TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Nuclear factor NF-kappa-B p105
UniProt ID NFKB1_HUMAN
Gene Name NFKB1
Gene ID 4790
Synonyms
NFKB1, CVID12, EBP-1, KBF1, NF-kB, NF-kB1, NF-kappa-B1, NF-kappaB, NF-kappabeta, NFKB-p105, NFKB-p50, NFkappaB
Sequence
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
Pathway Map MAP LINK
KEGG ID hsa4790
TTD ID T83145
Pfam PF00023; PF00531; PF00554; PF12796; PF13606; PF13637; PF13857; PF16179
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 997
Pair Name Chrysin, Paclitaxel
Phytochemical Name Chrysin
Anticancer drug Name Paclitaxel
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Nuclear factor NF-kappa-B p105 Expression
Result CR exhibited the ability to reduce oxidative DNA damage, exert anti-apoptotic and anti-inflammatory properties, and mitigate the toxic effects of Pax-induced hepatorenal toxicity.
Combination Pair ID: 313
Pair Name Juglone, Indomethacin
Phytochemical Name Juglone
Anticancer drug Name Indomethacin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result IND and JUG reduce the inflammatory activity and induce apoptotic cell death, while JUG effectively prevents IND induced gastric ulceration. These findings establish that a combination of IND + JUG may serve as a promising treatment regimen for colon cancer.
Combination Pair ID: 443
Pair Name Paeonol, Epirubicin
Phytochemical Name Paeonol
Anticancer drug Name Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result These findings suggest that combination of Paeonol and Epirubicin is potentially applicable for breast cancer treatment.
Combination Pair ID: 444
Pair Name Paeonol, Methotrexate
Phytochemical Name Paeonol
Anticancer drug Name Methotrexate
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Paeonol protects against MTX-induced nephrotoxicity through antioxidant, anti-inflammatory, and antiapoptotic mechanisms and might potentiate MTX chemotherapeutic efficacy.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 8
Pair Name Harmine, Paclitaxel
Phytochemical Harmine
Drug Paclitaxel
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer
Combination Pair ID: 9
Pair Name Piperlongumine, Doxorubicin
Phytochemical Piperlongumine
Drug Doxorubicin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells
Combination Pair ID: 47
Pair Name Dihydroberberine, Sunitinib
Phytochemical Dihydroberberine
Drug Sunitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Phosphorylation
Result DCS induced the expression of cell cycle signal molecules that are known to be affected by JNK and p38. The change of cell cycle, in turn, led to down-regulation of JNK and p38, and further reduced IL-1 secretion. Collectively, these findings highlight potential molecular mechanisms of DCS chemotherapeutic activity and suggest that DCS is an efficacious strategy in NSCLC therapy.
Combination Pair ID: 59
Pair Name Saikosaponin B1, Etoposide
Phytochemical Saikosaponin B1
Drug Etoposide
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result We conclude Saikosaponin B can be an attractive adjuvant for enhancing the clinical effect of cancer chemotherapy.
Combination Pair ID: 63
Pair Name Luteolin, Erlotinib
Phytochemical Luteolin
Drug Erlotinib
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Phosphorylation
Result These findings suggest that combining luteolin with erlotinib offers a potential treatment strategy for glioblastoma multiforme IV.
Combination Pair ID: 70
Pair Name Baicalin, Fluorouracil
Phytochemical Baicalin
Drug Fluorouracil
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result BA is a promising preventive or adjuvant therapy in breast cancer treatment with 5-FU mainly via cooperative inhibition of inflammation, angiogenesis, and triggering apoptotic cell death.
Combination Pair ID: 81
Pair Name Nobiletin, Bicalutamide
Phytochemical Nobiletin
Drug Bicalutamide
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result NBT and BCT combination reduced key cellular signaling regulators including: p-Erk/Erk, p-STAT3/STAT3 and NF-κB. Overall, these results suggest that NBT combination with BCT may be an effective treatment for prostate cancer.
Combination Pair ID: 94
Pair Name Amentoflavone, Cisplatin
Phytochemical Amentoflavone
Drug Cisplatin
Disease Info [ICD-11: 2B66.0] Oral squamous cell carcinoma Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result Inactivation of NF-κB and induction of apoptosis through intrinsic caspase-dependent and independent apoptotic pathways are associated with amentoflavone enhanced anti-OSCC efficacy of cisplatin.
Combination Pair ID: 95
Pair Name Amentoflavone, Sorafenib
Phytochemical Amentoflavone
Drug Sorafenib
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Phosphorylation
Result Amentoflavone may sensitize OS to sorafenib treatment by inducing intrinsic and extrinsic apoptosis and inhibiting ERK/NF-κB signaling transduction.
Combination Pair ID: 124
Pair Name Epigallocatechin gallate, Fluorouracil
Phytochemical Epigallocatechin gallate
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Nuclear factor NF-kappa-B p105 Activity
Result Our data show that EGCG may be act as a novel chemo-sensitizer, and the GRP78/NF-κB/miR-155-5p/MDR1 pathway plays a vital role in EGCG enhancing the sensitivity of colorectal cancer to 5-FU.
Combination Pair ID: 136
Pair Name Tectorigenin, Paclitaxel
Phytochemical Tectorigenin
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result These data suggest that tectorigenin could sensitize paclitaxel-resistant human ovarian cancer cells through inactivation of the Akt/IKK/IκB/NFκB signaling pathway, and promise a new intervention to chemosensitize paclitaxel-induced cytotoxicity in ovarian cancer.
Combination Pair ID: 999
Pair Name Tiliroside, Anti-MUC1 antibody
Phytochemical Tiliroside
Drug Anti-MUC1 antibody
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result The combined action of anti-MUC1 and tiliroside was more effective in comparison with monotherapy in the case of C1GalT1, ST3GalT1, FUT4, Gal-3, NF-κB, Akt mRNAs, and Tn antigen, as well as sialyl T antigen expression. The results of our study indicate that applied combined therapy may be a promising anti-gastric cancer strategy.
Combination Pair ID: 147
Pair Name Flavokawain B, Daunorubicin
Phytochemical Flavokawain B
Drug Daunorubicin
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Up-regulation Nuclear factor NF-kappa-B p105 Activity
Result A combination treatment of DNR and FKB may improve the anticancer effects of DNR in DNR-resistant acute myeloid leukemia.
Combination Pair ID: 175
Pair Name Parthenolide, Balsalazide
Phytochemical Parthenolide
Drug Balsalazide
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result These results demonstrate that parthenolide potentiates the efficacy of balsalazide through synergistic inhibition of NF-κB activation and the combination of dual agents prevents colon carcinogenesis from chronic inflammation.
Combination Pair ID: 185
Pair Name Astragaloside IV, Carboplatin
Phytochemical Astragaloside IV
Drug Carboplatin
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Our results suggested that AgIV enhanced carboplatin sensitivity in prostate cancer cell lines by suppressing AKT/NF-κB signaling, thus suppressed epithelial-mesenchymal transition induced by carboplatin. Our findings provided a new mechanism for AgIV in overcoming drug resistance of platinum-based chemotherapy and suggested a potential combination therapy of AgIV and carboplatin in prostate cancer.
Combination Pair ID: 202
Pair Name Ginsenoside Rh2, Gemcitabine
Phytochemical Ginsenoside Rh2
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Nuclear factor NF-kappa-B p105 Expression
Result Rh2 activation of DCs may remodel the cold TIME and optimize GEM chemotherapy for future therapeutic use.
Combination Pair ID: 222
Pair Name Maslinic acid, Gemcitabine
Phytochemical Maslinic acid
Drug Gemcitabine
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result The results suggest that MA potentiates the antitumor effects of GEM in human GBC cell lines by suppressing the activation of NF-κB and its dowstream gene products, which are involved in survival signaling.
Combination Pair ID: 226
Pair Name Curcumol, Cisplatin
Phytochemical Curcumol
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result The findings may offer new thoughts that curcumol in combination with cisplatin might be a useful strategy for GC management.
Combination Pair ID: 1040
Pair Name Costunolide, Osimertinib
Phytochemical Costunolide
Drug Osimertinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Phosphorylation
Result The combination of osimertinib and costunolide showed synergistic or additive inhibitory effects on tumor growth in osimertinib-resistant cell lines and PDX model. Hence, this study highlights a potential therapeutic strategy for osimertinib-resistant patients through targeting of MEK1 and AKT1/2 by costunolide.
Combination Pair ID: 246
Pair Name Oleuropein, Doxorubicin
Phytochemical Oleuropein
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result The key findings clearly indicate the synergistic efficacy of DOX with natural and nontoxic OL against breast tumor xenografts.
Combination Pair ID: 249
Pair Name Tubeimoside I, Temozolomide
Phytochemical Tubeimoside I
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Phosphorylation
Result We first demonstrated that synergistic effects of TBMS1 and TMZ induced apoptosis in GBM cells through reducing MGMT expression and inhibiting the EGFR induced PI3K/Akt/mTOR/NF-κB signaling pathway. This study provides a rationale for combined application of TMZ and TBMS1 as a potential chemotherapeutic treatment for MGMT+ GBM patients.
Combination Pair ID: 252
Pair Name Nimbolide, Docetaxel
Phytochemical Nimbolide
Drug Docetaxel
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result The combination of NL and DTX significantly reduced the DNA binding ability of NF-κB in both cell types. NL significantly enhanced the antitumor effect of DTX and reduced metastases in orthotopic models of prostate cancer. NL abolishes DTX-induced-NF-κB activation to counteract cell proliferation, tumor growth, and metastasis in the prostate cancer models.
Combination Pair ID: 271
Pair Name Deoxyelephantopin, Gemcitabine
Phytochemical Deoxyelephantopin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result It is possible that DET could be developed as a single agent or combined with conventional chemotherapy drugs to improve the treatment of pancreatic cancer.
Combination Pair ID: 273
Pair Name Eurycomalactone, Cisplatin
Phytochemical Eurycomalactone
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Phosphorylation
Result This finding provides a rationale for the combined use of chemotherapy drugs with ECL to improve their efficacy in NSCLC treatment.
Combination Pair ID: 274
Pair Name Gedunin, Epalrestat
Phytochemical Gedunin
Drug Epalrestat
Disease Info [ICD-11: 2B66.Z] Oral cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Our results provide compelling evidence that the combination of gedunin and epalrestat modulates expression of key oncogenic signalling kinases and transcription factors primarily by influencing phosphorylation and subcellular localisation. AR inhibitors such as gedunin and epalrestat are novel candidate agents for cancer prevention and therapy.
Combination Pair ID: 730
Pair Name Emodin, Gemcitabine
Phytochemical Emodin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result This study suggests that emodin enhances the antitumor effect of gemcitabine in SW1990 pancreatic cancer in vitro and in vivo, which may be via the downregulation of NF-κB expression, thus inhibiting the expression of XIAP.
Combination Pair ID: 744
Pair Name Thymoquinone, Cisplatin
Phytochemical Thymoquinone
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Thymoquinone combined with cisplatin showed synergistic anticancer activity by down-regulating NF-kappaB
Combination Pair ID: 750
Pair Name Thymoquinone, Fluorouracil
Phytochemical Thymoquinone
Drug Fluorouracil
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Our findings present the first report describing the in vivo enhancement effect of combined TQ and 5-FU against early stages of CRC; however, further studies are required to determine the value of this combination therapy in an advanced long-term model of CRC and also to realize its clinical potential.
Combination Pair ID: 311
Pair Name Juglone, Indomethacin
Phytochemical Juglone
Drug Indomethacin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result A combination of both was shown to be more effective, suggesting that juglone may be considered for therapeutic intervention of colon cancer.
Combination Pair ID: 319
Pair Name Rosmarinic acid, Paclitaxel
Phytochemical Rosmarinic acid
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Rosmarinic acid exerted chemo-preventive and therapeutic potential alone or in combination with Paclitaxel. Moreover, rosmarinic acid targets numerous signaling pathways associated with breast cancer.
Combination Pair ID: 324
Pair Name Caffeic acid phenethyl ester, Bortezomib
Phytochemical Caffeic acid phenethyl ester
Drug Bortezomib
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result We think that our study, which is the first to demonstrate the in vitro and in vivo effectiveness of the.combined use of CAPE and bortezomib, will be a pioneer for future human applications of CAPE in MM.
Combination Pair ID: 332
Pair Name Bergamottin, Simvastatin
Phytochemical Bergamottin
Drug Simvastatin
Disease Info [ICD-11: 2A20.1] Chronic myelogenous leukemia Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Discussion and conclusion Our results provide novel insight into the role of SV and BGM in potentially preventing and treating cancer through modulation of NF-κB signalling pathway and its regulated gene products.
Combination Pair ID: 346
Pair Name Obovatol, Docetaxel
Phytochemical Obovatol
Drug Docetaxel
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result These results indicate that obovatol augments cell growth inhibition by chemotherapeutics through inactivation of NF-kappaB and suggest that obovatol may have therapeutic advantages in the combination treatment with other chemotherapeutics.
Combination Pair ID: 348
Pair Name Beta-Sitosterol, Gemcitabine
Phytochemical Beta-Sitosterol
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Phosphorylation
Result β-Sitosterol and Gemcitabine Exhibit Synergistic Anti-pancreatic Cancer Activity by Modulating Apoptosis and Inhibiting Epithelial-Mesenchymal Transition by Deactivating Akt/GSK-3β Signaling
Combination Pair ID: 399
Pair Name Curcumin, Paclitaxel
Phytochemical Curcumin
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result Curcumin reduces paclitaxel resistance in ovarian carcinoma cells by upregulating SNIP1 and inhibiting NFκB activity
Combination Pair ID: 827
Pair Name Curcumin, TNF-related apoptosis inducing ligand
Phytochemical Curcumin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result Combined treatment with curcumin and carboplatin inhibited tumor cell growth, migration, and invasion compared with either drug alone. The synergistic antitumor activity of curcumin combined with carboplatin is mediated by multiple mechanisms involving suppression of NF-kappaB via inhibition of the Akt/IKKalpha pathway and enhanced ERK1/2 activity
Combination Pair ID: 842
Pair Name Luteolin, SMC3
Phytochemical Luteolin
Drug SMC3
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result The results suggest that combination of SMC3 and luteolin is an effective approach for improving the anticancer value of SMC3, which has implications in cancer prevention and therapy.
Combination Pair ID: 415
Pair Name Icariin, Fluorouracil
Phytochemical Icariin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result We suggest that combination of icariin with 5-FU might offer a therapeutic benefit to the patients with CRC; however, further studies are required to ascertain this proposition.
Combination Pair ID: 417
Pair Name Icariin, Gemcitabine
Phytochemical Icariin
Drug Gemcitabine
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result Icariin, by suppressing NF-κB activity, exerts antitumor activity, and potentiates the antitumor activity of gemcitabine in gallbladder cancer. Combined administration of gemcitabine and icariin may offer a better therapeutic option for the patients with gallbladder cancer.
Combination Pair ID: 448
Pair Name Naringenin, Diosmin
Phytochemical Naringenin
Drug Diosmin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Diosmin in combination with naringenin enhances apoptosis in colon cancer cells
Combination Pair ID: 454
Pair Name Mangiferin, Doxorubicin
Phytochemical Mangiferin
Drug Doxorubicin
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Our findings suggest that the combination of mangiferin and an anticancer drug could be used as a new regime for the treatment of MM.
Combination Pair ID: 458
Pair Name Neferine, Cisplatin
Phytochemical Neferine
Drug Cisplatin
Disease Info [ICD-11: 2C90.Z] Renal carcinoma Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result Neferine increases sensitivities to multiple anticancer drugs via downregulation of Bcl-2 expression in renal cancer cells
Combination Pair ID: 870
Pair Name Shogaol, Gemcitabine
Phytochemical Shogaol
Drug Gemcitabine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result Our results suggest that 6-shogaol can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing of TLR4/NF-κB-mediated inflammatory pathways linked to tumorigenesis.
Combination Pair ID: 480
Pair Name Tectochrysin, Cetuximab
Phytochemical Tectochrysin
Drug Cetuximab
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result Our results indicate that combined therapy with lower concentration of cetuximab and tectochrysin could significantly enhance the cancer cell growth inhibitory effect through the inhibition of EGFR signaling.
Combination Pair ID: 495
Pair Name Chebulagic acid, Doxorubicin
Phytochemical Chebulagic acid
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result The present study shows the efficacy of CA to overcome MDR-1 mediated drug resistance in HepG2 cells through COX-2 dependant modulation of MDR-1.
Combination Pair ID: 496
Pair Name Hispidin, Gemcitabine
Phytochemical Hispidin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Hispidin might be a novel chemosensitizer for gemcitabine and a potential synergistic agent for increasing the therapeutic index of gemcitabine as a treatment for pancreatic cancer.
Combination Pair ID: 527
Pair Name Oridonin, Arsenic oxide (As2O3)
Phytochemical Oridonin
Drug Arsenic oxide (As2O3)
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result The combination treatment induced ROS-dependent decrease in mitochondrial membrane potential (MMP) decrease, and relocation of Bax and cytochrome C. Besides, oridonin dramatically increased the intracellular Ca2+ overload triggered by As2O3. Furthermore, the co-treatment of oridonin and As2O3 induced ROS-mediated down-regulation of Akt and XIAP, and inhibition of NF-κB activation. The two drug combination enhanced tumor suppression activity in murine HCC model compared with single agent treatment in vivo.
Combination Pair ID: 532
Pair Name Artepillin C, TNF-related apoptosis inducing ligand
Phytochemical Artepillin C
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Nuclear factor NF-kappa-B p105 Activity
Result The data demonstrate the important role of Brazilian green propolis and its bioactive compounds in prostate cancer chemoprevention through the enhancement of TRAIL-mediated apoptosis.
Combination Pair ID: 545
Pair Name Sulforaphane, CB-5083
Phytochemical Sulforaphane
Drug CB-5083
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result The combination of Sulforaphane and CB-5083 may be a useful treatment strategy to combat CB-5083 resistance.
Combination Pair ID: 558
Pair Name Lycopene, Cisplatin
Phytochemical Lycopene
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Lycopene increases the sensitization of cervical cancer cells to cisplatin via inhibition of cell viability, up-regulation of Bax expression, and down-regulation of Bcl-2 expression. Furthermore, the anticancer effect of lycopene might be also associated with suppression of NF-κB-mediated inflammatory responses, and modulation of Nrf2-mediated oxidative stress. The results of the present study suggest that lycopene and concurrent cisplatin chemotherapy might have a role in improving the treatment of cervical cancer.
Combination Pair ID: 582
Pair Name Eriocalyxin B, Gemcitabine
Phytochemical Eriocalyxin B
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Phosphorylation
Result Gem and EriB (or Isodon extract) taken together in combination regulated PDK1/AKT1/caspase and JNK signaling and promoted apoptosis synergistically, which may contribute to the much increased anti-proliferative activity compared to either agent alone.
Combination Pair ID: 583
Pair Name Ginger extract, Doxorubicin
Phytochemical Ginger extract
Drug Doxorubicin
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result AMPK pathway and cyclin D1 gene expression could be a molecular therapeutic target for the anticancer effect of GE in mice bearing SEC. Combining GE and DOX revealed a greater efficacy as anticancer therapeutic regimen.
Combination Pair ID: 927
Pair Name Gamma-Tocotrienol, SU11274
Phytochemical Gamma-Tocotrienol
Drug SU11274
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Phosphorylation
Result Suggest that combined γ-tocotrienol and Met inhibitor treatment may provide benefit in treatment of breast cancers characterized by aberrant Met activity.
Combination Pair ID: 928
Pair Name Gamma-Tocotrienol, Gemcitabine
Phytochemical Gamma-Tocotrienol
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Our findings suggest that γ-T3 can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing NF-κB-mediated inflammatory pathways linked to tumorigenesis.
Combination Pair ID: 929
Pair Name Gamma-Tocotrienol, Capecitabine
Phytochemical Gamma-Tocotrienol
Drug Capecitabine
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Our findings suggest that γ-T3 inhibited the growth of human CRC and sensitised CRC to capecitabine by regulating proteins linked to tumourigenesis.
Combination Pair ID: 930
Pair Name Gamma-Tocotrienol, Docetaxel
Phytochemical Gamma-Tocotrienol
Drug Docetaxel
Disease Info [ICD-11: 2B66.Z] Oral cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result These findings suggest that the combination treatment with these agents may provide enhanced therapeutic response in oral cancer patients, while avoiding the toxicity associated with high-dose β-tubulin stabilization monotherapy.
Combination Pair ID: 937
Pair Name Cordycepin, Temozolomide
Phytochemical Cordycepin
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Cordycepin combined with temozolomide may down-regulate MYC through "MicroRNA in cancer, Proteoglycans in cancer, Pathways in cancer and PI3K-AKT signaling pathway", which in turn regulate the expression of MCL1, CTNNB1, MMP9, PDCD4, thus regulating cell proliferation, migration and apoptosis in glioblastoma.
Combination Pair ID: 946
Pair Name Guggulsterone, Gemcitabine
Phytochemical Guggulsterone
Drug Gemcitabine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result The combination of guggulsterone to gemcitabine enhanced antitumor efficacy through apoptosis induction by suppressing Akt and nuclear factor KappaB activity and by modulating apoptosis-related protein expression in pancreatic cancer
Combination Pair ID: 610
Pair Name Noscapine, Cisplatin
Phytochemical Noscapine
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Noscapine Increases the Sensitivity of Drug-Resistant Ovarian Cancer Cell Line SKOV3/DDP to Cisplatin by Regulating Cell Cycle and Activating Apoptotic Pathways
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 121
Pair Name Troxerutin, Fluorouracil
Phytochemical Troxerutin
Drug Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result Our data indicated a novel therapeutic strategy to potentiate 5-FU-induced anti-tumor effect in gastric cancer cells with resistance to 5-FU by TXN through suppression of p-STAT3/NF-κB (p65 and p50) and Bcl-2.
Combination Pair ID: 176
Pair Name Parthenolide, Temozolomide
Phytochemical Parthenolide
Drug Temozolomide
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Activity
Result These findings suggest that NF-κB is a potential target for inducing cell death in gliomas. A targeted combination strategy in which the response to TMZ is synergistically enhanced by the addition of parthenolide which may be useful, especially in chemoresistant gliomas with high MGMT expression.
Combination Pair ID: 742
Pair Name Aloe emodin, Temozolomide
Phytochemical Aloe emodin
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Expression
Result These convincing results suggest that AE could be a natural adjuvant agent to potentiate the effects of traditional drugs (TMZ) and overcome drug resistance in glioblastoma cells.
Combination Pair ID: 362
Pair Name Oleanolic Acid, Cisplatin
Phytochemical Oleanolic Acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Nuclear factor NF-kappa-B p105 Phosphorylation
Result OLO-2 treatment also exhibited up to 4.6-fold selectivity against human lung adenocarcinoma cells. Taken together, the results of the present study shed light on the drug resistance-reversing effects of OLO-2 in lung cancer cells.
03. Reference
No. Title Href
1 Chrysin attenuates paclitaxel-induced hepatorenal toxicity in rats by suppressing oxidative damage, inflammation, and apoptosis. Life Sci. 2023 Nov 1;332:122096. doi: 10.1016/j.lfs.2023.122096. Click
2 Effects of combined treatment with Indomethacin and Juglone on AOM/DSS induced colon carcinogenesis in Balb/c mice: Roles of inflammation and apoptosis. Life Sci. 2021 Jan 1;264:118657. doi: 10.1016/j.lfs.2020.118657. Click
3 Enhanced antitumor activity and attenuated cardiotoxicity of Epirubicin combined with Paeonol against breast cancer. Tumour Biol. 2016 Sep;37(9):12301-12313. doi: 10.1007/s13277-016-5088-9. Click
4 Paeonol Protects Against Methotrexate-Induced Nephrotoxicity via Upregulation of P-gp Expression and Inhibition of TLR4/NF-κB Pathway. Front Pharmacol. 2022 Feb 4;13:774387. doi: 10.3389/fphar.2022.774387. Click
5 Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer. Oncol Lett. 2016 Aug;12(2):983-988. doi: 10.3892/ol.2016.4696. Click
6 Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells. Chem Biol Interact. 2022 Feb 25;354:109832. doi: 10.1016/j.cbi.2022.109832. Click
7 Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178. Click
8 Chemosensitizing Effect of Saikosaponin B on B16F10 Melanoma Cells. Nutr Cancer. 2017 Apr;69(3):505-511. doi: 10.1080/01635581.2017.1285407. Click
9 Luteolin enhances erlotinib's cell proliferation inhibitory and apoptotic effects in glioblastoma cell lines. Front Pharmacol. 2022 Sep 19;13:952169. doi: 10.3389/fphar.2022.952169. Click
10 Baicalin; a promising chemopreventive agent, enhances the antitumor effect of 5-FU against breast cancer and inhibits tumor growth and angiogenesis in Ehrlich solid tumor. Biomed Pharmacother. 2022 Feb;146:112599. doi: 10.1016/j.biopha.2021.112599. Click
11 Nobiletin, a citrus polymethoxyflavone, enhances the effects of bicalutamide on prostate cancer cells via down regulation of NF-κB, STAT3, and ERK activation. RSC Adv. 2020 Mar 10;10(17):10254-10262. doi: 10.1039/c9ra10020b. Click
12 Anticancer Efficacy and Mechanism of Amentoflavone for Sensitizing Oral Squamous Cell Carcinoma to Cisplatin. Anticancer Res. 2020 Dec;40(12):6723-6732. doi: 10.21873/anticanres.14695. Click
13 Reinforcement of Sorafenib Anti-osteosarcoma Effect by Amentoflavone Is Associated With the Induction of Apoptosis and Inactivation of ERK/NF-κB. In Vivo. 2022 May-Jun;36(3):1136-1143. doi: 10.21873/invivo.12812. Click
14 (-)-Epigallocatechin Gallate (EGCG) Enhances the Sensitivity of Colorectal Cancer Cells to 5-FU by Inhibiting GRP78/NF-κB/miR-155-5p/MDR1 Pathway. J Agric Food Chem. 2019 Mar 6;67(9):2510-2518. doi: 10.1021/acs.jafc.8b06665. Click
15 Tectorigenin sensitizes paclitaxel-resistant human ovarian cancer cells through downregulation of the Akt and NFκB pathway. Carcinogenesis. 2012 Dec;33(12):2488-98. doi: 10.1093/carcin/bgs302. Click
16 Tiliroside Combined with Anti-MUC1 Monoclonal Antibody as Promising Anti-Cancer Strategy in AGS Cancer Cells. Int J Mol Sci. 2023 Aug 22;24(17):13036. doi: 10.3390/ijms241713036. Click
17 The Combination of Flavokawain B and Daunorubicin Induces Apoptosis in Human Myeloid Leukemic Cells by Modifying NF-κB. Anticancer Res. 2018 May;38(5):2771-2778. doi: 10.21873/anticanres.12520. Click
18 Combined Parthenolide and Balsalazide Have Enhanced Antitumor Efficacy Through Blockade of NF-κB Activation. Mol Cancer Res. 2017 Feb;15(2):141-151. doi: 10.1158/1541-7786.MCR-16-0101. Click
19 Astragaloside IV enhanced carboplatin sensitivity in prostate cancer by suppressing AKT/NF-κB signaling pathway. Biochem Cell Biol. 2021 Apr;99(2):214-222. doi: 10.1139/bcb-2020-0026. Click
20 The combination of gemcitabine and ginsenoside Rh2 enhances the immune function of dendritic cells against pancreatic cancer via the CARD9-BCL10-MALT1 / NF-κB pathway. Clin Immunol. 2023 Mar;248:109217. doi: 10.1016/j.clim.2022.109217. Click
21 Maslinic acid potentiates the antitumor activities of gemcitabine in vitro and in vivo by inhibiting NF-κB-mediated survival signaling pathways in human gallbladder cancer cells. Oncol Rep. 2015 Apr;33(4):1683-90. doi: 10.3892/or.2015.3755. Click
22 Curcumol enhances cisplatin sensitivity of gastric cancer: involvement of microRNA-7 and the nuclear factor-kappa B/snail family transcriptional repressor 1 axis. Bioengineered. 2022 May;13(5):11668-11683. doi: 10.1080/21655979.2022.2070975. Click
23 Costunolide is a dual inhibitor of MEK1 and AKT1/2 that overcomes osimertinib resistance in lung cancer. Mol Cancer. 2022;21(1):193. Published 2022 Oct 6. doi:10.1186/s12943-022-01662-1 Click
24 Synergistic Anti-Breast-Cancer Effects of Combined Treatment With Oleuropein and Doxorubicin In Vivo. Altern Ther Health Med. 2019 May;25(3):17-24. Click
25 Tubeimoside-I sensitizes temozolomide-resistant glioblastoma cells to chemotherapy by reducing MGMT expression and suppressing EGFR induced PI3K/Akt/mTOR/NF-κB-mediated signaling pathway. Phytomedicine. 2022 May;99:154016. doi: 10.1016/j.phymed.2022.154016. Click
26 Nimbolide enhances the antitumor effect of docetaxel via abrogation of the NF-κB signaling pathway in prostate cancer preclinical models. Biochim Biophys Acta Mol Cell Res. 2022 Dec;1869(12):119344. doi: 10.1016/j.bbamcr.2022.119344. Click
27 Deoxyelephantopin induces apoptosis via oxidative stress and enhances gemcitabine sensitivity in vitro and in vivo through targeting the NF-κB signaling pathway in pancreatic cancer. Aging (Albany NY). 2020 Jun 11;12(11):11116-11138. doi: 10.18632/aging.103327. Click
28 Inactivation of AKT/NF‑κB signaling by eurycomalactone decreases human NSCLC cell viability and improves the chemosensitivity to cisplatin. Oncol Rep. 2020 Oct;44(4):1441-1454. doi: 10.3892/or.2020.7710. Click
29 Gedunin, A Neem Limonoid in Combination with Epalrestat Inhibits Cancer Hallmarks by Attenuating Aldose Reductase-Driven Oncogenic Signaling in SCC131 Oral Cancer Cells. Anticancer Agents Med Chem. 2018;18(14):2042-2052. doi: 10.2174/1871520618666180731093433. Click
30 Enhanced antitumor efficacy by the combination of emodin and gemcitabine against human pancreatic cancer cells via downregulation of the expression of XIAP in vitro and in vivo. Int J Oncol. 2011 Nov;39(5):1123-31. doi: 10.3892/ijo.2011.1115. Click
31 Thymoquinone and cisplatin as a therapeutic combination in lung cancer: In vitro and in vivo. J Exp Clin Cancer Res. 2010 Jul 1;29(1):87. doi: 10.1186/1756-9966-29-87. Click
32 Thymoquinone subdues tumor growth and potentiates the chemopreventive effect of 5-fluorouracil on the early stages of colorectal carcinogenesis in rats. Drug Des Devel Ther. 2016 Jul 11;10:2239-53. doi: 10.2147/DDDT.S109721. Click
33 Indomethacin and juglone inhibit inflammatory molecules to induce apoptosis in colon cancer cells. J Biochem Mol Toxicol. 2020 Feb;34(2):e22433. doi: 10.1002/jbt.22433. Click
34 Rosmarinic acid suppresses inflammation, angiogenesis, and improves paclitaxel induced apoptosis in a breast cancer model via NF3 κB-p53-caspase-3 pathways modulation. J Appl Biomed. 2021 Dec;19(4):202-209. doi: 10.32725/jab.2021.024. Click
35 An in vitro and in vivo investigation of the cytotoxic effects of caffeic acid (3,4-dihydroxycinnamic acid) phenethyl ester and bortezomib in multiple myeloma cells. Turk J Med Sci. 2015;45(1):38-46. doi: 10.3906/sag-1401-127. Click
36 Simvastatin in combination with bergamottin potentiates TNF-induced apoptosis through modulation of NF-κB signalling pathway in human chronic myelogenous leukaemia. Pharm Biol. 2016 Oct;54(10):2050-60. doi: 10.3109/13880209.2016.1141221. Click
37 Obovatol enhances docetaxel-induced prostate and colon cancer cell death through inactivation of nuclear transcription factor-kappaB. J Pharmacol Sci. 2009 Oct;111(2):124-36. doi: 10.1254/jphs.09048fp. Click
38 β-Sitosterol and Gemcitabine Exhibit Synergistic Anti-Pancreatic Cancer Activity by Modulating Apoptosis and Inhibiting Epithelial-Mesenchymal Transition by Deactivating Akt/GSK-3β Signaling. Front Pharmacol. 2020 Nov 20;11:565535. doi: 10.3389/fphar.2020.565535. Click
39 Curcumin reduces paclitaxel resistance in ovarian carcinoma cells by upregulating SNIP1 and inhibiting NFκB activity. Biochem Pharmacol. 2023 Jun;212:115581. doi: 10.1016/j.bcp.2023.115581. Click
40 Curcumin sensitizes human lung cancer cells to apoptosis and metastasis synergistically combined with carboplatin. Exp Biol Med (Maywood). 2015 Nov;240(11):1416-25. doi: 10.1177/1535370215571881. Click
41 Attenuating Smac mimetic compound 3-induced NF-kappaB activation by luteolin leads to synergistic cytotoxicity in cancer cells. J Cell Biochem. 2009 Dec 1;108(5):1125-31. doi: 10.1002/jcb.22346. Click
42 Icariin-mediated inhibition of NF-κB activity enhances the in vitro and in vivo antitumour effect of 5-fluorouracil in colorectal cancer. Cell Biochem Biophys. 2014 Jul;69(3):523-30. doi: 10.1007/s12013-014-9827-5. Click
43 Icariin potentiates the antitumor activity of gemcitabine in gallbladder cancer by suppressing NF-κB. Acta Pharmacol Sin. 2013 Feb;34(2):301-8. doi: 10.1038/aps.2012.162. Click
44 Diosmin in combination with naringenin enhances apoptosis in colon cancer cells. Oncol Rep. 2022 Jan;47(1):4. doi: 10.3892/or.2021.8215. Click
45 Mangiferin enhances the sensitivity of human multiple myeloma cells to anticancer drugs through suppression of the nuclear factor κB pathway. Int J Oncol. 2016 Jun;48(6):2704-12. doi: 10.3892/ijo.2016.3470. Click
46 Neferine increases sensitivities to multiple anticancer drugs via downregulation of Bcl-2 expression in renal cancer cells. Genes Genomics. 2022 Feb;44(2):165-173. doi: 10.1007/s13258-021-01201-0. Click
47 Antitumor activity of gemcitabine can be potentiated in pancreatic cancer through modulation of TLR4/NF-κB signaling by 6-shogaol. AAPS J. 2014 Mar;16(2):246-57. doi: 10.1208/s12248-013-9558-3. Click
48 Synergistic inhibitory effect of cetuximab and tectochrysin on human colon cancer cell growth via inhibition of EGFR signal. Arch Pharm Res. 2016 May;39(5):721-9. doi: 10.1007/s12272-016-0735-7. Click
49 Chebulagic acid synergizes the cytotoxicity of doxorubicin in human hepatocellular carcinoma through COX-2 dependant modulation of MDR-1. Med Chem. 2011 Sep;7(5):432-42. doi: 10.2174/157340611796799087. Click
50 Combination Effects of Hispidin and Gemcitabine via Inhibition of Stemness in Pancreatic Cancer Stem Cells. Anticancer Res. 2018 Jul;38(7):3967-3975. doi: 10.21873/anticanres.12683. Click
51 Synergistic antitumor activity of oridonin and arsenic trioxide on hepatocellular carcinoma cells. Int J Oncol. 2012;40(1):139-147. doi:10.3892/ijo.2011.1210 Click
52 Ethanolic extract of Brazilian green propolis sensitizes prostate cancer cells to TRAIL-induced apoptosis. Int J Oncol. 2011 Apr;38(4):941-53. doi: 10.3892/ijo.2011.930. Click
53 Sulforaphane is Synergistic with CB-5083 and Inhibits Colony Formation of CB-5083-Resistant HCT116 Cells. ChemMedChem. 2022 Jun 3;17(11):e202200030. doi: 10.1002/cmdc.202200030. Click
54 Lycopene sensitizes the cervical cancer cells to cisplatin via targeting nuclear factor- kappa B (NF-κB) pathway. Turk J Med Sci. 2021 Feb 26;51(1):368-374. doi: 10.3906/sag-2005-413. Click
55 Isodon eriocalyx and its bioactive component Eriocalyxin B enhance cytotoxic and apoptotic effects of gemcitabine in pancreatic cancer. Phytomedicine. 2018 May 15;44:56-64. doi: 10.1016/j.phymed.2018.03.055. Click
56 Ginger extract adjuvant to doxorubicin in mammary carcinoma: study of some molecular mechanisms. Eur J Nutr. 2018 Apr;57(3):981-989. doi: 10.1007/s00394-017-1382-6. Click
57 Combined γ-tocotrienol and Met inhibitor treatment suppresses mammary cancer cell proliferation, epithelial-to-mesenchymal transition and migration. Cell Prolif. 2013 Oct;46(5):538-53. doi: 10.1111/cpr.12059. Click
58 {Gamma}-tocotrienol inhibits pancreatic tumors and sensitizes them to gemcitabine treatment by modulating the inflammatory microenvironment. Cancer Res. 2010 Nov 1;70(21):8695-705. doi: 10.1158/0008-5472.CAN-10-2318. Epub 2010 Sep 23. Click
59 γ-Tocotrienol suppresses growth and sensitises human colorectal tumours to capecitabine in a nude mouse xenograft model by down-regulating multiple molecules. Br J Cancer. 2016 Sep 27;115(7):814-24. doi: 10.1038/bjc.2016.257. Click
60 γ-tocotrienol enhances the chemosensitivity of human oral cancer cells to docetaxel through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 Click
61 Cordycepin improves sensitivity to temozolomide in glioblastoma cells by down-regulating MYC. J Cancer Res Clin Oncol. 2023 Nov;149(17):16055-16067. doi: 10.1007/s00432-023-05347-0. Click
62 Enhanced antitumor effect of combination therapy with gemcitabine and guggulsterone in pancreatic cancer. Pancreas. 2012 Oct;41(7):1048-57. doi: 10.1097/MPA.0b013e318249d62e. Click
63 Noscapine Increases the Sensitivity of Drug-Resistant Ovarian Cancer Cell Line SKOV3/DDP to Cisplatin by Regulating Cell Cycle and Activating Apoptotic Pathways. Cell Biochem Biophys. 2015 May;72(1):203-13. doi: 10.1007/s12013-014-0438-y. Click
64 Troxerutin (TXN) potentiated 5-Fluorouracil (5-Fu) treatment of human gastric cancer through suppressing STAT3/NF-κB and Bcl-2 signaling pathways. Biomed Pharmacother. 2017 Aug;92:95-107. doi: 10.1016/j.biopha.2017.04.059. Click
65 Inhibition of NF-κB results in anti-glioma activity and reduces temozolomide-induced chemoresistance by down-regulating MGMT gene expression. Cancer Lett. 2018 Aug 1;428:77-89. doi: 10.1016/j.canlet.2018.04.033. Click
66 Aloe-Emodin Overcomes Anti-Cancer Drug Resistance to Temozolomide and Prevents Colony Formation and Migration in Primary Human Glioblastoma Cell Lines NULU and ZAR. Molecules. 2023 Aug 11;28(16):6024. doi: 10.3390/molecules28166024 Click
67 Olean-28,13b-olide 2 plays a role in cisplatin-mediated apoptosis and reverses cisplatin resistance in human lung cancer through multiple signaling pathways. Biochem Pharmacol. 2019;170:113642. doi:10.1016/j.bcp.2019.113642 Click
It has been 222433 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP