Name | Mitogen-activated protein kinase 1 | ||
UniProt ID | MK01_HUMAN | ||
Gene Name | MAPK1 | ||
Gene ID | 5594 | ||
Synonyms |
MAPK1, ERK, ERK-2, ERK2, ERT1, MAPK2, NS13, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk, p42-MAPK
|
||
Sequence |
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS |
||
Pathway Map | MAP LINK | ||
T.C. Number | 8.A.216.1.1; 9.A.14.8.3 | ||
KEGG ID | hsa5594 | ||
TTD ID | T58970 | ||
Pfam | PF00069; PF01633; PF01636; PF03109; PF06293; PF07714; PF12330; PF13095 |
Pair Name | Narirutin, Cisplatin | |||
Phytochemical Name | Narirutin | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Based on the significant anticancer effect and high biosafety, naringin has great potential as a functional food in the adjuvant treatment of lung cancer. |
Pair Name | Trifolirhizin, Sorafenib | |||
Phytochemical Name | Trifolirhizin | |||
Anticancer drug Name | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | Synergistic anticancer effect of flavonoids from Sophora alopecuroides with Sorafenib against hepatocellular carcinoma |
Pair Name | Curcumin, Fluorouracil | |||
Phytochemical Name | Curcumin | |||
Anticancer drug Name | Fluorouracil | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | We conclude that curcumin promotes chemosensitivity of CRC cells to 5-FU by downregulating L1 expression. Our findings provide experimental evidence for the synergism between curcumin and 5-FU, which can be utilized in clinical applications for reducing the toxicity and adverse effects of 5-FU. |
Pair Name | Paeonol, Epirubicin | |||
Phytochemical Name | Paeonol | |||
Anticancer drug Name | Epirubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | These findings suggest that combination of Paeonol and Epirubicin is potentially applicable for breast cancer treatment. |
Pair Name | Corilagin, Paclitaxel | |||
Phytochemical Name | Corilagin | |||
Anticancer drug Name | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Our observations indicate that corilagin sensitized epithelial ovarian cancer cells to paclitaxel and carboplatin treatment by primarily inhibiting Snail-glycolysis pathways. Corilagin is a herbal medicine with low toxic effects to normal cells, particularly hepatoprotective, and may be an ideal complimentary medicine when combined with highly toxic chemotherapeutic agents. |
Pair Name | Biochanin A, SB590885 | |||
Phytochemical Name | Biochanin A | |||
Anticancer drug Name | SB590885 | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | The results identify an effective combination therapy for the most aggressive form of HCC and provide the possibility of therapeutic improvement for patients with advanced HCC. |
Pair Name | Umbelliferone, Cisplatin | |||
Phytochemical Name | Umbelliferone | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Combination of 7-hydroxycoumarin in a platinum(IV) complex derived from cisplatin enhanced cytotoxicity with multiple mechanisms of action. |
Pair Name | Halofuginone, Cisplatin | |||
Phytochemical | Halofuginone | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Halofuginone Sensitizes Lung Cancer Organoids to Cisplatin via Suppressing PI3K/AKT and MAPK Signaling Pathways |
Pair Name | Evodiamine, Doxorubicin | |||
Phytochemical | Evodiamine | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Our results indicated that EVO enhanced the apoptotic action of DOX by inhibiting the Ras/MEK/ERK cascade and the expression of IAPs without inhibiting the expression and activity of P-glycoprotein (P-gp). Taken together, our data indicate that EVO, a natural product, may be useful applied alone or in combination with DOX for the treatment of resistant breast cancer. |
Pair Name | Lycorine, Bortezomib | |||
Phytochemical | Lycorine | |||
Drug | Bortezomib | |||
Disease Info | [ICD-11: 2A83.1] | Multiple myeloma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | We observed higher HMGB1 expression in bortezomib resistant cells and the combination of bortezomib plus lycorine was highly efficient in vitro and in vivo myeloma models as well as in re-sensitizing resistant cells to bortezomib. These observations indicate lycorine as an effective autophagy inhibitor and reveal that lycorine alone or in combination with bortezomib is a potential therapeutic strategy. |
Pair Name | Trigonelline, Cisplatin | |||
Phytochemical | Trigonelline | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Our study demonstrated that Trigonelline blocks Nrf2 activation and its nuclear translocation via inhibition of EGFR signalling pathway. It has improved responsiveness of NSCLC cells for Cisplatin and Etoposide and could be a promising choice for lung cancer therapy. Toxicol In Vitro. 2021 Feb;70:105038. doi: 10.1016/j.tiv.2020.105038. |
Pair Name | Berbamine, Sorafenib | |||
Phytochemical | Berbamine | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Targeting Na+/K+-ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma |
Pair Name | Berbamine, Arcyriaflavin A | |||
Phytochemical | Berbamine | |||
Drug | Arcyriaflavin A | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells. |
Pair Name | (S)-10-Hydroxycamptothecin, Crizotinib | |||
Phytochemical | (S)-10-Hydroxycamptothecin | |||
Drug | Crizotinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells |
Pair Name | Daurinoline, Sorafenib | |||
Phytochemical | Daurinoline | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Our study provides insights into the molecular mechanisms underlying DS-induced inhibition of VM, which may facilitate the development of a novel clinical anti-HCC drug. Moreover, our findings suggest that the combination of DS and sorafenib constitutes a potential therapeutic strategy for HCC. |
Pair Name | Luteolin, Oxaliplatin | |||
Phytochemical | Luteolin | |||
Drug | Oxaliplatin | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis |
Pair Name | Kaempferol, Erlotinib | |||
Phytochemical | Kaempferol | |||
Drug | Erlotinib | |||
Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | These data imply that KAE may be a valid therapeutic candidate to potentiate PC cell sensitivity to ERL via inhibiting PI3K/AKT and EGFR signaling. |
Pair Name | Baicalein, Cisplatin | |||
Phytochemical | Baicalein | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Treatment with baicalein improved the sensitivity of ovarian cancer cells to cisplatin and inhibited cell proliferation, metastasis and tumor growth |
Pair Name | Apigenin, Doxorubicin | |||
Phytochemical | Apigenin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C82.0] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells |
Pair Name | Nobiletin, Bicalutamide | |||
Phytochemical | Nobiletin | |||
Drug | Bicalutamide | |||
Disease Info | [ICD-11: 2C82.0] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | NBT and BCT combination reduced key cellular signaling regulators including: p-Erk/Erk, p-STAT3/STAT3 and NF-κB. Overall, these results suggest that NBT combination with BCT may be an effective treatment for prostate cancer. |
Pair Name | Tangeretin, Metformin | |||
Phytochemical | Tangeretin | |||
Drug | Metformin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | The current work underscores the importance of metformin as an ERMA in tackling breast cancer and as a novel approach to boost its anticancer activity via a synergistic combination with tangeretin. |
Pair Name | Daidzein, Gefitinib | |||
Phytochemical | Daidzein | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | Daidzein Synergizes with Gefitinib to Induce ROS/JNK/c-Jun Activation and Inhibit EGFR-STAT/AKT/ERK Pathways to enhance Lung Adenocarcinoma cells chemosensitivity |
Pair Name | Amentoflavone, Sorafenib | |||
Phytochemical | Amentoflavone | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Amentoflavone may sensitize OS to sorafenib treatment by inducing intrinsic and extrinsic apoptosis and inhibiting ERK/NF-κB signaling transduction. |
Pair Name | Silibinin, Sorafenib | |||
Phytochemical | Silibinin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | These results suggested that silibinin improved the efficacy of sorafenib in HCC therapy, indicating a clinical promising therapeutic strategy for HCC patients. |
Pair Name | Morusin, MAPK pathway inhibitors | |||
Phytochemical | Morusin | |||
Drug | MAPK pathway inhibitors | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Our results suggested that the combination of morusin and MAPK pathway inhibitors may be a more effective treatment strategy for BRAF-mutant melanoma than MAPK pathway inhibitors alone. |
Pair Name | Licochalcone B, TNF-related apoptosis inducing ligand | |||
Phytochemical | Licochalcone B | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC. |
Pair Name | Quercetin, Doxorubicin | |||
Phytochemical | Quercetin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Que could attenuate AC-induced cardiotoxicity by inhibiting ROS accumulation and activating ERK1/2 pathway in cardiomyocytes, but interestingly, Que could enhance the antitumor activity of AC by inhibiting ROS accumulation and ERK1/2 pathway in TNBC cells. In addition,in vivo studies further confirmed that Que could enhance the chemotherapeutic effect of AC against TNBC while it reduced the injury of cardiotoxicity induced by AC |
Pair Name | Resveratrol, Temozolomide | |||
Phytochemical | Resveratrol | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2F7Z] | Glioma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Activity | |
Result | TMZ in combination with resveratrol remarkably increased reactive oxygen species (ROS) production, which serves as an upstream signal for AMP-activated protein kinase (AMPK) activation. Subsequently, activated AMPK inhibited mTOR signaling and downregulated antiapoptosis protein Bcl-2, which was contributed to the additive antiproliferation effects of combination treatment. In an orthotopic xenograft model of GBM, TMZ plus resveratrol treatment significantly reduced the volume of tumor, which was confirmed by decreased expression of Ki-67, a marker of proliferation index |
Pair Name | Oridonin, Fluorouracil | |||
Phytochemical | Oridonin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C90.Z] | Renal carcinoma | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Activity | |
Result | Oridonin enhances the cytotoxicity of 5-FU in renal cancer cells partially through inducing necroptosis, providing evidence of using necroptosis inducers in combination with chemotherapeutic agents for cancer treatment. |
Pair Name | Oleanolic Acid, Gemcitabine | |||
Phytochemical | Oleanolic Acid | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | We found an interesting finding that the 73-03 in combination with GCB can improve GCB efficacy and decrease PCa resistance, which induced apoptosis and mitochondrial damage through epigenetic inhibition of SPINK1 transcription by miR-421 up-regulation. This was the first study that used OA derivatives on GCB-resistant PCa cells, so this combined strategy warrants further investigation. |
Pair Name | Ginsenoside Rg1, Doxorubicin | |||
Phytochemical | Ginsenoside Rg1 | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | The present results support the chemosensitizing property of ginsenoside Rg1 in triple-negative breast cancer cell lines. |
Pair Name | Costunolide, Osimertinib | |||
Phytochemical | Costunolide | |||
Drug | Osimertinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | The combination of osimertinib and costunolide showed synergistic or additive inhibitory effects on tumor growth in osimertinib-resistant cell lines and PDX model. Hence, this study highlights a potential therapeutic strategy for osimertinib-resistant patients through targeting of MEK1 and AKT1/2 by costunolide. |
Pair Name | Beta-Elemene, Fluorouracil | |||
Phytochemical | Beta-Elemene | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | The conclusion obtained, considering that the results suggest that the combination may be important specifically in the treatment of TNBC. |
Pair Name | Ginkgolide B, Cisplatin | |||
Phytochemical | Ginkgolide B | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B66.Z] | Oral cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | These results suggest that PAFR is a therapeutic target for modulating CDDP sensitivity in OSCC cells. Thus, GB may be a novel drug that could enhance combination chemotherapy with CDDP for OSCC patients. |
Pair Name | Resveratrol, Temozolomide | |||
Phytochemical | Resveratrol | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2F7Z] | Glioma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | TMZ-induced ROS/ERK-mediated autophagy protected glioma cells from apoptosis, and the combination of resveratrol with TMZ could improve the efficacy of chemotherapy for brain tumors. |
Pair Name | Gedunin, Epalrestat | |||
Phytochemical | Gedunin | |||
Drug | Epalrestat | |||
Disease Info | [ICD-11: 2B66.Z] | Oral cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | Our results provide compelling evidence that the combination of gedunin and epalrestat modulates expression of key oncogenic signalling kinases and transcription factors primarily by influencing phosphorylation and subcellular localisation. AR inhibitors such as gedunin and epalrestat are novel candidate agents for cancer prevention and therapy. |
Pair Name | Emodin, Cytarabine | |||
Phytochemical | Emodin | |||
Drug | Cytarabine | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Emodin and its combination with Ara-C may be considered a promising therapeutic approach in AML and worthy of further investigation. |
Pair Name | Cryptotanshinone, Trifluridine | |||
Phytochemical | Cryptotanshinone | |||
Drug | Trifluridine | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | FTD combined with CTS has a synergistic anti-gastric cancer effect as shown by in vitro and in vivo experiments, and the combined treatment of FTD and CTS will be a promising treatment option for advanced gastric cancer. |
Pair Name | Honokiol, Oxaliplatin | |||
Phytochemical | Honokiol | |||
Drug | Oxaliplatin | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | This combination allows a reduction in oxaliplatin dose, and thereby reduces its adverse effects. It may also enhance the chemotherapeutic effect of oxaliplatin for this disease. |
Pair Name | Chlorogenic acid, Doxorubicin | |||
Phytochemical | Chlorogenic acid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | These findings firstly propose CGA as a promising chemosensitizer and cardioprotective agent in OS therapy, suggesting the p44/42 MAPK pathway as relevantly involved in CGA-mediated Doxo susceptibility. |
Pair Name | Chlorogenic acid, Fluorouracil | |||
Phytochemical | Chlorogenic acid | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | CGA sensitizes hepatocellular carcinoma cells to 5-FU treatment by the suppression of ERK activation through the overproduction of ROS. CGA has shown potential as a chemosensitizer of 5-FU chemotherapy in hepatocellular carcinoma. |
Pair Name | Caffeic acid, Paclitaxel | |||
Phytochemical | Caffeic acid | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Our results indicated that CA inhibited NSCLC H1299 cell growth by inducing apoptosis and CA and PTX combined produced a synergistic anti-cancer effect in H1299 cells. |
Pair Name | Decursin, Doxorubicin | |||
Phytochemical | Decursin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2A83.1] | Multiple myeloma | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | The combination treatment of decursin and doxorubicin can enhance apoptotic activity via mTOR and/or STAT3 signaling pathway in multiple myeloma cells. |
Pair Name | Magnolin, B-RAF Inhibitors | |||
Phytochemical | Magnolin | |||
Drug | B-RAF Inhibitors | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway |
Pair Name | Ursodiol, Sorafenib | |||
Phytochemical | Ursodiol | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | The present findings may represent a promising therapeutic strategy for patients with advanced hepatocellular carcinoma. |
Pair Name | Pterostilbene, Fluorouracil | |||
Phytochemical | Pterostilbene | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | These results provide a rationale for novel combination treatment strategies, especially for patients with 5-FU-resistant tumors expressing ER-β protein. |
Pair Name | Resveratrol, Sorafenib | |||
Phytochemical | Resveratrol | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C90.0] | Renal cell carcinoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | PEGylated resveratrol combined with sorafenib can achieve synergistic anti-RCC activity, and the mechanism may be related to the inhibition of Akt/mTOR/p70S6k-4EBP-1 and c-Raf7MEK/ERK signaling pathways. |
Pair Name | Curcumin, Vemurafenib | |||
Phytochemical | Curcumin | |||
Drug | Vemurafenib | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Curcumin suppresses cell proliferation and triggers apoptosis in vemurafenib-resistant melanoma cells by downregulating the EGFR signaling pathway |
Pair Name | Curcumin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Curcumin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Combined treatment with curcumin and carboplatin inhibited tumor cell growth, migration, and invasion compared with either drug alone. The synergistic antitumor activity of curcumin combined with carboplatin is mediated by multiple mechanisms involving suppression of NF-kappaB via inhibition of the Akt/IKKalpha pathway and enhanced ERK1/2 activity |
Pair Name | Acteoside, Temozolomide | |||
Phytochemical | Acteoside | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | It was also determined that TMZ + acteoside induced apoptosis and autophagy through the mitogen‑activated protein kinase signaling pathway. These findings suggest that acteoside has beneficial effects on TMZ‑based glioblastoma therapy. |
Pair Name | alpha-Mangostin, Sorafenib | |||
Phytochemical | alpha-Mangostin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Our results highlight the synergistic effect of the combination of sorafenib and α-Mangostin, which indicates a potential treatment for advanced HCC for patients that are not sensitive to sorafenib therapy. |
Pair Name | alpha-Mangostin, Sorafenib | |||
Phytochemical | alpha-Mangostin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | These data demonstrate an unanticipated synergy between α-Mangostin and sorafenib, with mechanistic actions that convert a known safe natural product to a candidate combinatorial therapeutic agent. |
Pair Name | Gossypol, Gefitinib | |||
Phytochemical | Gossypol | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | AT-101 enhances gefitinib sensitivity in non-small cell lung cancer with EGFR T790M mutations. |
Pair Name | Oxidized tea polyphenol, Nimotuzumab | |||
Phytochemical | Oxidized tea polyphenol | |||
Drug | Nimotuzumab | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | OTP-3 can also serve as an effective therapeutic agent in NSCLC where it can augment the effects of nimotuzumab, a valuable property for combination agents. |
Pair Name | 10-Gingerol, Paclitaxel | |||
Phytochemical | 10-Gingerol | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | This data suggests that 10-G may be used as a new chemotherapeutic synergist in combination with paclitaxel to enhance anticancer activity. The potential value of ADRB2 as a target for improving chemotherapy sensitivity was also emphasized. |
Pair Name | Gambogenic acid, Erlotinib | |||
Phytochemical | Gambogenic acid | |||
Drug | Erlotinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Our findings provide preclinical evidence for using GNA as an FGFR signaling pathway inhibitor to overcome erlotinib resistance in NSCLC treatment or to enhance erlotinib efficacy when used as a combined administration. |
Pair Name | Gambogic Acid, Gemcitabine | |||
Phytochemical | Gambogic Acid | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | These results demonstrate that gambogic acid sensitizes pancreatic cancer cells to gemcitabine in vitro and in vivo by inhibiting the activation of the ERK/E2F1/RRM2 signaling pathway. The results also indicate that gambogic acid treatment combined with gemcitabine might be a promising chemotherapy strategy for pancreatic cancer. |
Pair Name | Gambogic Acid, Cisplatin | |||
Phytochemical | Gambogic Acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | Gambogic acid sensitises lung cancer cells to CDDP in vitro and in vivo in NSCLC through inactivation of NF-κB and MAPK/HO-1 signalling pathways, providing a rationale for the combined use of CDDP and GA in lung cancer chemotherapy. |
Pair Name | Chebulagic acid, Doxorubicin | |||
Phytochemical | Chebulagic acid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Activity | |
Result | The present study shows the efficacy of CA to overcome MDR-1 mediated drug resistance in HepG2 cells through COX-2 dependant modulation of MDR-1. |
Pair Name | Usnic acid, Sorafenib | |||
Phytochemical | Usnic acid | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | Investigation of new treatment option for hepatocellular carcinoma: a combination of sorafenib with usnic acid |
Pair Name | Retinoic acid, PI3K inhibitor | |||
Phytochemical | All-trans-retinoic acid | |||
Drug | PI3K inhibitor | |||
Disease Info | [ICD-11: 2D4Y] | Adenoid cystic carcinoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Expression | |
Result | We displayed the morphologically and genetic featured PDXs which recapitulated the heterogeneity of original ACC tumors, indicating that the models could be used as a platform for drug screening for therapy response. The feasibility of combination treatment approaches for dual targets were confirmed, providing new regimens for personalized therapies in ACC. |
Pair Name | All-trans retinoic acid, Midostaurin | |||
Phytochemical | All-trans-retinoic acid | |||
Drug | Midostaurin | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Combination of midostaurin and ATRA exerts dose-dependent dual effects on acute myeloid leukemia cells with wild type FLT3 |
Pair Name | Myriocin, Cisplatin | |||
Phytochemical | Myriocin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | We suggest that myriocin is a novel potent anti-cancer agent that dually targets both VEGFR2 in ECs and IκBα in cancer cells, and exerts more pronounced anti-tumor effects than with either kinase being inhibited alone. |
Pair Name | Sulforaphane, Lapatinib | |||
Phytochemical | Sulforaphane | |||
Drug | Lapatinib | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Therapeutic Mechanism of Lapatinib Combined with Sulforaphane on Gastric Cancer |
Pair Name | Sulforaphane, Gefitinib | |||
Phytochemical | Sulforaphane | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | SFN overcame T790M-mediated gefitinib resistance in vitro through EMT. Thus, a combination of gefitinib and SFN may be a beneficial treatment strategy for lung cancer patients with acquired resistance due to T790M mutation. |
Pair Name | Sulforaphene, Carboplatin | |||
Phytochemical | Sulforaphene | |||
Drug | Carboplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | This study demonstrates that the duel character of this combination therapy may be an effective replacement for conventional therapy alone against NSCLC. |
Pair Name | Sulforaphene, Photodynamic therapy | |||
Phytochemical | Sulforaphene | |||
Drug | Photodynamic therapy | |||
Disease Info | [ICD-11: 2D10.Z] | Thyroid cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Our work designates sulforaphene as a unique natural enhancer of efficacy with PDT against anaplastic thyroid cancer. |
Pair Name | Berberine, Erlotinib | |||
Phytochemical | Berberine | |||
Drug | Erlotinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Our data supported use of BBR in combination with erlotinib as a novel strategy for treatment of patients with EGFR positive tumors. |
Pair Name | Berberine, Cisplatin | |||
Phytochemical | Berberine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway |
Pair Name | Periplocin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Periplocin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway |
Pair Name | Platycodin D, Venetoclax | |||
Phytochemical | Platycodin D | |||
Drug | Venetoclax | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Platycodin D may be a potent therapeutic candidate for the treatment of AML |
Pair Name | Scutellarin, Cisplatin | |||
Phytochemical | Scutellarin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | This study identifies the unique role of scutellarin in reversing cisplatin resistance through apoptosis and autophagy, and suggests that combined cisplatin and scutellarin might be a novel therapeutic strategy for patients with NSCLC. |
Pair Name | Epigallocatechin gallate, Gefitinib | |||
Phytochemical | Epigallocatechin gallate | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | EGCG overcomes Gef resistance by inhibiting autophagy and augmenting cell death through targeting ERK pathway in NSCLC. Gef and EGCG combination therapy may be an effective strategy to overcome acquired resistance in NSCLC. |
Pair Name | Epigallocatechin gallate, Osimertinib | |||
Phytochemical | Epigallocatechin gallate | |||
Drug | Osimertinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | The combined use of EGFR-TKIs and EGCG significantly reversed the Warburg effect by suppressing glycolysis while boosting mitochondrial respiration, which was accompanied by increased cellular ROS and decreased lactate secretion. The combination effectively activated the AMPK pathway while inhibited both ERK/MAPK and AKT/mTOR pathways, leading to cell cycle arrest and apoptosis, particularly in drug-resistant NSCLC cells. The in vivo results obtained from mouse tumor xenograft model confirmed that EGCG effectively overcame osimertinib resistance. |
Pair Name | Honokiol, Paclitaxel | |||
Phytochemical | Honokiol | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction |
Pair Name | Rosmarinic acid, Cisplatin | |||
Phytochemical | Rosmarinic acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Activity | |
Result | Rosmarinic acid reverses non-small cell lung cancer cisplatin resistance by activating the MAPK signaling pathway |
Pair Name | Oleanolic Acid, Cisplatin | |||
Phytochemical | Oleanolic Acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | OLO-2 treatment also exhibited up to 4.6-fold selectivity against human lung adenocarcinoma cells. Taken together, the results of the present study shed light on the drug resistance-reversing effects of OLO-2 in lung cancer cells. |
Pair Name | Shogaol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Shogaol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | This study gives rise to the possibility of applying shogaol as an antitumor agent that can be used for the purpose of combination treatment with TRAIL in TRAIL-resistant colon tumor therapy. |
Pair Name | Platycodin D, Histone deacetylase inhibitor | |||
Phytochemical | Platycodin D | |||
Drug | Histone deacetylase inhibitor | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Platycodin D reverses histone deacetylase inhibitor resistance in hepatocellular carcinoma cells by repressing ERK1/2-mediated cofilin-1 phosphorylation |
Pair Name | Shikonin, Gefitinib | |||
Phytochemical | Shikonin | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Mitogen-activated protein kinase 1 | Phosphorylation | |
Result | Shikonin-induced cell apoptosis is closely associated with ROS elevation in the cells. These findings indicate that Shikonin can be an effective small molecule treating gefitinib-resistant NSCLC. |
No. | Title | Href |
---|---|---|
1 | Molecular mechanism of ion channel protein TMEM16A regulated by natural product of narirutin for lung cancer adjuvant treatment. Int J Biol Macromol. 2022 Dec 31;223(Pt A):1145-1157. doi: 10.1016/j.ijbiomac.2022.11.123. | Click |
2 | Synergistic anticancer effect of flavonoids from Sophora alopecuroides with Sorafenib against hepatocellular carcinoma. Phytother Res. 2023 Feb;37(2):592-610. doi: 10.1002/ptr.7637. | Click |
3 | Low curcumin concentration enhances the anticancer effect of 5-fluorouracil against colorectal cancer. Phytomedicine. 2021 May;85:153547. doi: 10.1016/j.phymed.2021.153547. | Click |
4 | Enhanced antitumor activity and attenuated cardiotoxicity of Epirubicin combined with Paeonol against breast cancer. Tumour Biol. 2016 Sep;37(9):12301-12313. doi: 10.1007/s13277-016-5088-9. | Click |
5 | Corilagin sensitizes epithelial ovarian cancer to chemotherapy by inhibiting Snail‑glycolysis pathways. Oncol Rep. 2017 Oct;38(4):2464-2470. doi: 10.3892/or.2017.5886. | Click |
6 | The combination of Biochanin A and SB590885 potentiates the inhibition of tumour progression in hepatocellular carcinoma. Cancer Cell Int. 2020 Aug 5;20:371. doi: 10.1186/s12935-020-01463-w. | Click |
7 | Combination of 7-hydroxycoumarin in a platinum(IV) complex derived from cisplatin enhanced cytotoxicity with multiple mechanisms of action. J Inorg Biochem. 2018 Sep;186:17-23. doi: 10.1016/j.jinorgbio.2018.05.015. | Click |
8 | Halofuginone Sensitizes Lung Cancer Organoids to Cisplatin via Suppressing PI3K/AKT and MAPK Signaling Pathways. Front Cell Dev Biol. 2021 Nov 24;9:773048. doi: 10.3389/fcell.2021.773048. | Click |
9 | Evodiamine synergizes with doxorubicin in the treatment of chemoresistant human breast cancer without inhibiting P-glycoprotein. PLoS One. 2014 May 15;9(5):e97512. doi: 10.1371/journal.pone.0097512. | Click |
10 | Lycorine Downregulates HMGB1 to Inhibit Autophagy and Enhances Bortezomib Activity in Multiple Myeloma. Theranostics. 2016 Sep 24;6(12):2209-2224. doi: 10.7150/thno.15584. | Click |
11 | Trigonelline inhibits Nrf2 via EGFR signalling pathway and augments efficacy of Cisplatin and Etoposide in NSCLC cells. Toxicol In Vitro. 2021 Feb;70:105038. doi: 10.1016/j.tiv.2020.105038. | Click |
12 | Targeting Na+ /K+ -ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma. Br J Pharmacol. 2021 Nov;178(21):4389-4407. doi: 10.1111/bph.15616. | Click |
13 | Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. | Click |
14 | Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells. J Enzyme Inhib Med Chem. 2023 Dec;38(1):1-11. doi: 10.1080/14756366.2022.2132487. | Click |
15 | The role of daurisoline treatment in hepatocellular carcinoma: Inhibiting vasculogenic mimicry formation and enhancing sensitivity to sorafenib. Phytomedicine. 2021 Nov;92:153740. doi: 10.1016/j.phymed.2021.153740. | Click |
16 | Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis. Oncol Lett. 2022 Jan;23(1):16. doi: 10.3892/ol.2021.13134. | Click |
17 | Kaempferol potentiates the sensitivity of pancreatic cancer cells to erlotinib via inhibition of the PI3K/AKT signaling pathway and epidermal growth factor receptor. Inflammopharmacology. 2021 Oct;29(5):1587-1601. doi: 10.1007/s10787-021-00848-1. | Click |
18 | Baicalein improves the chemoresistance of ovarian cancer through regulation of CirSLC7A6. J Ovarian Res. 2023 Nov 8;16(1):212. doi: 10.1186/s13048-023-01285-0. | Click |
19 | Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells. Exp Oncol. 2021 Jun;43(2):125-134. doi: 10.32471/exp-oncology.2312-8852.vol-43-no-2.16096. | Click |
20 | Nobiletin, a citrus polymethoxyflavone, enhances the effects of bicalutamide on prostate cancer cells via down regulation of NF-κB, STAT3, and ERK activation. RSC Adv. 2020 Mar 10;10(17):10254-10262. doi: 10.1039/c9ra10020b. | Click |
21 | Tangeretin boosts the anticancer activity of metformin in breast cancer cells via curbing the energy production. Phytomedicine. 2021 Mar;83:153470. doi: 10.1016/j.phymed.2021.153470. | Click |
22 | Daidzein Synergizes with Gefitinib to Induce ROS/JNK/c-Jun Activation and Inhibit EGFR-STAT/AKT/ERK Pathways to enhance Lung Adenocarcinoma cells chemosensitivity. Int J Biol Sci. 2022 May 16;18(9):3636-3652. doi: 10.7150/ijbs.71870. | Click |
23 | Reinforcement of Sorafenib Anti-osteosarcoma Effect by Amentoflavone Is Associated With the Induction of Apoptosis and Inactivation of ERK/NF-κB. In Vivo. 2022 May-Jun;36(3):1136-1143. doi: 10.21873/invivo.12812. | Click |
24 | Combined treatment with sorafenib and silibinin synergistically targets both HCC cells and cancer stem cells by enhanced inhibition of the phosphorylation of STAT3/ERK/AKT. Eur J Pharmacol. 2018 Aug 5;832:39-49. doi: 10.1016/j.ejphar.2018.05.027. | Click |
25 | Morusin enhances the antitumor activity of MAPK pathway inhibitors in BRAF-mutant melanoma by inhibiting the feedback activation of STAT3. Eur J Cancer. 2022 Apr;165:58-70. doi: 10.1016/j.ejca.2022.01.004. | Click |
26 | Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. | Click |
27 | Quercetin attenuates the cardiotoxicity of doxorubicin-cyclophosphamide regimen and potentiates its chemotherapeutic effect against triple-negative breast cancer. Phytother Res. 2022;36(1):551-561. doi:10.1002/ptr.7342 | Click |
28 | Resveratrol enhances the antitumor effects of temozolomide in glioblastoma via ROS-dependent AMPK-TSC-mTOR signaling pathway. CNS Neurosci Ther. 2012;18(7):536-546. doi:10.1111/j.1755-5949.2012.00319.x | Click |
29 | Oridonin enhances the cytotoxicity of 5-FU in renal carcinoma cells by inducting necroptotic death. Biomed Pharmacother. 2018 Oct;106:175-182. doi: 10.1016/j.biopha.2018.06.111. | Click |
30 | Enhancement of gemcitabine efficacy by K73-03 via epigenetically regulation of miR-421/SPINK1 in gemcitabine resistant pancreatic cancer cells. Phytomedicine. 2021 Oct;91:153711. doi: 10.1016/j.phymed.2021.153711. | Click |
31 | Ginsenoside RG1 augments doxorubicin-induced apoptotic cell death in MDA-MB-231 breast cancer cell lines. J Biochem Mol Toxicol. 2022 Jan;36(1):e22945. doi: 10.1002/jbt.22945. | Click |
32 | Costunolide is a dual inhibitor of MEK1 and AKT1/2 that overcomes osimertinib resistance in lung cancer. Mol Cancer. 2022;21(1):193. Published 2022 Oct 6. doi:10.1186/s12943-022-01662-1 | Click |
33 | β-Elemene Enhances the Chemotherapeutic Effect of 5-Fluorouracil in Triple-Negative Breast Cancer via PI3K/AKT, RAF-MEK-ErK, and NF-κB Signaling Pathways. Onco Targets Ther. 2020 Jun 9;13:5207-5222. doi: 10.2147/OTT.S242820. | Click |
34 | Ginkgolide B Regulates CDDP Chemoresistance in Oral Cancer via the Platelet-Activating Factor Receptor Pathway. Cancers (Basel). 2021 Dec 15;13(24):6299. doi: 10.3390/cancers13246299. | Click |
35 | Resveratrol enhances the therapeutic effect of temozolomide against malignant glioma in vitro and in vivo by inhibiting autophagy. Free Radic Biol Med. 2012;52(2):377-391. doi:10.1016/j.freeradbiomed.2011.10.487 | Click |
36 | Gedunin, A Neem Limonoid in Combination with Epalrestat Inhibits Cancer Hallmarks by Attenuating Aldose Reductase-Driven Oncogenic Signaling in SCC131 Oral Cancer Cells. Anticancer Agents Med Chem. 2018;18(14):2042-2052. doi: 10.2174/1871520618666180731093433. | Click |
37 | Emodin and Its Combination with Cytarabine Induce Apoptosis in Resistant Acute Myeloid Leukemia Cells in Vitro and in Vivo. Cell Physiol Biochem. 2018;48(5):2061-2073. doi: 10.1159/000492544. | Click |
38 | Effects and mechanisms of trifluridine alone or in combination with cryptotanshinone in inhibiting malignant biological behavior of gastric cancer. Cell Cycle. 2023 Jun;22(12):1463-1477. doi: 10.1080/15384101.2023.2215678. | Click |
39 | Honokiol augments the anti-cancer effects of oxaliplatin in colon cancer cells. Acta Biochim Biophys Sin (Shanghai). 2013 Sep;45(9):773-9. doi: 10.1093/abbs/gmt071. | Click |
40 | Chlorogenic Acid Enhances Doxorubicin-Mediated Cytotoxic Effect in Osteosarcoma Cells. Int J Mol Sci. 2021 Aug 10;22(16):8586. doi: 10.3390/ijms22168586. | Click |
41 | Chlorogenic acid enhances the effects of 5-fluorouracil in human hepatocellular carcinoma cells through the inhibition of extracellular signal-regulated kinases. Anticancer Drugs. 2015 Jun;26(5):540-6. doi: 10.1097/CAD.0000000000000218. | Click |
42 | Synergistic Anticancer Activity of Combined Use of Caffeic Acid with Paclitaxel Enhances Apoptosis of Non-Small-Cell Lung Cancer H1299 Cells in Vivo and in Vitro. Cell Physiol Biochem. 2018;48(4):1433-1442. doi: 10.1159/000492253. | Click |
43 | Decursin and Doxorubicin Are in Synergy for the Induction of Apoptosis via STAT3 and/or mTOR Pathways in Human Multiple Myeloma Cells. Evid Based Complement Alternat Med. 2013;2013:506324. doi: 10.1155/2013/506324. | Click |
44 | Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway. Am J Transl Res. 2019 Jun 15;11(6):3816-3824. | Click |
45 | Synergistic effect of ursodeoxycholic acid on the antitumor activity of sorafenib in hepatocellular carcinoma cells via modulation of STAT3 and ERK. Int J Mol Med. 2018 Nov;42(5):2551-2559. doi: 10.3892/ijmm.2018.3807. | Click |
46 | Pterostilbine, an active component of blueberries, sensitizes colon cancer cells to 5-fluorouracil cytotoxicity. Sci Rep. 2015 Oct 16;5:15239. doi: 10.1038/srep15239. | Click |
47 | Synergistic anti-tumour activity of sorafenib in combination with pegylated resveratrol is mediated by Akt/mTOR/p70S6k-4EBP-1 and c-Raf7MEK/ERK signaling pathways. Heliyon. 2023 Aug 19;9(8):e19154. doi: 10.1016/j.heliyon.2023.e19154. | Click |
48 | Curcumin suppresses cell proliferation and triggers apoptosis in vemurafenib-resistant melanoma cells by downregulating the EGFR signaling pathway. Environ Toxicol. 2022 Apr;37(4):868-879. doi: 10.1002/tox.23450. | Click |
49 | Curcumin sensitizes human lung cancer cells to apoptosis and metastasis synergistically combined with carboplatin. Exp Biol Med (Maywood). 2015 Nov;240(11):1416-25. doi: 10.1177/1535370215571881. | Click |
50 | Synergistic anticancer effect of acteoside and temozolomide-based glioblastoma chemotherapy. Int J Mol Med. 2019 Mar;43(3):1478-1486. doi: 10.3892/ijmm.2019.4061. | Click |
51 | Synergistic effects of α-Mangostin and sorafenib in hepatocellular carcinoma: New insights into α-mangostin cytotoxicity. Biochem Biophys Res Commun. 2021 Jun 18;558:14-21. doi: 10.1016/j.bbrc.2021.04.047. | Click |
52 | Inhibition of Cell Proliferation in an NRAS Mutant Melanoma Cell Line by Combining Sorafenib and α-Mangostin. PLoS One. 2016 May 6;11(5):e0155217. doi: 10.1371/journal.pone.0155217. | Click |
53 | AT-101 enhances gefitinib sensitivity in non-small cell lung cancer with EGFR T790M mutations. BMC Cancer. 2016 Jul 18;16:491. doi: 10.1186/s12885-016-2519-3. | Click |
54 | Oxidized tea polyphenol (OTP-3) targets EGFR synergistic nimotuzumab at inhibition of non-small cell lung tumor growth. Bioorg Chem. 2022 Nov;128:106084. doi: 10.1016/j.bioorg.2022.106084. | Click |
55 | 10-Gingerol Enhances the Effect of Taxol in Triple-Negative Breast Cancer via Targeting ADRB2 Signaling. Drug Des Devel Ther. 2023 Jan 20;17:129-142. doi: 10.2147/DDDT.S390602. | Click |
56 | Gambogenic acid inhibits fibroblast growth factor receptor signaling pathway in erlotinib-resistant non-small-cell lung cancer and suppresses patient-derived xenograft growth. Cell Death Dis. 2018 Feb 15;9(3):262. doi: 10.1038/s41419-018-0314-6. | Click |
57 | Gambogic acid sensitizes gemcitabine efficacy in pancreatic cancer by reducing the expression of ribonucleotide reductase subunit-M2 (RRM2). J Exp Clin Cancer Res. 2017 Aug 10;36(1):107. doi: 10.1186/s13046-017-0579-0. | Click |
58 | Gambogic acid synergistically potentiates cisplatin-induced apoptosis in non-small-cell lung cancer through suppressing NF-κB and MAPK/HO-1 signalling. Br J Cancer. 2014 Jan 21;110(2):341-52. doi: 10.1038/bjc.2013.752. | Click |
59 | Chebulagic acid synergizes the cytotoxicity of doxorubicin in human hepatocellular carcinoma through COX-2 dependant modulation of MDR-1. Med Chem. 2011 Sep;7(5):432-42. doi: 10.2174/157340611796799087. | Click |
60 | Investigation of new treatment option for hepatocellular carcinoma: a combination of sorafenib with usnic acid. J Pharm Pharmacol. 2019 Jul;71(7):1119-1132. doi: 10.1111/jphp.13097. | Click |
61 | Establishment of patient-derived xenograft models of adenoid cystic carcinoma to assess pre-clinical efficacy of combination therapy of a PI3K inhibitor and retinoic acid. Am J Cancer Res. 2021 Mar 1;11(3):773-792. | Click |
62 | Combination of midostaurin and ATRA exerts dose-dependent dual effects on acute myeloid leukemia cells with wild type FLT3. BMC Cancer. 2022 Jul 9;22(1):749. doi: 10.1186/s12885-022-09828-2. | Click |
63 | Dual anti-angiogenic and anti-metastatic activity of myriocin synergistically enhances the anti-tumor activity of cisplatin. Cell Oncol (Dordr). 2023 Feb;46(1):117-132. doi: 10.1007/s13402-022-00737-x. | Click |
64 | Therapeutic Mechanism of Lapatinib Combined with Sulforaphane on Gastric Cancer. Evid Based Complement Alternat Med. 2021 Sep 18;2021:9933274. doi: 10.1155/2021/9933274. | Click |
65 | Sulforaphane overcomes T790M-mediated gefitinib resistance in vitro through epithelial-mesenchymal transition. J Physiol Pharmacol. 2021 Oct;72(5). doi: 10.26402/jpp.2021.5.09. | Click |
66 | Sulforaphene-Carboplatin Combination Synergistically Enhances Apoptosis by Disruption of Mitochondrial Membrane Potential and Cell Cycle Arrest in Human Non-Small Cell Lung Carcinoma. J Med Food. 2016 Sep;19(9):860-9. doi: 10.1089/jmf.2016.3675. | Click |
67 | Sulforaphene Enhances The Efficacy of Photodynamic Therapy In Anaplastic Thyroid Cancer Through Ras/RAF/MEK/ERK Pathway Suppression. J Photochem Photobiol B. 2018 Feb;179:46-53. doi: 10.1016/j.jphotobiol.2017.12.013. | Click |
68 | Antitumor effects of erlotinib in combination with berberine in A431 cells. BMC Pharmacol Toxicol. 2023 May 11;24(1):29. doi: 10.1186/s40360-023-00661-2. | Click |
69 | Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway. Molecules. 2021 Mar 17;26(6):1666. doi: 10.3390/molecules26061666. | Click |
70 | Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway. Mol Carcinog. 2019 Jun;58(6):1033-1045. doi: 10.1002/mc.22991. | Click |
71 | Platycodin D induces apoptotic cell death through PI3K/AKT and MAPK/ERK pathways and synergizes with venetoclax in acute myeloid leukemia. Eur J Pharmacol. 2023 Oct 5;956:175957. doi: 10.1016/j.ejphar.2023.175957. | Click |
72 | Scutellarin Increases Cisplatin-Induced Apoptosis and Autophagy to Overcome Cisplatin Resistance in Non-small Cell Lung Cancer via ERK/p53 and c-met/AKT Signaling Pathways. Front Pharmacol. 2018 Feb 13;9:92. doi: 10.3389/fphar.2018.00092. | Click |
73 | EGCG overcomes gefitinib resistance by inhibiting autophagy and augmenting cell death through targeting ERK phosphorylation in NSCLC. Onco Targets Ther. 2019 Jul 26;12:6033-6043. doi: 10.2147/OTT.S209441. | Click |
74 | Epigallocatechin gallate circumvents drug-induced resistance in non-small-cell lung cancer by modulating glucose metabolism and AMPK/AKT/MAPK axis. Phytother Res. 2023;37(12):5837-5853. doi:10.1002/ptr.7990 | Click |
75 | Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction. Cell Oncol (Dordr). 2021 Feb;44(1):135-150. doi: 10.1007/s13402-020-00557-x. | Click |
76 | Rosmarinic acid reverses non-small cell lung cancer cisplatin resistance by activating the MAPK signaling pathway. Phytother Res. 2020 May;34(5):1142-1153. doi: 10.1002/ptr.6584. | Click |
77 | Olean-28,13b-olide 2 plays a role in cisplatin-mediated apoptosis and reverses cisplatin resistance in human lung cancer through multiple signaling pathways. Biochem Pharmacol. 2019;170:113642. doi:10.1016/j.bcp.2019.113642 | Click |
78 | Shogaol overcomes TRAIL resistance in colon cancer cells via inhibiting of survivin. Tumour Biol. 2015 Nov;36(11):8819-29. doi: 10.1007/s13277-015-3629-2. | Click |
79 | Platycodin D reverses histone deacetylase inhibitor resistance in hepatocellular carcinoma cells by repressing ERK1/2-mediated cofilin-1 phosphorylation. Phytomedicine. 2021 Feb;82:153442. doi: 10.1016/j.phymed.2020.153442. | Click |
80 | Shikonin inhibits gefitinib-resistant non-small cell lung cancer by inhibiting TrxR and activating the EGFR proteasomal degradation pathway. Pharmacol Res. 2017;115:45-55. doi:10.1016/j.phrs.2016.11.011 | Click |