Name | Caspase-8 | ||
UniProt ID | CASP8_HUMAN | ||
Gene Name | CASP8 | ||
Gene ID | 841 | ||
Synonyms |
CASP8, ALPS2B, CAP4, Casp-8, FLICE, MACH, MCH5
|
||
Sequence |
MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLS
FLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSF KFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEE FSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIIN NHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ LMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQAC QGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTW YIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa841 | ||
TTD ID | T15700 | ||
Pfam | PF00656; PF01335; PF02758 |
Pair Name | Eugenol, Sorafenib | |||
Phytochemical Name | Eugenol | |||
Anticancer drug Name | Sorafenib | |||
Disease Info | [ICD-11: 2D10.Z] | Thyroid cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | The most potent apoptotic effect was achieved with sorafenib and eugenol at their IC50. Lower doses of sorafenib could be used with eugenol to improve its efficacy while reducing its side effects. |
Pair Name | Mahanine, Cisplatin | |||
Phytochemical Name | Mahanine | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | Caspase-8 | Cleavage | |
Result | Our results revealed that mahanine may be a prospective agent to reduce the concentration of cisplatin in adjunct for the treatment of cancer and thereby decreasing its toxicity. |
Pair Name | Oleanolic Acid, Doxorubicin | |||
Phytochemical Name | Oleanolic Acid | |||
Anticancer drug Name | Doxorubicin | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | This approach may increase the efficiency of chemotherapy and reduce unintended side effects by lowering the prescribed dose of DOX. |
Pair Name | Rutin, Oxaliplatin | |||
Phytochemical Name | Rutin | |||
Anticancer drug Name | Oxaliplatin | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin |
Pair Name | Usnic acid, Bleomycin | |||
Phytochemical Name | Usnic acid | |||
Anticancer drug Name | Bleomycin | |||
Disease Info | [ICD-11: 2F94] | Ascitic tumor | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin |
Pair Name | [6]-Gingerol, Cisplatin | |||
Phytochemical | [6]-Gingerol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | The findings of the present study demonstrated that the cisplatin and 6-gingerol combination is more effective in inducing apoptosis and suppressing the angiogenesis of ovarian cancer cells than using each drug alone. |
Pair Name | 20(s)-ginsenoside Rh2, TNF-related apoptosis inducing ligand | |||
Phytochemical | 20(s)-ginsenoside Rh2 | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Caspase-8 | Cleavage | |
Result | Our study indicates that Rh2 may act as a sensitizer in combination with TRAIL to increase the efficacy of its anti-tumor activity. |
Pair Name | Amentoflavone, Sorafenib | |||
Phytochemical | Amentoflavone | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Caspase-8 | Expression | |
Result | Our results demonstrated that amentoflavone significantly enhanced sorafenib-inhibited tumor growth and expression of ERK/AKT phosphorylation and anti-apoptotic proteins compared to single-agent treatment. Additionally, amentoflavone also triggered sorafenib-induced apoptosis through extrinsic and intrinsic apoptotic pathways. |
Pair Name | Anacardic Acid, Bortezomib | |||
Phytochemical | Anacardic Acid | |||
Drug | Bortezomib | |||
Disease Info | [ICD-11: 2A83] | Multiple myeloma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | The results of the present study suggest that AA/Bor combination may be a potential therapeutic strategy for MM treatment. |
Pair Name | Apigenin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Apigenin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Apigenin sensitizes cells to TRAIL-induced apoptosis by activating both intrinsic and extrinsic apoptotic pathway-related caspases. The augmented apoptotic effect by TRAIL/apigenin combination was accompanied by triggering mitochondria-dependent signaling pathway, as indicated by Bax/Bcl-2 ratio up-regulation |
Pair Name | Astaxanthin, Cytarabine | |||
Phytochemical | Astaxanthin | |||
Drug | Cytarabine | |||
Disease Info | [ICD-11: 2B33.3] | Acute lymphoblastic leukemia | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | Co-treatment of ASX and Ara-C has synergism effects on apoptosis pathways, cell proliferation inhibition, and decreased inflammation. |
Pair Name | Bakuchiol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Bakuchiol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | The collective results suggest that bakuchiol facilitates TRAIL-induced apoptosis in colon cancer cells through up-regulation of the TRAIL receptors; DR4 and DR5 via ROS/JNK pathway signals. |
Pair Name | Berbamine, Cisplatin | |||
Phytochemical | Berbamine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | This study proposed that the combination therapy of BBR and DDP markedly enhanced more ovarian cancer cell death by inducing apoptosis and necroptosis, which may improve the anticancer effect of chemotherapy drugs. The apoptosis involved the caspase-dependent pathway, while the necroptosis involved the activation of the RIPK3-MLKL pathway. We hope our findings might provide a new insight for the potential of BBR as a therapeutic agent in the treatment of ovarian cancer. |
Pair Name | Beta-Elemene, Cisplatin | |||
Phytochemical | Beta-Elemene | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C94] | Bladder cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | Cisplatin combined with β-elemene as a chemosensitizer warrants further pre-clinical therapeutic studies and may be useful for the treatment of cisplatin-resistant bladder cancer and other types of carcinomas. |
Pair Name | Beta-Elemene, Cisplatin | |||
Phytochemical | Beta-Elemene | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | These data indicate that β-elemene sensitizes chemoresistant ovarian carcinoma cells to cisplatin-induced apoptosis and that the augmented effect of β-elemene on cisplatin cytotoxicity and sensitivity in resistant ovarian tumor cells is mediated through a mitochondria- and caspase-dependent cell death pathway. |
Pair Name | Beta-Elemene, TNF-related apoptosis inducing ligand | |||
Phytochemical | Beta-Elemene | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | Our results suggest that β-elemene increases the sensitivity of gastric cancer cells to TRAIL partially by promoting the formation of DISC in lipid rafts. |
Pair Name | Butein, TNF-related apoptosis inducing ligand | |||
Phytochemical | Butein | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | Our data suggests that combined treatment with butein and TRAIL may provide a safe and effective strategy for treating cancer. |
Pair Name | Cantharidin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Cantharidin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | The results of the present study revealed that cantharidin effectively sensitized cells to TRAIL‑mediated apoptosis and its effects are likely to be mediated by autophagy, the downregulation of c‑FLIP and the upregulation of DR‑5. |
Pair Name | Carnosic acid, Tamoxifen | |||
Phytochemical | Carnosic acid | |||
Drug | Tamoxifen | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Our study supplies a novel therapeutic strategy to induce apoptosis for suppressing breast cancer, which was relied on Caspase-3/TRAIL activation. |
Pair Name | Casticin, Fluorouracil | |||
Phytochemical | Casticin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | We may suggest that 5-FU combined with casticin treatment increased apoptotic cell death in WEHI-3 mouse leukemia cells that may undergo mitochondria and caspases signaling pathways in vitro. |
Pair Name | Celastrol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Celastrol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | The combined use of TRAIL with celastrol may serve as a safe and adequate therapeutic technique for the treatment of TRAIL‑resistant lung cancer, suggesting that celastrol‑mediated autophagy flux inhibition sensitized TRAIL‑initiated apoptosis via regulation of ROS and ΔΨm. |
Pair Name | Celastrol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Celastrol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | The results of our study demonstrate that celastrol sensitizes glioma cells to TRAIL via the death receptor pathway and that DR5 plays an important role in the effects of this cotreatment. The results indicate that this cotreatment is a promising tumor-killing therapeutic strategy with high efficacy and low toxicity. |
Pair Name | Chrysin, Cisplatin | |||
Phytochemical | Chrysin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | The combination of Chrysin and Cisplatin Induces Apoptosis in HepG2 through Down-regulation of cFLIP and Activity of Caspase. |
Pair Name | Chrysin, Cisplatin | |||
Phytochemical | Chrysin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Our results suggest that combination of chrysin and cisplatin is a promising strategy for chemotherapy of human cancers that are resistant to cisplatin. |
Pair Name | Curcumin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Curcumin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C17] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | The present study demonstrates the potential of using curcumin in combination with TRAIL to yield better TRAIL therapy outcomes in TRAIL-resistant CCA. |
Pair Name | Curcumin, TRAIL/Apo2L | |||
Phytochemical | Curcumin | |||
Drug | TRAIL/Apo2L | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Combined curcumin and Apo2L/TRAIL treatment results in enhanced induction of apoptotic cell death. Because curcumin and Apo2L/TRAIL together can activate both the extrinsic and intrinsic pathways of apoptosis, they may circumvent chemoresistance to conventional chemotherapeutic agents. |
Pair Name | Dihydroartemisinin, Doxorubicin | |||
Phytochemical | Dihydroartemisinin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2A81] | Primary effusion lymphoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | DHA is a potentially effective candidate drug for PEL treatment. |
Pair Name | Epigallocatechin gallate, TNF-related apoptosis inducing ligand | |||
Phytochemical | Epigallocatechin gallate | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | Caspase-8 | Expression | |
Result | EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis |
Pair Name | Epigallocatechin gallate, TNF-related apoptosis inducing ligand | |||
Phytochemical | Epigallocatechin gallate | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B6B] | Nasopharyngeal carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | EGCG sensitizes NPC cells to TRAIL-mediated apoptosis via modulation of extrinsic and intrinsic apoptotic pathways and inhibition of NF-κB activation. |
Pair Name | Fisetin, Sorafenib | |||
Phytochemical | Fisetin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | The combination of fisetin and sorafenib exerted better synergistic effects in vitro and in vivo than either agent used alone against human cervical cancer, and this synergism was based on apoptotic potential through a mitochondrial- and DR5-dependent caspase-8/caspase-3 signaling pathway |
Pair Name | Fucoxanthin, Doxorubicin | |||
Phytochemical | Fucoxanthin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | The carotenoid fucoxanthin can sensitize multidrug resistant cancer cells to doxorubicin via induction of apoptosis, inhibition of multidrug resistance proteins and metabolic enzymes |
Pair Name | Gambogic acid, Cisplatin | |||
Phytochemical | Gambogic acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | GA could increase the chemotherapeutic effect of CDDP in human osteosarcoma treatment through inducing the cell cycle arrest and promoting cell apoptosis |
Pair Name | Gambogic Acid, Cisplatin | |||
Phytochemical | Gambogic Acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Gambogic acid sensitises lung cancer cells to CDDP in vitro and in vivo in NSCLC through inactivation of NF-κB and MAPK/HO-1 signalling pathways, providing a rationale for the combined use of CDDP and GA in lung cancer chemotherapy. |
Pair Name | Gambogic Acid, Doxorubicin | |||
Phytochemical | Gambogic Acid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | These findings indicate that GA sensitizes lung cancer cells to ADM in vitro and in vivo, providing a rationale for the combined use of GA and ADM in lung cancer chemotherapy. |
Pair Name | Gambogic Acid, TNF-related apoptosis inducing ligand | |||
Phytochemical | Gambogic Acid | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | These findings may open a new window in the treatment of breast cancer using TRAIL in combination with GA. |
Pair Name | Gamma-Tocotrienol, Docetaxel | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Docetaxel | |||
Disease Info | [ICD-11: 2B66.Z] | Oral cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | These findings suggest that the combination treatment with these agents may provide enhanced therapeutic response in oral cancer patients, while avoiding the toxicity associated with high-dose β-tubulin stabilization monotherapy. |
Pair Name | Homoharringtonine, Suberoylanilide hydroxamic acid (SAHA) | |||
Phytochemical | Homoharringtonine | |||
Drug | Suberoylanilide hydroxamic acid (SAHA) | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | The synergistic effect between HHT and SAHA was blocked partially using a specific anti‑TRAIL antibody. The combination therapy was also found to significantly inhibit the growth of leukemia xenografts in vivo with enhanced apoptosis. These results indicate that, by regulating the induction of TRAIL and activation of the TRAIL apoptotic pathway, it is possible to administer HHT at low concentrations in combination with SAHA as an effective therapeutic approach for the treatment of AML. |
Pair Name | Icariin, Fluorouracil | |||
Phytochemical | Icariin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | We suggest that combination of icariin with 5-FU might offer a therapeutic benefit to the patients with CRC; however, further studies are required to ascertain this proposition. |
Pair Name | Irigenin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Irigenin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Our present study gave new insights into the effects of Iri on potentiating TRAIL-sensitivity, and suggested that Iri could be a potential candidate for sensitizer of TRAIL-resistant cancer cell treatment. |
Pair Name | lambda-Carrageenan Oligosaccharides, Fluorouracil | |||
Phytochemical | lambda-Carrageenan Oligosaccharides | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | These findings suggested that λ-COS could be used as an immune-modulating agent for chemotherapy. |
Pair Name | Licochalcone B, TNF-related apoptosis inducing ligand | |||
Phytochemical | Licochalcone B | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC. |
Pair Name | Liquiritin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Liquiritin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation |
Pair Name | Luteolin, IL-24 | |||
Phytochemical | Luteolin | |||
Drug | IL-24 | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | These data confirm that the synergistic mechanism of VV-IL-24 and luteolin elicits a stronger tumor growth inhibition than any single therapy. Thus, the combination of VV-IL-24 and luteolin could provide the basis for preclinical research in the treatment of liver cancer. |
Pair Name | Luteolin, SMC3 | |||
Phytochemical | Luteolin | |||
Drug | SMC3 | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | The results suggest that combination of SMC3 and luteolin is an effective approach for improving the anticancer value of SMC3, which has implications in cancer prevention and therapy. |
Pair Name | Luteolin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Luteolin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Caspase-8 | Expression | |
Result | Our findings unveil a critical biological function of miR-301-3p in regulating cell proliferation and elevating an antiproliferative effect of TRAIL on cancer cells. Our observation of miR-301-3p/caspase-8 relationship can also serve to clarify the role of miR-301-3p in other cancer types and related diseases. |
Pair Name | Luteolin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Luteolin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Data from this study thus provide strong in vivo evidence supporting that luteolin is a potential sensitizer for TRAIL in anticancer therapy. |
Pair Name | Medicarpin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Medicarpin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B33.1] | Myeloid leukemia | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway |
Pair Name | Morin, Auranofin | |||
Phytochemical | Morin | |||
Drug | Auranofin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Caspase-8 | Expression | |
Result | This study provides evidence that morin can enhance the anticancer activity of AF in Hep3B human hepatocellular carcinoma cells, indicating that its combination could be an alternative treatment strategy for the hepatocellular carcinoma. |
Pair Name | Naringenin, AMG-951 | |||
Phytochemical | Naringenin | |||
Drug | AMG-951 | |||
Disease Info | [ICD-11: 2F7Z] | Glioma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | The present study provides a novel therapeutic strategy for glioma by potentiating APO2L-induced apoptosis via the combination with NG in glioma tumor cells. |
Pair Name | Naringenin, Diosmin | |||
Phytochemical | Naringenin | |||
Drug | Diosmin | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | Diosmin in combination with naringenin enhances apoptosis in colon cancer cells |
Pair Name | Neobavaisoflavone, TNF-related apoptosis inducing ligand | |||
Phytochemical | Neobavaisoflavone | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2F7Z] | Glioma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | Taken together, our results suggest that NBIF reduces the resistance of cancer cells to TRAIL and that the combination of NBIF and TRAIL may be a new therapeutic strategy for treating TRAIL-resistant glioma cells. |
Pair Name | Noscapine, Cisplatin | |||
Phytochemical | Noscapine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Our results suggest that Nos enhanced the anticancer activity of Cis in an additive to synergistic manner by activating multiple signaling pathways including apoptosis. These findings suggest potential benefit for use of Nos and Cis combination in treatment of lung cancer. |
Pair Name | Noscapine, Doxorubicin | |||
Phytochemical | Noscapine | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | Noscapine potentiated the anticancer activity of Doxorubicin in a synergistic manner against TNBC tumors via inactivation of NF-KB and anti-angiogenic pathways while stimulating apoptosis. These findings suggest potential benefit for use of oral Noscapine and Doxorubicin combination therapy for treatment of more aggressive TNBC. |
Pair Name | Noscapine, Gemcitabine | |||
Phytochemical | Noscapine | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | Nos potentiated the anticancer activity of Gem in an additive to synergistic manner against lung cancer via antiangiogenic and apoptotic pathways. These findings suggest potential benefit for use of NGC chemotherapy for treatment of lung cancer. |
Pair Name | Oleandrin, Cisplatin | |||
Phytochemical | Oleandrin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | The combination of oleandrin with cisplatin exerts a synergistic antitumor effect in osteosarcoma, which relates to the activation of the p38 MAPK pathway. |
Pair Name | Parthenolide, Balsalazide | |||
Phytochemical | Parthenolide | |||
Drug | Balsalazide | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Caspase-8 | Expression | |
Result | These results demonstrate that parthenolide potentiates the efficacy of balsalazide through synergistic inhibition of NF-κB activation and the combination of dual agents prevents colon carcinogenesis from chronic inflammation. |
Pair Name | Periplocin, Gemcitabine | |||
Phytochemical | Periplocin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells |
Pair Name | Periplocin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Periplocin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway |
Pair Name | Periplocin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Periplocin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B70.1] | Esophageal squamous cell carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Our data suggest that CPP and TRAIL could be further explored as potential therapeutic approach for esophageal cancer. |
Pair Name | Phenethyl isothiocyanate, Gefitinib | |||
Phytochemical | Phenethyl isothiocyanate | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | We explored the prospect of PEITC in improving the efficacy of targeted drug therapy and demonstrated the synergistic effects and underlined mechanisms of PEITC combined with Gefitinib in NSCLC cells treatment. This study provided useful information for developing novel therapy strategies by combination treatment of PEITC with targeted drugs. |
Pair Name | Phenethyl isothiocyanate, Irinotecan | |||
Phytochemical | Phenethyl isothiocyanate | |||
Drug | Irinotecan | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | PEITC potentiates IRI anticancer activity by promoting cell apoptosis in the human colon HCT 116 cells. Thus, PEITC may be a potential enhancer for IRI in humans as an anticolon cancer drug in the future. |
Pair Name | Plumbagin, rsTRAIL | |||
Phytochemical | Plumbagin | |||
Drug | rsTRAIL | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | Our results suggest that both plumbagin and rsTRAIL could be used as a single agent or synergistical agents to induce apoptosis of leukemic Kasumi‑1 cells in vitro and in vivo. |
Pair Name | Pterostilbene, TNF-related apoptosis inducing ligand | |||
Phytochemical | Pterostilbene | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | Pterostilbene enhances TRAIL-induced apoptosis through the induction of death receptors and downregulation of cell survival proteins in TRAIL-resistance triple negative breast cancer cells |
Pair Name | Quercetin, Doxorubicin | |||
Phytochemical | Quercetin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | These findings demonstrated that quercetin is important in MDR and may be developed into a new reversal agent for cancer chemotherapy. |
Pair Name | Resveratrol, Rapamycin | |||
Phytochemical | Resveratrol | |||
Drug | Rapamycin | |||
Disease Info | [ICD-11: 2D10.1] | Papillary thyroid cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | The present study suggests that the combination of rapamycin and resveratrol may be a promising strategy for the treatment of papillary thyroid cancer. |
Pair Name | Resveratrol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Resveratrol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C90.0] | Renal cell carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | Our data demonstrated that RES plus Ad5/35-TRAIL significantly inhibited RCC xenograft growth in nude mice. These results suggest the possibility of a new combination therapeutic leading to the improvement of RCC treatment. |
Pair Name | Shikonin, 4-hydroxytamoxifen | |||
Phytochemical | Shikonin | |||
Drug | 4-hydroxytamoxifen | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | The combination of SK and 4-OHT shows highly efficient anticancer effects on breast cancer therapy. SK may be a promising candidate as an adjuvant to 4-OHT for breast cancer treatments, especially for ER- breast cancer. |
Pair Name | Shikonin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Shikonin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Caspase-8 | Expression | |
Result | The results indicated that shikonin sensitized resistant cancer cells to TRAIL-induced cytotoxicity via the modulation of the JNK, STAT3 and AKT pathways, the downregulation of antiapoptotic proteins and the upregulation of proapoptotic proteins. |
Pair Name | Shogaol, Gefitinib | |||
Phytochemical | Shogaol | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C73] | Ovarian Cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Our results suggest that 6-shogaol exerts a potential anti-cancer effect in ovarian cancer and combination treatment with 6-shogaol and gefitinib may provide a novel anti-tumor therapeutic strategy in gefitinib-resistant ovarian cancer. |
Pair Name | Silibinin, Paclitaxel | |||
Phytochemical | Silibinin | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines |
Pair Name | Sulforaphane, Fluorouracil | |||
Phytochemical | Sulforaphane | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Caspase-8 | Expression | |
Result | Studies of the interaction mechanism have revealed that sulforaphane and 5-fluorouracil act synergistically in the MDA-MB-231 cells by inducing autophagic cell death and premature senescence. |
Pair Name | Sulforaphane, Fluorouracil | |||
Phytochemical | Sulforaphane | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | An increased cytostatic effect was observed in case of alyssin while for sulforaphane the synergistic interaction with 5-fluorouracil involved an intensification of apoptotic cell death. |
Pair Name | Sulforaphene, Cisplatin | |||
Phytochemical | Sulforaphene | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian Cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | SFE synergistically inhibited proliferation and induced apoptosis of SKOV3 and SNU8 cells in combination with cisplatin by activating multiple apoptotic pathways. Therefore, we suggest sulforaphene as a chemo-enhancing adjuvant to improve the efficacy of cisplatin in ovarian cancer treatment. |
Pair Name | Sulforaphene, Photodynamic therapy | |||
Phytochemical | Sulforaphene | |||
Drug | Photodynamic therapy | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | This study could be useful in the improvement of therapies for human cervical and other types of cancers. |
Pair Name | Tectorigenin, Paclitaxel | |||
Phytochemical | Tectorigenin | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | These data suggest that tectorigenin could sensitize paclitaxel-resistant human ovarian cancer cells through inactivation of the Akt/IKK/IκB/NFκB signaling pathway, and promise a new intervention to chemosensitize paclitaxel-induced cytotoxicity in ovarian cancer. |
Pair Name | Tenacissoside G, Fluorouracil | |||
Phytochemical | Tenacissoside G | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | TG potentiated 5-FU's inhibitory activity to human colorectal cancer through arresting cell cycle progression and inducing p53-mediated apoptosis, which may present a novel strategy in CRC therapies and contribute to the optimizing clinical application of 5-FU. |
Pair Name | Tetrandrine, Sorafenib | |||
Phytochemical | Tetrandrine | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | The antitumour activity of sorafenib plus tetrandrine may be attributed to the induction of the intrinsic apoptosis pathway through ROS/Akt signaling. This finding provides a novel approach that may broaden the clinical application of sorafenib. |
Pair Name | Thymoquinone, Fluorouracil | |||
Phytochemical | Thymoquinone | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | TQ and 5-FU probably showed synergistic effect on both of cell cycle and apoptosis of tested TNBC cell lines. Our study reveals that TQ can synergise 5-FU action, and increase its anticancer efficiency against TNBC cells, which might be good choice in drug development for TNBC treatment. |
Pair Name | Thymoquinone, TNF-related apoptosis inducing ligand | |||
Phytochemical | Thymoquinone | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | The synergistic influence between TQ which induced the DR5 and TRAIL, facilitating the connection between TRAIL and its receptors on the cancerous cell membrane. Hence, the proposed combination therapy induced the ROS-mediated apoptotic stimulus. |
Pair Name | Ursolic acid, Oxaliplatin | |||
Phytochemical | Ursolic acid | |||
Drug | Oxaliplatin | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | These observations suggested that a combination of UA and Oxa elicited synergistically anticancer effects in RKO cells and provided new evidence for potential application of UA and Oxa for CRC treatment. |
Pair Name | Ursolic acid, Sorafenib | |||
Phytochemical | Ursolic acid | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Expression | |
Result | These results suggest that the synergistic antitumor effects of sorafenib combined with ursolic acid may involve the induction of Mcl-1-related apoptosis and SLC7A11-dependent ferroptosis. Our findings may offer a novel effective therapeutic strategy for tumor treatment. |
Pair Name | Zeylenone, Cisplatin | |||
Phytochemical | Zeylenone | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway |
Pair Name | Amentoflavone, Sorafenib | |||
Phytochemical | Amentoflavone | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Amentoflavone not only reversed sorafenib-induced anti-apoptotic protein levels but also enhanced sorafenib-induced pro-apoptotic protein expression in SK-Hep1R cells. In conclusion, amentoflavone may be used as a sorafenib sensitizer to enhance sorafenib-induced cytotoxicity and trigger sorafenib-induced apoptosis through extrinsic and intrinsic pathways in SK-Hep1R cells. |
Pair Name | Decursin, Doxorubicin | |||
Phytochemical | Decursin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Activity | |
Result | AGN would be a potentially novel treatment option for multidrug-resistant tumors by sensitizing to anticancer agents. |
Pair Name | Gambogic acid, Cisplatin | |||
Phytochemical | Gambogic acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Our results demonstrate that GA may be a new potent therapeutic agent useful for targeting human OS cells. |
Pair Name | Liquiritin, Cisplatin | |||
Phytochemical | Liquiritin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | Liquiritin induces apoptosis and autophagy in cisplatin (DDP)-resistant gastric cancer cells in vitro and xenograft nude mice in vivo |
Pair Name | Shogaol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Shogaol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-8 | Cleavage | |
Result | This study gives rise to the possibility of applying shogaol as an antitumor agent that can be used for the purpose of combination treatment with TRAIL in TRAIL-resistant colon tumor therapy. |
No. | Title | Href |
---|---|---|
1 | Eugenol: A New Option in Combination Therapy with Sorafenib for the Treatment of Undifferentiated Thyroid Cancer. Iran J Allergy Asthma Immunol. 2022 Jun 18;21(3):313-321. doi: 10.18502/ijaai.v21i3.9804. | Click |
2 | Improved chemosensitivity in cervical cancer to cisplatin: synergistic activity of mahanine through STAT3 inhibition. Cancer Lett. 2014 Aug 28;351(1):81-90. doi: 10.1016/j.canlet.2014.05.005. | Click |
3 | Oleanolic acid increases the anticancer potency of doxorubicin in pancreatic cancer cells. J Biochem Mol Toxicol. 2023 Oct;37(10):e23426. doi: 10.1002/jbt.23426. | Click |
4 | P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin. Biomed Res Int. 2019 Nov 6;2019:6407210. doi: 10.1155/2019/6407210. | Click |
5 | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. | Click |
6 | The inhibitory effect of 6-gingerol and cisplatin on ovarian cancer and antitumor activity: In silico, in vitro, and in vivo. Front Oncol. 2023 Mar 3;13:1098429. doi: 10.3389/fonc.2023.1098429. | Click |
7 | 20(s)-ginsenoside Rh2 promotes TRAIL-induced apoptosis by upregulating DR5 in human hepatocellular carcinoma cells. Med Oncol. 2022 May 15;39(5):70. doi: 10.1007/s12032-022-01663-6. | Click |
8 | Amentoflavone Enhances the Therapeutic Efficacy of Sorafenib by Inhibiting Anti-apoptotic Potential and Potentiating Apoptosis in Hepatocellular Carcinoma In Vivo. Anticancer Res. 2018 Apr;38(4):2119-2125. doi: 10.21873/anticanres.12452. | Click |
9 | Combined therapeutic effects of bortezomib and anacardic acid on multiple myeloma cells via activation of the endoplasmic reticulum stress response. Mol Med Rep. 2016 Sep;14(3):2679-84. doi: 10.3892/mmr.2016.5533. | Click |
10 | Apigenin Sensitizes Huh-7 Human Hepatocellular Carcinoma Cells to TRAIL-induced Apoptosis. Biomol Ther (Seoul). 2012 Jan;20(1):62-7. doi: 10.4062/biomolther.2012.20.1.062. | Click |
11 | Astaxanthin decreases the growth-inhibitory dose of cytarabine and inflammatory response in the acute lymphoblastic leukemia cell line NALM-6. Mol Biol Rep. 2022 Jul;49(7):6415-6422. doi: 10.1007/s11033-022-07452-8. | Click |
12 | Bakuchiol sensitizes cancer cells to TRAIL through ROS- and JNK-mediated upregulation of death receptors and downregulation of survival proteins. Biochem Biophys Res Commun. 2016 Apr 29;473(2):586-92. doi: 10.1016/j.bbrc.2016.03.127. | Click |
13 | Berberine in combination with cisplatin induces necroptosis and apoptosis in ovarian cancer cells. Biol Res. 2019 Jul 18;52(1):37. doi: 10.1186/s40659-019-0243-6. | Click |
14 | β-Elemene promotes cisplatin-induced cell death in human bladder cancer and other carcinomas. Anticancer Res. 2013 Apr;33(4):1421-8. | Click |
15 | Enhancement of cisplatin-induced apoptosis by β-elemene in resistant human ovarian cancer cells. Med Oncol. 2013 Mar;30(1):424. doi: 10.1007/s12032-012-0424-4. | Click |
16 | β-elemene increases the sensitivity of gastric cancer cells to TRAIL by promoting the formation of DISC in lipid rafts. Cell Biol Int. 2018 Sep;42(10):1377-1385. doi: 10.1002/cbin.11023. | Click |
17 | Butein sensitizes human leukemia cells to apoptosis induced by tumor necrosis factor-related apoptosis inducing ligand (TRAIL). Arch Pharm Res. 2008 Sep;31(9):1179-86. doi: 10.1007/s12272-001-1286-2. | Click |
18 | Downregulation of c‑FLIP and upregulation of DR‑5 by cantharidin sensitizes TRAIL‑mediated apoptosis in prostate cancer cells via autophagy flux. Int J Mol Med. 2020 Jul;46(1):280-288. doi: 10.3892/ijmm.2020.4566. | Click |
19 | Carnosic acid cooperates with tamoxifen to induce apoptosis associated with Caspase-3 activation in breast cancer cells in vitro and in vivo. Biomed Pharmacother. 2017 May;89:827-837. doi: 10.1016/j.biopha.2017.01.084. | Click |
20 | Combinational treatment of 5-fluorouracil and casticin induces apoptosis in mouse leukemia WEHI-3 cells in vitro. Environ Toxicol. 2020 Sep;35(9):911-921. doi: 10.1002/tox.22927. | Click |
21 | Autophagy flux inhibition mediated by celastrol sensitized lung cancer cells to TRAIL‑induced apoptosis via regulation of mitochondrial transmembrane potential and reactive oxygen species. Mol Med Rep. 2019 Feb;19(2):984-993. doi: 10.3892/mmr.2018.9757. | Click |
22 | Celastrol enhances TRAIL-induced apoptosis in human glioblastoma via the death receptor pathwayCelastrol enhances TRAIL-induced apoptosis in human glioblastoma via the death receptor pathway. Cancer Chemother Pharmacol. 2019 Oct;84(4):719-728. doi: 10.1007/s00280-019-03900-8. | Click |
23 | The Combination of Chrysin and Cisplatin Induces Apoptosis in HepG2 through Down-regulation of cFLIP and Activity of Caspase. Anticancer Agents Med Chem. 2023;23(4):432-439. doi: 10.2174/1871520622666220615121525. | Click |
24 | Combination of chrysin and cisplatin promotes the apoptosis of Hep G2 cells by up-regulating p53. Chem Biol Interact. 2015 May 5;232:12-20. doi: 10.1016/j.cbi.2015.03.003. | Click |
25 | Potentiation of TRAIL-Induced Apoptosis in TRAIL-Resistant Cholangiocarcinoma Cells by Curcumin through the Induction of DR5 Membrane Localization and Disruption of the Anti-Apoptotic Complex DR5/DDX3/GSK3β. Asian Pac J Cancer Prev. 2023 Feb 1;24(2):425-434. doi: 10.31557/APJCP.2023.24.2.425. | Click |
26 | Curcumin enhances Apo2L/TRAIL-induced apoptosis in chemoresistant ovarian cancer cells. Gynecol Oncol. 2007 Apr;105(1):104-12. doi: 10.1016/j.ygyno.2006.10.050. | Click |
27 | Dihydroartemisinin Induced Apoptosis and Synergized With Chemotherapy in Pleural Effusion Lymphoma Cells. Anticancer Res. 2023 Mar;43(3):1139-1148. doi: 10.21873/anticanres.16259. | Click |
28 | Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63. doi: 10.1038/sj.onc.1210840. | Click |
29 | EGCG sensitizes human nasopharyngeal carcinoma cells to TRAIL-mediated apoptosis by activation NF-κB. Neoplasma. 2017;64(1):74-80. doi: 10.4149/neo_2017_109. | Click |
30 | Synergistic effect of fisetin combined with sorafenib in human cervical cancer HeLa cells through activation of death receptor-5 mediated caspase-8/caspase-3 and the mitochondria-dependent apoptotic pathway. Tumour Biol. 2016 May;37(5):6987-96. doi: 10.1007/s13277-015-4526-4. | Click |
31 | The carotenoid fucoxanthin can sensitize multidrug resistant cancer cells to doxorubicin via induction of apoptosis, inhibition of multidrug resistance proteins and metabolic enzymes. Phytomedicine. 2020 Oct;77:153280. doi: 10.1016/j.phymed.2020.153280. | Click |
32 | Viability inhibition effect of gambogic acid combined with cisplatin on osteosarcoma cells via mitochondria-independent apoptotic pathway. Mol Cell Biochem. 2013 Oct;382(1-2):243-52. doi: 10.1007/s11010-013-1740-5. | Click |
33 | Gambogic acid synergistically potentiates cisplatin-induced apoptosis in non-small-cell lung cancer through suppressing NF-κB and MAPK/HO-1 signalling. Br J Cancer. 2014 Jan 21;110(2):341-52. doi: 10.1038/bjc.2013.752. | Click |
34 | Suppression of NF-κB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103. doi: 10.2174/1568009613666131113100634. | Click |
35 | Gambogic acid sensitizes breast cancer cells to TRAIL-induced apoptosis by promoting the crosstalk of extrinsic and intrinsic apoptotic signalings. Food Chem Toxicol. 2018 Sep;119:334-341. doi: 10.1016/j.fct.2018.02.037. | Click |
36 | γ-tocotrienol enhances the chemosensitivity of human oral cancer cells to docetaxel through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 | Click |
37 | Homoharringtonine and SAHA synergistically enhance apoptosis in human acute myeloid leukemia cells through upregulation of TRAIL and death receptors. Mol Med Rep. 2013 Jun;7(6):1838-44. doi: 10.3892/mmr.2013.1440. | Click |
38 | Icariin-mediated inhibition of NF-κB activity enhances the in vitro and in vivo antitumour effect of 5-fluorouracil in colorectal cancer. Cell Biochem Biophys. 2014 Jul;69(3):523-30. doi: 10.1007/s12013-014-9827-5. | Click |
39 | Irigenin sensitizes TRAIL-induced apoptosis via enhancing pro-apoptotic molecules in gastric cancer cells. Biochem Biophys Res Commun. 2018 Feb 12;496(3):998-1005. doi: 10.1016/j.bbrc.2018.01.003. | Click |
40 | The Antitumor Potential of λ-Carrageenan Oligosaccharides on Gastric Carcinoma by Immunomodulation. Nutrients. 2023 Apr 24;15(9):2044. doi: 10.3390/nu15092044. | Click |
41 | Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. | Click |
42 | Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation. Biomed Pharmacother. 2017 Sep;93:948-960. doi: 10.1016/j.biopha.2017.06.095. | Click |
43 | Luteolin enhances the antitumor efficacy of oncolytic vaccinia virus that harbors IL-24 gene in liver cancer cells. J Clin Lab Anal. 2021 Mar;35(3):e23677. doi: 10.1002/jcla.23677. | Click |
44 | Attenuating Smac mimetic compound 3-induced NF-kappaB activation by luteolin leads to synergistic cytotoxicity in cancer cells. J Cell Biochem. 2009 Dec 1;108(5):1125-31. doi: 10.1002/jcb.22346. | Click |
45 | Luteolin-regulated MicroRNA-301-3p Targets Caspase-8 and Modulates TRAIL Sensitivity in PANC-1 Cells. Anticancer Res. 2020 Feb;40(2):723-731. doi: 10.21873/anticanres.14003. | Click |
46 | Luteolin enhances TNF-related apoptosis-inducing ligand's anticancer activity in a lung cancer xenograft mouse model. Biochem Biophys Res Commun. 2012 Jan 13;417(2):842-6. doi: 10.1016/j.bbrc.2011.12.055. | Click |
47 | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. | Click |
48 | Morin enhances auranofin anticancer activity by up-regulation of DR4 and DR5 and modulation of Bcl-2 through reactive oxygen species generation in Hep3B human hepatocellular carcinoma cells. Phytother Res. 2019 May;33(5):1384-1393. doi: 10.1002/ptr.6329. | Click |
49 | Glioma progression is suppressed by Naringenin and APO2L combination therapy via the activation of apoptosis in vitro and in vivo. Invest New Drugs. 2020 Dec;38(6):1743-1754. doi: 10.1007/s10637-020-00979-2. | Click |
50 | Diosmin in combination with naringenin enhances apoptosis in colon cancer cells. Oncol Rep. 2022 Jan;47(1):4. doi: 10.3892/or.2021.8215. | Click |
51 | Neobavaisoflavone sensitizes apoptosis via the inhibition of metastasis in TRAIL-resistant human glioma U373MG cells. Life Sci. 2014 Jan 30;95(2):101-7. doi: 10.1016/j.lfs.2013.10.035. | Click |
52 | Anticancer activity of Noscapine, an opioid alkaloid in combination with Cisplatin in human non-small cell lung cancer. Lung Cancer. 2011 Mar;71(3):271-82. doi: 10.1016/j.lungcan.2010.06.002. | Click |
53 | Antitumor activity of Noscapine in combination with Doxorubicin in triple negative breast cancer. PLoS One. 2011 Mar 15;6(3):e17733. doi: 10.1371/journal.pone.0017733. | Click |
54 | Enhanced anticancer activity of gemcitabine in combination with noscapine via antiangiogenic and apoptotic pathway against non-small cell lung cancer. PLoS One. 2011;6(11):e27394. doi: 10.1371/journal.pone.0027394. | Click |
55 | Oleandrin synergizes with cisplatin in human osteosarcoma cells by enhancing cell apoptosis through activation of the p38 MAPK signaling pathway. Cancer Chemother Pharmacol. 2018 Dec;82(6):1009-1020. doi: 10.1007/s00280-018-3692-7. | Click |
56 | Combined Parthenolide and Balsalazide Have Enhanced Antitumor Efficacy Through Blockade of NF-κB Activation. Mol Cancer Res. 2017 Feb;15(2):141-151. doi: 10.1158/1541-7786.MCR-16-0101. | Click |
57 | Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells. Biomed Pharmacother. 2023 Jan;157:114039. doi: 10.1016/j.biopha.2022.114039. | Click |
58 | Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway. Mol Carcinog. 2019 Jun;58(6):1033-1045. doi: 10.1002/mc.22991. | Click |
59 | Combination of the natural compound Periplocin and TRAIL induce esophageal squamous cell carcinoma apoptosis in vitro and in vivo: Implication in anticancer therapy. J Exp Clin Cancer Res. 2019 Dec 21;38(1):501. doi: 10.1186/s13046-019-1498-z. | Click |
60 | Phenethyl isothiocyanate synergistically induces apoptosis with Gefitinib in non-small cell lung cancer cells via endoplasmic reticulum stress-mediated degradation of Mcl-1. Mol Carcinog. 2020 Jun;59(6):590-603. doi: 10.1002/mc.23184. | Click |
61 | Phenethyl isothiocyanate and irinotecan synergistically induce cell apoptosis in colon cancer HCT 116 cells in vitro. Environ Toxicol. 2024 Jan;39(1):457-469. doi: 10.1002/tox.23993. | Click |
62 | Plumbagin enhances TRAIL-induced apoptosis of human leukemic Kasumi‑1 cells through upregulation of TRAIL death receptor expression, activation of caspase-8 and inhibition of cFLIP. Oncol Rep. 2017;37(6):3423-3432. doi:10.3892/or.2017.5627 | Click |
63 | Pterostilbene Enhances TRAIL-Induced Apoptosis through the Induction of Death Receptors and Downregulation of Cell Survival Proteins in TRAIL-Resistance Triple Negative Breast Cancer Cells. J Agric Food Chem. 2017 Dec 27;65(51):11179-11191. doi: 10.1021/acs.jafc.7b02358. | Click |
64 | Quercetin enhances adriamycin cytotoxicity through induction of apoptosis and regulation of mitogen-activated protein kinase/extracellular signal-regulated kinase/c-Jun N-terminal kinase signaling in multidrug-resistant leukemia K562 cells. Mol Med Rep. 2015 Jan;11(1):341-8. doi: 10.3892/mmr.2014.2734. | Click |
65 | Resveratrol potentiates the anti-tumor effects of rapamycin in papillary thyroid cancer: PI3K/AKT/mTOR pathway involved. Arch Biochem Biophys. 2020 Aug 15;689:108461. doi: 10.1016/j.abb.2020.108461. | Click |
66 | Mechanism and therapeutic prospect of resveratrol combined with TRAIL in the treatment of renal cell carcinoma. Cancer Gene Ther. 2020 Aug;27(7-8):619-623. doi: 10.1038/s41417-019-0150-6. | Click |
67 | Shikonin and 4-hydroxytamoxifen synergistically inhibit the proliferation of breast cancer cells through activating apoptosis signaling pathway in vitro and in vivo. Chin Med. 2020 Mar 10;15:23. doi: 10.1186/s13020-020-00305-1. | Click |
68 | Shikonin sensitizes A549 cells to TRAIL-induced apoptosis through the JNK, STAT3 and AKT pathways. BMC Cell Biol. 2018 Dec 29;19(1):29. doi: 10.1186/s12860-018-0179-7. | Click |
69 | 6-Shogaol Overcomes Gefitinib Resistance via ER Stress in Ovarian Cancer Cells. Int J Mol Sci. 2023 Jan 30;24(3):2639. doi: 10.3390/ijms24032639. | Click |
70 | Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines. Mol Med Rep. 2018 Aug;18(2):1835-1841. doi: 10.3892/mmr.2018.9129. | Click |
71 | Autophagic cell death and premature senescence: New mechanism of 5-fluorouracil and sulforaphane synergistic anticancer effect in MDA-MB-231 triple negative breast cancer cell line. Food Chem Toxicol. 2018 Jan;111:1-8. doi: 10.1016/j.fct.2017.10.056. | Click |
72 | In Vitro Evaluation of Sulforaphane and a Natural Analog as Potent Inducers of 5-Fluorouracil Anticancer Activity. Molecules. 2018 Nov 21;23(11):3040. doi: 10.3390/molecules23113040. | Click |
73 | Sulforaphene Synergistically Sensitizes Cisplatin via Enhanced Mitochondrial Dysfunction and PI3K/PTEN Modulation in Ovarian Cancer Cells. Anticancer Res. 2015 Jul;35(7):3901-8. | Click |
74 | Evaluation of synergistic effects of sulforaphene with photodynamic therapy in human cervical cancer cell line. Lasers Med Sci. 2016 Nov;31(8):1675-1682. doi: 10.1007/s10103-016-2037-1. | Click |
75 | Tectorigenin sensitizes paclitaxel-resistant human ovarian cancer cells through downregulation of the Akt and NFκB pathway. Carcinogenesis. 2012 Dec;33(12):2488-98. doi: 10.1093/carcin/bgs302. | Click |
76 | Tenacissoside G synergistically potentiates inhibitory effects of 5-fluorouracil to human colorectal cancer. Phytomedicine. 2021 Jun;86:153553. doi: 10.1016/j.phymed.2021.153553. | Click |
77 | Synergistic antitumour activity of sorafenib in combination with tetrandrine is mediated by reactive oxygen species (ROS)/Akt signaling. Br J Cancer. 2013 Jul 23;109(2):342-50. doi: 10.1038/bjc.2013.334. | Click |
78 | Synergistic Role of Thymoquinone on Anticancer Activity of 5-Fluorouracil in Triple Negative Breast Cancer Cells. Anticancer Agents Med Chem. 2022;22(6):1111-1118. doi: 10.2174/1871520621666210624111613. | Click |
79 | Thymoquinone Crosstalks with DR5 to Sensitize TRAIL Resistance and Stimulate ROS-Mediated Cancer Apoptosis. Asian Pac J Cancer Prev. 2021 Sep 1;22(9):2855-2865. doi: 10.31557/APJCP.2021.22.9.2855. | Click |
80 | Ursolic acid potentiated oxaliplatin to induce apoptosis in colorectal cancer RKO cells. Pharmazie. 2020 Jun 1;75(6):246-249. doi: 10.1691/ph.2020.0417. | Click |
81 | Ursolic acid enhances the antitumor effects of sorafenib associated with Mcl-1-related apoptosis and SLC7A11-dependent ferroptosis in human cancer. Pharmacol Res. 2022 Aug;182:106306. doi: 10.1016/j.phrs.2022.106306. | Click |
82 | Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway. Phytother Res. 2021 Oct;35(10):5899-5918. doi: 10.1002/ptr.7299 | Click |
83 | Amentoflavone enhances sorafenib-induced apoptosis through extrinsic and intrinsic pathways in sorafenib-resistant hepatocellular carcinoma SK-Hep1 cells in vitro. Oncol Lett. 2017 Sep;14(3):3229-3234. doi: 10.3892/ol.2017.6540. | Click |
84 | Decursin in Angelica gigas Nakai (AGN) Enhances Doxorubicin Chemosensitivity in NCI/ADR-RES Ovarian Cancer Cells via Inhibition of P-glycoprotein Expression. Phytother Res. 2016 Dec;30(12):2020-2026. doi: 10.1002/ptr.5708. | Click |
85 | Hypoxia-induced resistance to cisplatin-mediated apoptosis in osteosarcoma cells is reversed by gambogic acid independently of HIF-1α. Mol Cell Biochem. 2016 Sep;420(1-2):1-8. doi: 10.1007/s11010-016-2759-1. | Click |
86 | Liquiritin induces apoptosis and autophagy in cisplatin (DDP)-resistant gastric cancer cells in vitro and xenograft nude mice in vivo. Int J Oncol. 2017 Nov;51(5):1383-1394. doi: 10.3892/ijo.2017.4134. | Click |
87 | Shogaol overcomes TRAIL resistance in colon cancer cells via inhibiting of survivin. Tumour Biol. 2015 Nov;36(11):8819-29. doi: 10.1007/s13277-015-3629-2. | Click |