The results identify an effective combination therapy for the most aggressive form of HCC and provide the possibility of therapeutic improvement for patients with advanced HCC. |
Pair Name | Usnic acid, Bleomycin | |||
Phytochemical Name | Usnic acid | |||
Anticancer drug Name | Bleomycin | |||
Disease Info | [ICD-11: 2F94] | Ascitic tumor | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin |
Pair Name | Halofuginone, Cisplatin | |||
Phytochemical | Halofuginone | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Halofuginone Sensitizes Lung Cancer Organoids to Cisplatin via Suppressing PI3K/AKT and MAPK Signaling Pathways |
Pair Name | Narciclasine, Tamoxifen | |||
Phytochemical | Narciclasine | |||
Drug | Tamoxifen | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our findings successfully highlight the STAT3 as the direct therapeutic target of Nar in ER-positive breast cancer cells, especially, Nar leaded STAT3 degradation as a promising strategy for the tamoxifen-resistant breast cancer treatment. |
Pair Name | Lycorine hydrochloride, Anti-CTLA-4 | |||
Phytochemical | Lycorine hydrochloride | |||
Drug | Anti-CTLA-4 | |||
Disease Info | [ICD-11: 2C90.0] | Renal cell carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Synergistic effects of the immune checkpoint inhibitor CTLA-4 combined with the growth inhibitor lycorine in a mouse model of renal cell carcinoma |
Pair Name | Berbamine, Aspirin | |||
Phytochemical | Berbamine | |||
Drug | Aspirin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | These data demonstrate that the regulation of cAMP-PKA-CREB/ATF1 signaling represents a noncanonical function of CPS1. Targeting the PKA-CREB/ATF1 axis may be a strategy to improve the therapeutic effects of aspirin on HCC. |
Pair Name | Berbamine, Sorafenib | |||
Phytochemical | Berbamine | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | These findings identify a new type of natural STAT3 inhibitor and provide a novel approach to the enhancement of SORA efficacy by blocking the activation of STAT3. |
Pair Name | Berbamine, Sorafenib | |||
Phytochemical | Berbamine | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Targeting Na+/K+-ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma |
Pair Name | Berbamine, Arcyriaflavin A | |||
Phytochemical | Berbamine | |||
Drug | Arcyriaflavin A | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells. |
Pair Name | Peiminine, Doxorubicin | |||
Phytochemical | Peiminine | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our findings indicated that sinapine played an important role in the downregulation of MDR1 expression through suppression of fibroblast growth factor receptor (FGFR)4/FRS2α-ERK1/2 mediated NF-κB activation in MCF-7/dox cancer cells. |
Pair Name | Solamargine, Cisplatin | |||
Phytochemical | Solamargine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Identification of solamargine as a cisplatin sensitizer through phenotypical screening in cisplatin-resistant NSCLC organoids |
Pair Name | Dihydroberberine, Sunitinib | |||
Phytochemical | Dihydroberberine | |||
Drug | Sunitinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | DCS induced the expression of cell cycle signal molecules that are known to be affected by JNK and p38. The change of cell cycle, in turn, led to down-regulation of JNK and p38, and further reduced IL-1 secretion. Collectively, these findings highlight potential molecular mechanisms of DCS chemotherapeutic activity and suggest that DCS is an efficacious strategy in NSCLC therapy. |
Pair Name | Jervine, Decitabine | |||
Phytochemical | Jervine | |||
Drug | Decitabine | |||
Disease Info | [ICD-11: 2A3Z] | Myelodysplastic syndrome | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The Smo inhibitor jervine and its combination with decitabine have a synergistic effect on the proliferation, cell cycle, and apoptosis of MUTZ-1 cells, and its mechanism may be achieved by interfering with the Shh signaling pathway. |
Pair Name | Sanguinarium, Bortezomib | |||
Phytochemical | Sanguinarium | |||
Drug | Bortezomib | |||
Disease Info | [ICD-11: 2A83.1] | Multiple myeloma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our findings demonstrate that SNG induces mitochondrial and caspase-dependent apoptosis, generates oxidative stress, and suppresses MM cell lines proliferation. In addition, co-treatment of MM cell lines with sub-toxic doses of SNG and BTZ potentiated the cytotoxic activity. These results would suggest that SNG could be developed into therapeutic agent either alone or in combination with other anticancer drugs in MM. |
Pair Name | Sanguinarium, Doxorubicin | |||
Phytochemical | Sanguinarium | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Cellular and molecular studies suggested adjuvant chemosensitizers SA and SN to reverse MDR in breast cancer cells. |
Pair Name | Daurinoline, Sorafenib | |||
Phytochemical | Daurinoline | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our study provides insights into the molecular mechanisms underlying DS-induced inhibition of VM, which may facilitate the development of a novel clinical anti-HCC drug. Moreover, our findings suggest that the combination of DS and sorafenib constitutes a potential therapeutic strategy for HCC. |
Pair Name | Baicalin, Fluorouracil | |||
Phytochemical | Baicalin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | These results indicate that HQ and its component baicalin enhance the effect of 5-fluorouracil-based chemotherapy via inhibition of CDK-RB pathway. These findings may provide the rational basis for developing agents that can overcome the development of cellular drug resistance. Video Abstract. |
Pair Name | Puerarin, Cisplatin | |||
Phytochemical | Puerarin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Taking these results together, we can draw the conclusion that the PUE enhances the anti-tumor effect of DDP on the drug-resistant A549 cancer in vivo and in vitro through activation of the Wnt signaling pathway. |
Pair Name | Hesperetin, Cisplatin | |||
Phytochemical | Hesperetin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Hesperetin could inhibit the phosphatidylinositol-4,5-bisphosphate 3-kinase (PI3K)/AKT signaling pathway and induce the mitochondrial pathway via upregulating PTEN expression, thereby significantly enhancing DDP's anti-tumor effect on GC |
Pair Name | Silibinin, Metformin | |||
Phytochemical | Silibinin | |||
Drug | Metformin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The results provide evidence that synergistic antiproliferative effects of MET and SIL, linking to the down-regulation of Cyclin D1 and hTERT genes, and propose that MET+SIL may have therapeutic value in breast cancer therapy. |
Pair Name | Chrysin, Metformin | |||
Phytochemical | Chrysin | |||
Drug | Metformin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The conmbination of metformin and chrysin suppressing hTERT and cyclin D1 gene expression might offer an appropriate approach for breast cancer therapy. |
Pair Name | Butein, Cisplatin | |||
Phytochemical | Butein | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C77.Z] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a |
Pair Name | Butein, Cisplatin | |||
Phytochemical | Butein | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C77.Z] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a |
Pair Name | Morusin, MAPK pathway inhibitors | |||
Phytochemical | Morusin | |||
Drug | MAPK pathway inhibitors | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our results suggested that the combination of morusin and MAPK pathway inhibitors may be a more effective treatment strategy for BRAF-mutant melanoma than MAPK pathway inhibitors alone. |
Pair Name | Epigallocatechin gallate, Metformin | |||
Phytochemical | Epigallocatechin gallate | |||
Drug | Metformin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Anti-proliferative and anti-apoptotic potential effects of epigallocatechin-3-gallate and/or metformin on hepatocellular carcinoma cells: in vitro study |
Pair Name | Licochalcone B, TNF-related apoptosis inducing ligand | |||
Phytochemical | Licochalcone B | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC. |
Pair Name | Parthenolide, Balsalazide | |||
Phytochemical | Parthenolide | |||
Drug | Balsalazide | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | These results demonstrate that parthenolide potentiates the efficacy of balsalazide through synergistic inhibition of NF-κB activation and the combination of dual agents prevents colon carcinogenesis from chronic inflammation. |
Pair Name | Oridonin, Venetoclax | |||
Phytochemical | Oridonin | |||
Drug | Venetoclax | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Oridonin and venetoclax synergistically promote AML cell apoptosis by inhibiting AKT signaling. |
Pair Name | Betulinic Acid, Sorafenib | |||
Phytochemical | Betulinic Acid | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | We showed that combined treatment with low concentrations of sorafenib and betulinic acid had the capacity to inhibit proliferation and abolish clonogenic activity in PDAC cell lines. |
Pair Name | Ursolic acid, Cisplatin | |||
Phytochemical | Ursolic acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C77.Z] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The combination of UA with DDP could more effectively inhibit SiHa cells proliferation and facilitate cell apoptosis through suppressing NF-κB p65. |
Pair Name | Ursolic acid, Doxorubicin | |||
Phytochemical | Ursolic acid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | UA may be a novel anticancer strategy and could be considered for investigation as a complementary chemotherapy agent in the future. |
Pair Name | Maslinic acid, Gemcitabine | |||
Phytochemical | Maslinic acid | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C94.Z] | Bladder cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The results suggest that MA potentiates the antitumor effects of GEM in human GBC cell lines by suppressing the activation of NF-κB and its dowstream gene products, which are involved in survival signaling. |
Pair Name | Beta-Elemene, Etoposide | |||
Phytochemical | Beta-Elemene | |||
Drug | Etoposide | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | These results suggest that the combination of β-elemene and VP-16 may be a promising therapeutic option for lung cancer. |
Pair Name | Oleuropein, Doxorubicin | |||
Phytochemical | Oleuropein | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The key findings clearly indicate the synergistic efficacy of DOX with natural and nontoxic OL against breast tumor xenografts. |
Pair Name | Alpha-Hederin, Carboplatin | |||
Phytochemical | Alpha-Hederin | |||
Drug | Carboplatin | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Chemopreventive effect of α-hederin/carboplatin combination against experimental colon hyperplasia and impact on JNK signaling |
Pair Name | Shikonin, Gefitinib | |||
Phytochemical | Shikonin | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | These results provide a promising therapeutic approach for the treatment of wild-type EGFR non-small cell lung cancer. |
Pair Name | Shikonin, Gemcitabine | |||
Phytochemical | Shikonin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our results suggest that shikonin can suppress the growth of human pancreatic tumors and potentiate the antitumor effects of gemcitabine through the suppression of NF-κB and NF-κB-regulated gene products. |
Pair Name | Thymoquinone, Cyclophosphamide | |||
Phytochemical | Thymoquinone | |||
Drug | Cyclophosphamide | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The current findings suggested that TQ can alter the cell cycle progression and induce cell death independent of FASN mediated signaling. In terms of clinical perspective, the present study clearly showed that TQ can broadly augment the effect of cyclo in breast cancer cases irrespective of Her-2+ or Her-. |
Pair Name | Thymoquinone, Propranolol | |||
Phytochemical | Thymoquinone | |||
Drug | Propranolol | |||
Disease Info | [ICD-11: 2C23.Z] | Laryngeal cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The effect of thymoquinone and propranolol combination on epidermoid laryngeal carcinoma cell. |
Pair Name | Honokiol, Rosiglitazone | |||
Phytochemical | Honokiol | |||
Drug | Rosiglitazone | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Honokiol combined with rosiglitazone showed more effective growth inhibition in hepatoma cells mediated through the regulation of G0/G1 phase-related proteins p21, cyclin D1, cyclin E1, and Rb and cell cycle progression |
Pair Name | Bergamottin, Simvastatin | |||
Phytochemical | Bergamottin | |||
Drug | Simvastatin | |||
Disease Info | [ICD-11: 2A20.1] | Chronic myelogenous leukemia | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Discussion and conclusion Our results provide novel insight into the role of SV and BGM in potentially preventing and treating cancer through modulation of NF-κB signalling pathway and its regulated gene products. |
Pair Name | Decursin, Doxorubicin | |||
Phytochemical | Decursin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2A83.1] | Multiple myeloma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The combination treatment of decursin and doxorubicin can enhance apoptotic activity via mTOR and/or STAT3 signaling pathway in multiple myeloma cells. |
Pair Name | Magnolin, B-RAF Inhibitors | |||
Phytochemical | Magnolin | |||
Drug | B-RAF Inhibitors | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway |
Pair Name | Tenacissoside G, Fluorouracil | |||
Phytochemical | Tenacissoside G | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | TG potentiated 5-FU's inhibitory activity to human colorectal cancer through arresting cell cycle progression and inducing p53-mediated apoptosis, which may present a novel strategy in CRC therapies and contribute to the optimizing clinical application of 5-FU. |
Pair Name | Pterostilbene, Sorafenib | |||
Phytochemical | Pterostilbene | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | PET obviously enhanced sorafenib's antitumour effects against GAC through inhibiting cell proliferation, inducing autophagy and promoting apoptosis. The combination therapy with PET and sorafenib may serve as a novel therapeutic strategy for treating GAC and deserve further clinical trials. |
Pair Name | Oxyresveratrol, Dacarbazine | |||
Phytochemical | Oxyresveratrol | |||
Drug | Dacarbazine | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Up-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | This combination treatment may serve as a novel therapeutic strategy for treating malignant melanoma. |
Pair Name | Icariin, Fluorouracil | |||
Phytochemical | Icariin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | We suggest that combination of icariin with 5-FU might offer a therapeutic benefit to the patients with CRC; however, further studies are required to ascertain this proposition. |
Pair Name | [6]-Gingerol, Cisplatin | |||
Phytochemical | [6]-Gingerol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | [6]-Gingerol enhances the cisplatin sensitivity of gastric cancer cells through inhibition of proliferation and invasion via PI3K/AKT signaling pathway |
Pair Name | Alpha-Mangostin, Tamoxifen | |||
Phytochemical | Alpha-Mangostin | |||
Drug | Tamoxifen | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | This study establishes the benefits of incorporating AM as a co-adjuvant for first-line ER+ breast cancer therapy. |
Pair Name | Shogaol, Fluorouracil | |||
Phytochemical | Shogaol | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Influence of 6-shogaol potentiated on 5-fluorouracil treatment of liver cancer by promoting apoptosis and cell cycle arrest by regulating AKT/mTOR/MRP1 signalling |
Pair Name | Shogaol, Gemcitabine | |||
Phytochemical | Shogaol | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10.0] | Pancreatic ductal adenocarcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our results suggest that 6-shogaol can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing of TLR4/NF-κB-mediated inflammatory pathways linked to tumorigenesis. |
Pair Name | Biochanin A, Fluorouracil | |||
Phytochemical | Biochanin A | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The synergistic antitumor effect of Bio-A/ 5-FU combination can be, at least partly, attributed to Bio-A-mediated suppression of ER-α/Akt axis and the augmentation of 5-FU-mediated proapoptotic effects. |
Pair Name | Gossypol, Fluorouracil | |||
Phytochemical | Gossypol | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | These findings suggest that gossypol-mediated down-regulation of TS, cyclin D1, and the mTOR/p70S6K1 signaling pathways enhances the anti-tumor effect of 5-FU. Ultimately, our data exposed a new action for gossypol as an enhancer of 5-FU-induced cell growth suppression. |
Pair Name | All-trans retinoic acid, Salinomycin | |||
Phytochemical | All-trans-retinoic acid | |||
Drug | Salinomycin | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | S+RA induced differentiation by β-catenin-inhibition-mediated up-regulation of C/EBPs and PU.1 and suppression of c-Myc. S+RA triggered apoptosis through β-catenin-inhibition-regulated ΔΨm collapse and caspase-3/7 activation. Taken together, our findings may provide novel therapeutic strategies for AML patients by targeting the WNT/β-catenin pathway. |
Pair Name | Methylselenocysteine, Tamoxifen | |||
Phytochemical | Methylselenocysteine | |||
Drug | Tamoxifen | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | These findings demonstrate synergistic growth inhibition of ERalpha positive breast cancer xenografts by combination of tamoxifen with organic selenium compounds. Organic selenium may provide added benefit when combined with tamoxifen in adjuvant therapy or prevention. |
Pair Name | Sulforaphane, Cisplatin | |||
Phytochemical | Sulforaphane | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C28] | Malignant mesothelioma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Pro-oxidant activity of sulforaphane and cisplatin potentiates apoptosis and simultaneously promotes autophagy in malignant mesothelioma cells |
Pair Name | Ginger extract, Doxorubicin | |||
Phytochemical | Ginger extract | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | AMPK pathway and cyclin D1 gene expression could be a molecular therapeutic target for the anticancer effect of GE in mice bearing SEC. Combining GE and DOX revealed a greater efficacy as anticancer therapeutic regimen. |
Pair Name | Delta-Tocotrienol, Cisplatin | |||
Phytochemical | Delta-Tocotrienol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis |
Pair Name | Gamma-Tocotrienol, Capecitabine | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Capecitabine | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our results show that γ-tocotrienol can potentiate the effects of capecitabine through suppression of NF-κB-regulated markers of proliferation, invasion, angiogenesis, and metastasis. |
Pair Name | Gamma-Tocotrienol, Gemcitabine | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our findings suggest that γ-T3 can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing NF-κB-mediated inflammatory pathways linked to tumorigenesis. |
Pair Name | Gamma-Tocotrienol, Capecitabine | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Capecitabine | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our findings suggest that γ-T3 inhibited the growth of human CRC and sensitised CRC to capecitabine by regulating proteins linked to tumourigenesis. |
Pair Name | Berberine, Erlotinib | |||
Phytochemical | Berberine | |||
Drug | Erlotinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our data supported use of BBR in combination with erlotinib as a novel strategy for treatment of patients with EGFR positive tumors. |
Pair Name | Berberine, Cisplatin | |||
Phytochemical | Berberine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway |
Pair Name | Evening primrose oil, Tamoxifen | |||
Phytochemical | Evening primrose oil | |||
Drug | Tamoxifen | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The most significant finding of this study was the confirmation of the anticancer activity of the natural product EPO, which potentiated the activity of the anticancer drug TAM against MCF-7 and MDA-MB-231 BC cell lines through the induction of apoptosis, inhibiting angiogenesis and halting cell proliferation. |
Pair Name | Noscapine, Cisplatin | |||
Phytochemical | Noscapine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our results suggest that Nos enhanced the anticancer activity of Cis in an additive to synergistic manner by activating multiple signaling pathways including apoptosis. These findings suggest potential benefit for use of Nos and Cis combination in treatment of lung cancer. |
Pair Name | Noscapine, Gemcitabine | |||
Phytochemical | Noscapine | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Nos potentiated the anticancer activity of Gem in an additive to synergistic manner against lung cancer via antiangiogenic and apoptotic pathways. These findings suggest potential benefit for use of NGC chemotherapy for treatment of lung cancer. |
Pair Name | Periplocin, Gemcitabine | |||
Phytochemical | Periplocin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells |
Pair Name | Platycodin D, Cetuximab | |||
Phytochemical | Platycodin D | |||
Drug | Cetuximab | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our findings provide a potential strategy to inhibit CRC metastasis during cetuximab therapy by addition of platycodin D. |
Pair Name | Platycodin D, Sorafenib | |||
Phytochemical | Platycodin D | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C82.0] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The combination of Platycodin D and sorafenib may exert potent anti-cancer effects specifically via FOXO3a |
Pair Name | Chrysin, Fluorouracil | |||
Phytochemical | Chrysin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Potentiating activities of chrysin in the therapeutic efficacy of 5-fluorouracil in gastric cancer cells |
Pair Name | Liquiritin, Cisplatin | |||
Phytochemical | Liquiritin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Liquiritin induces apoptosis and autophagy in cisplatin (DDP)-resistant gastric cancer cells in vitro and xenograft nude mice in vivo |
Pair Name | Mitocurcumin, Cytarabine | |||
Phytochemical | Mitocurcumin | |||
Drug | Cytarabine | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis. |
Pair Name | Gamma-Tocotrienol, Simvastatin | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Simvastatin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol |
Pair Name | Cordycepin, Cisplatin | |||
Phytochemical | Cordycepin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Our results suggested that Cor in combination with DDP could be an additional therapeutic option for the treatment of DDP-resistant NSCLC. |
Pair Name | Noscapine, Docetaxel | |||
Phytochemical | Noscapine | |||
Drug | Docetaxel | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-D1 | Expression | |
Result | Chemo-sensitizing effect of Nos followed by DTX regime provide a promising chemotherapeutic strategy and its significant role for the treatment of drug-resistant TNBC. |
No. | Title | Href |
---|---|---|
1 | Baicalein enhances the antitumor efficacy of docetaxel on nonsmall cell lung cancer in a β-catenin-dependent manner. Phytother Res. 2020 Jan;34(1):104-117. doi: 10.1002/ptr.6501. | Click |
2 | Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells. J Food Sci. 2021 Jun;86(6):2700-2712. doi: 10.1111/1750-3841.15740. | Click |
3 | Molecular mechanism of ion channel protein TMEM16A regulated by natural product of narirutin for lung cancer adjuvant treatment. Int J Biol Macromol. 2022 Dec 31;223(Pt A):1145-1157. doi: 10.1016/j.ijbiomac.2022.11.123. | Click |
4 | EGCG synergizes the therapeutic effect of irinotecan through enhanced DNA damage in human colorectal cancer cells. J Cell Mol Med. 2021 Aug;25(16):7913-7921. doi: 10.1111/jcmm.16718. | Click |
5 | Crocin synergistically enhances the antiproliferative activity of 5-flurouracil through Wnt/PI3K pathway in a mouse model of colitis-associated colorectal cancer. J Cell Biochem. 2018 Dec;119(12):10250-10261. doi: 10.1002/jcb.27367. | Click |
6 | Phyto-sesquiterpene lactone deoxyelephantopin and cisplatin synergistically suppress lung metastasis of B16 melanoma in mice with reduced nephrotoxicity. Phytomedicine. 2019 Mar 15;56:194-206. doi: 10.1016/j.phymed.2018.11.005. | Click |
7 | Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. | Click |
8 | The combination of Biochanin A and SB590885 potentiates the inhibition of tumour progression in hepatocellular carcinoma. Cancer Cell Int. 2020 Aug 5;20:371. doi: 10.1186/s12935-020-01463-w. | Click |
9 | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. | Click |
10 | Halofuginone Sensitizes Lung Cancer Organoids to Cisplatin via Suppressing PI3K/AKT and MAPK Signaling Pathways. Front Cell Dev Biol. 2021 Nov 24;9:773048. doi: 10.3389/fcell.2021.773048. | Click |
11 | Narciclasine targets STAT3 via distinct mechanisms in tamoxifen-resistant breast cancer cells. Mol Ther Oncolytics. 2022 Jan 3;24:340-354. doi: 10.1016/j.omto.2021.12.025. | Click |
12 | Synergistic effects of the immune checkpoint inhibitor CTLA-4 combined with the growth inhibitor lycorine in a mouse model of renal cell carcinoma. Oncotarget. 2017 Mar 28;8(13):21177-21186. doi: 10.18632/oncotarget.15505. | Click |
13 | Blockade of AMPK-Mediated cAMP-PKA-CREB/ATF1 Signaling Synergizes with Aspirin to Inhibit Hepatocellular Carcinoma. Cancers (Basel). 2021 Apr 6;13(7):1738. doi: 10.3390/cancers13071738. | Click |
14 | Berbamine (BBM), a Natural STAT3 Inhibitor, Synergistically Enhances the Antigrowth and Proapoptotic Effects of Sorafenib on Hepatocellular Carcinoma Cells. ACS Omega. 2020 Sep 18;5(38):24838-24847. doi: 10.1021/acsomega.0c03527. | Click |
15 | Targeting Na+ /K+ -ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma. Br J Pharmacol. 2021 Nov;178(21):4389-4407. doi: 10.1111/bph.15616. | Click |
16 | Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. | Click |
17 | Peiminine serves as an adriamycin chemosensitizer in gastric cancer by modulating the EGFR/FAK pathway. Oncol Rep. 2018 Mar;39(3):1299-1305. doi: 10.3892/or.2018.6184. | Click |
18 | Identification of solamargine as a cisplatin sensitizer through phenotypical screening in cisplatin-resistant NSCLC organoids. Front Pharmacol. 2022 Aug 10;13:802168. doi: 10.3389/fphar.2022.802168. | Click |
19 | Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178. | Click |
20 | Synergistic inhibitory effect of Smo inhibitor jervine and its combination with decitabine can target Hedgehog signaling pathway to inhibit myelodysplastic syndrome cell line. Hematology. 2021 Dec;26(1):518-528. doi: 10.1080/16078454.2021.1950897. | Click |
21 | Sanguinarine Induces Apoptosis Pathway in Multiple Myeloma Cell Lines via Inhibition of the JaK2/STAT3 Signaling. Front Oncol. 2019 Apr 17;9:285. doi: 10.3389/fonc.2019.00285. | Click |
22 | Doxorubicin-sanguinarine nanoparticles: formulation and evaluation of breast cancer cell apoptosis and cell cycle. Drug Dev Ind Pharm. 2024 Jan 5:1-15. doi: 10.1080/03639045.2024.2302557. | Click |
23 | The role of daurisoline treatment in hepatocellular carcinoma: Inhibiting vasculogenic mimicry formation and enhancing sensitivity to sorafenib. Phytomedicine. 2021 Nov;92:153740. doi: 10.1016/j.phymed.2021.153740. | Click |
24 | Scutellaria baicalensis enhances 5-fluorouracil-based chemotherapy via inhibition of proliferative signaling pathways. Cell Commun Signal. 2023 Jun 19;21(1):147. doi: 10.1186/s12964-023-01156-7. | Click |
25 | Puerarin Enhances the Anti-Tumor Effect of Cisplatin on Drug-Resistant A549 Cancer in vivo and in vitro Through Activation of the Wnt Signaling Pathway. Cancer Manag Res. 2020 Jul 24;12:6279-6289. doi: 10.2147/CMAR.S253327. | Click |
26 | Hesperetin Promotes Cisplatin-Induced Apoptosis of Gastric Cancer In Vitro and In Vivo by Upregulating PTEN Expression. Front Pharmacol. 2020 Aug 27;11:1326. doi: 10.3389/fphar.2020.01326. | Click |
27 | Synergistic Anti-proliferative Effects of Metformin and Silibinin Combination on T47D Breast Cancer Cells via hTERT and Cyclin D1 Inhibition. Drug Res (Stuttg). 2018 Dec;68(12):710-716. doi: 10.1055/a-0631-8046. | Click |
28 | Synergistic Growth Inhibitory Effects of Chrysin and Metformin Combination on Breast Cancer Cells through hTERT and Cyclin D1 Suppression. Asian Pac J Cancer Prev. 2018 Apr 25;19(4):977-982. doi: 10.22034/APJCP.2018.19.4.977. | Click |
29 | Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a. Int J Mol Med. 2015 Oct;36(4):957-66. doi: 10.3892/ijmm.2015.2324. | Click |
30 | Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a. Int J Mol Med. 2015 Oct;36(4):957-66. doi: 10.3892/ijmm.2015.2324. | Click |
31 | Morusin enhances the antitumor activity of MAPK pathway inhibitors in BRAF-mutant melanoma by inhibiting the feedback activation of STAT3. Eur J Cancer. 2022 Apr;165:58-70. doi: 10.1016/j.ejca.2022.01.004. | Click |
32 | Anti-proliferative and anti-apoptotic potential effects of epigallocatechin-3-gallate and/or metformin on hepatocellular carcinoma cells: in vitro study. Mol Biol Rep. 2019 Apr;46(2):2039-2047. doi: 10.1007/s11033-019-04653-6. | Click |
33 | Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. | Click |
34 | Combined Parthenolide and Balsalazide Have Enhanced Antitumor Efficacy Through Blockade of NF-κB Activation. Mol Cancer Res. 2017 Feb;15(2):141-151. doi: 10.1158/1541-7786.MCR-16-0101. | Click |
35 | Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195. | Click |
36 | Sorafenib in Combination with Betulinic Acid Synergistically Induces Cell Cycle Arrest and Inhibits Clonogenic Activity in Pancreatic Ductal Adenocarcinoma Cells. Int J Mol Sci. 2018 Oct 19;19(10):3234. doi: 10.3390/ijms19103234. | Click |
37 | Synergism of ursolic acid and cisplatin promotes apoptosis and enhances growth inhibition of cervical cancer cells via suppressing NF-κB p65. Oncotarget. 2017 Oct 30;8(57):97416-97427. doi: 10.18632/oncotarget.22133. | Click |
38 | Inhibition of colorectal cancer tumorigenesis by ursolic acid and doxorubicin is mediated by targeting the Akt signaling pathway and activating the Hippo signaling pathway. Mol Med Rep. 2023 Jan;27(1):11. doi: 10.3892/mmr.2022.12898. | Click |
39 | Maslinic acid potentiates the antitumor activities of gemcitabine in vitro and in vivo by inhibiting NF-κB-mediated survival signaling pathways in human gallbladder cancer cells. Oncol Rep. 2015 Apr;33(4):1683-90. doi: 10.3892/or.2015.3755. | Click |
40 | Synergistic antitumor effect of β-elemene and etoposide is mediated via induction of cell apoptosis and cell cycle arrest in non-small cell lung carcinoma cells. Mol Med Rep. 2011 Nov-Dec;4(6):1189-93. doi: 10.3892/mmr.2011.537. | Click |
41 | Synergistic Anti-Breast-Cancer Effects of Combined Treatment With Oleuropein and Doxorubicin In Vivo. Altern Ther Health Med. 2019 May;25(3):17-24. | Click |
42 | Chemopreventive effect of α-hederin/carboplatin combination against experimental colon hyperplasia and impact on JNK signaling. Toxicol Mech Methods. 2021 Feb;31(2):138-149. doi: 10.1080/15376516.2020.1849483. | Click |
43 | Shikonin enhances sensitization of gefitinib against wild-type EGFR non-small cell lung cancer via inhibition PKM2/stat3/cyclinD1 signal pathway. Life Sci. 2018 Jul 1;204:71-77. doi: 10.1016/j.lfs.2018.05.012. | Click |
44 | Shikonin suppresses tumor growth and synergizes with gemcitabine in a pancreatic cancer xenograft model: Involvement of NF-κB signaling pathway. Biochem Pharmacol. 2014 Apr 1;88(3):322-33. doi: 10.1016/j.bcp.2014.01.041. | Click |
45 | Thymoquinone Augments Cyclophosphamide-Mediated Inhibition of Cell Proliferation in Breast Cancer Cells. Asian Pac J Cancer Prev. 2019 Apr 29;20(4):1153-1160. doi: 10.31557/APJCP.2019.20.4.1153. | Click |
46 | The effect of thymoquinone and propranolol combination on epidermoid laryngeal carcinoma cell. Eur Arch Otorhinolaryngol. 2023 Jun;280(6):2849-2858. doi: 10.1007/s00405-023-07825-0. | Click |
47 | Combined effect of honokiol and rosiglitazone on cell growth inhibition through enhanced G0/G1 phase arrest in hepatoma cells. J Chin Med Assoc. 2016 Aug;79(8):415-21. doi: 10.1016/j.jcma.2016.03.003. | Click |
48 | Simvastatin in combination with bergamottin potentiates TNF-induced apoptosis through modulation of NF-κB signalling pathway in human chronic myelogenous leukaemia. Pharm Biol. 2016 Oct;54(10):2050-60. doi: 10.3109/13880209.2016.1141221. | Click |
49 | Decursin and Doxorubicin Are in Synergy for the Induction of Apoptosis via STAT3 and/or mTOR Pathways in Human Multiple Myeloma Cells. Evid Based Complement Alternat Med. 2013;2013:506324. doi: 10.1155/2013/506324. | Click |
50 | Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway. Am J Transl Res. 2019 Jun 15;11(6):3816-3824. | Click |
51 | Tenacissoside G synergistically potentiates inhibitory effects of 5-fluorouracil to human colorectal cancer. Phytomedicine. 2021 Jun;86:153553. doi: 10.1016/j.phymed.2021.153553. | Click |
52 | Pterostilbene enhances sorafenib's anticancer effects on gastric adenocarcinoma. J Cell Mol Med. 2020 Nov;24(21):12525-12536. doi: 10.1111/jcmm.15795. | Click |
53 | Synergistic inhibitory effects of the oxyresveratrol and dacarbazine combination against melanoma cells. Oncol Lett. 2021 Sep;22(3):667. doi: 10.3892/ol.2021.12928. | Click |
54 | Icariin-mediated inhibition of NF-κB activity enhances the in vitro and in vivo antitumour effect of 5-fluorouracil in colorectal cancer. Cell Biochem Biophys. 2014 Jul;69(3):523-30. doi: 10.1007/s12013-014-9827-5. | Click |
55 | [6]-Gingerol enhances the cisplatin sensitivity of gastric cancer cells through inhibition of proliferation and invasion via PI3K/AKT signaling pathway. Phytother Res. 2019 May;33(5):1353-1362. doi: 10.1002/ptr.6325. | Click |
56 | Enhancing Tamoxifen Therapy with α-Mangostin: Synergistic Antiproliferative Effects on Breast Cancer Cells and Potential Reduced Endometrial Impact. Pharmaceuticals (Basel). 2023 Nov 8;16(11):1576. doi: 10.3390/ph16111576. | Click |
57 | Influence of 6-shogaol potentiated on 5-fluorouracil treatment of liver cancer by promoting apoptosis and cell cycle arrest by regulating AKT/mTOR/MRP1 signalling. Chin J Nat Med. 2022 May;20(5):352-363. doi: 10.1016/S1875-5364(22)60174-2. | Click |
58 | Antitumor activity of gemcitabine can be potentiated in pancreatic cancer through modulation of TLR4/NF-κB signaling by 6-shogaol. AAPS J. 2014 Mar;16(2):246-57. doi: 10.1208/s12248-013-9558-3. | Click |
59 | The natural isoflavone Biochanin-A synergizes 5-fluorouracil anticancer activity in vitro and in vivo in Ehrlich solid-phase carcinoma model. Phytother Res. 2022 Mar;36(3):1310-1325. doi: 10.1002/ptr.7388. | Click |
60 | Gossypol sensitizes the antitumor activity of 5-FU through down-regulation of thymidylate synthase in human colon carcinoma cells. Cancer Chemother Pharmacol. 2015 Sep;76(3):575-86. doi: 10.1007/s00280-015-2749-0. | Click |
61 | Combined Application of Salinomycin and ATRA Induces Apoptosis and Differentiation of Acute Myeloid Leukemia Cells by Inhibiting WNT/β-Catenin Pathway. Anticancer Agents Med Chem. 2023;23(9):1074-1084. doi: 10.2174/1871520623666230110121629. | Click |
62 | Combination of methylselenocysteine with tamoxifen inhibits MCF-7 breast cancer xenografts in nude mice through elevated apoptosis and reduced angiogenesis. Breast Cancer Res Treat. 2009 Nov;118(1):33-43. doi: 10.1007/s10549-008-0216-x. | Click |
63 | Pro-oxidant activity of sulforaphane and cisplatin potentiates apoptosis and simultaneously promotes autophagy in malignant mesothelioma cells. Mol Med Rep. 2017 Aug;16(2):2133-2141. doi: 10.3892/mmr.2017.6789. | Click |
64 | Ginger extract adjuvant to doxorubicin in mammary carcinoma: study of some molecular mechanisms. Eur J Nutr. 2018 Apr;57(3):981-989. doi: 10.1007/s00394-017-1382-6. | Click |
65 | δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis. Cell Prolif. 2021 Nov;54(11):e13111. doi: 10.1111/cpr.13111. | Click |
66 | First evidence that γ-tocotrienol inhibits the growth of human gastric cancer and chemosensitizes it to capecitabine in a xenograft mouse model through the modulation of NF-κB pathway. Clin Cancer Res. 2012 Apr 15;18(8):2220-9. doi: 10.1158/1078-0432.CCR-11-2470. | Click |
67 | {Gamma}-tocotrienol inhibits pancreatic tumors and sensitizes them to gemcitabine treatment by modulating the inflammatory microenvironment. Cancer Res. 2010 Nov 1;70(21):8695-705. doi: 10.1158/0008-5472.CAN-10-2318. Epub 2010 Sep 23. | Click |
68 | γ-Tocotrienol suppresses growth and sensitises human colorectal tumours to capecitabine in a nude mouse xenograft model by down-regulating multiple molecules. Br J Cancer. 2016 Sep 27;115(7):814-24. doi: 10.1038/bjc.2016.257. | Click |
69 | Antitumor effects of erlotinib in combination with berberine in A431 cells. BMC Pharmacol Toxicol. 2023 May 11;24(1):29. doi: 10.1186/s40360-023-00661-2. | Click |
70 | Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway. Molecules. 2021 Mar 17;26(6):1666. doi: 10.3390/molecules26061666. | Click |
71 | Evening Primrose Oil Enhances Tamoxifen's Anticancer Activity against Breast Cancer Cells by Inducing Apoptosis, Inhibiting Angiogenesis, and Arresting the Cell Cycle. Molecules. 2022 Apr 7;27(8):2391. doi: 10.3390/molecules27082391 | Click |
72 | Anticancer activity of Noscapine, an opioid alkaloid in combination with Cisplatin in human non-small cell lung cancer. Lung Cancer. 2011 Mar;71(3):271-82. doi: 10.1016/j.lungcan.2010.06.002. | Click |
73 | Enhanced anticancer activity of gemcitabine in combination with noscapine via antiangiogenic and apoptotic pathway against non-small cell lung cancer. PLoS One. 2011;6(11):e27394. doi: 10.1371/journal.pone.0027394. | Click |
74 | Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells. Biomed Pharmacother. 2023 Jan;157:114039. doi: 10.1016/j.biopha.2022.114039. | Click |
75 | Platycodin D represses β-catenin to suppress metastasis of cetuximab-treated KRAS wild-type colorectal cancer cells. Clin Exp Metastasis. 2023 Aug;40(4):339-356. doi: 10.1007/s10585-023-10218-6. | Click |
76 | Combined Anti-Cancer Effects of Platycodin D and Sorafenib on Androgen-Independent and PTEN-Deficient Prostate Cancer. Front Oncol. 2021 May 7;11:648985. doi: 10.3389/fonc.2021.648985. | Click |
77 | Potentiating activities of chrysin in the therapeutic efficacy of 5-fluorouracil in gastric cancer cells. Oncol Lett. 2021 Jan;21(1):24. doi: 10.3892/ol.2020.12285. | Click |
78 | Liquiritin induces apoptosis and autophagy in cisplatin (DDP)-resistant gastric cancer cells in vitro and xenograft nude mice in vivo. Int J Oncol. 2017 Nov;51(5):1383-1394. doi: 10.3892/ijo.2017.4134. | Click |
79 | Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004 | Click |
80 | Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol. Cancer Lett. 2013 Jan 28;328(2):285-96. doi: 10.1016/j.canlet.2012.10.003. | Click |
81 | Cordycepin Reverses Cisplatin Resistance in Non-small Cell Lung Cancer by Activating AMPK and Inhibiting AKT Signaling Pathway. Front Cell Dev Biol. 2021 Jan 15;8:609285. doi: 10.3389/fcell.2020.609285. | Click |
82 | Reversal of drug-resistance by noscapine chemo-sensitization in docetaxel resistant triple negative breast cancer. Sci Rep. 2017 Nov 20;7(1):15824. doi: 10.1038/s41598-017-15531-1. | Click |