
| Name | Serine/threonine-protein kinase mTOR | ||
| UniProt ID | MTOR_HUMAN | ||
| Gene Name | MTOR | ||
| Gene ID | 2475 | ||
| Synonyms |
MTOR, FRAP, FRAP1, FRAP2, RAFT1, RAPT1, SKS
|
||
| Sequence |
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESR CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSP TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD VPTQVELLIKQATSHENLCQCYIGWCPFW |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 2.A.18.9.1; 2.A.23.3.3; 2.A.74.1.3; 8.A.188.1.1; 8.A.58.1.3; 8.A.75.1.5; 8.A.87.2.1; 8.A.9.2.2; | ||
| KEGG ID | hsa2475 | ||
| TTD ID | T75243 | ||
| Pfam | PF00275; PF00454; PF02259; PF02260; PF05004; PF08064; PF08771; PF11865; PF13513; PF13646 | ||
| Pair Name | Kuromanin chloride, Cisplatin | |||
| Phytochemical Name | Kuromanin chloride | |||
| Anticancer drug Name | Cisplatin | |||
| Disease Info | [ICD-11: 2C77.Z] | Cervical cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells | |||
| Pair Name | Ononin, Paclitaxel | |||
| Phytochemical Name | Ononin | |||
| Anticancer drug Name | Paclitaxel | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | Our findings suggested that the therapeutic index of PTX-based chemotherapy could be improved by reducing toxicity with increasing antitumor capabilities when combined with ononin. | |||
| Pair Name | Silibinin, Regorafenib | |||
| Phytochemical Name | Silibinin | |||
| Anticancer drug Name | Regorafenib | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | The present study suggests that silybin in combination with regorafenib is a promising strategy for treatment of metastatic colorectal patients. | |||
| Pair Name | Artesunate, Fluorouracil | |||
| Phytochemical Name | Artesunate | |||
| Anticancer drug Name | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Our findings point to the crucial treatment effect of Arte on inflammation, intestinal cell senescence, and CRC cell proliferation and offer a new option for CRC treatment. | |||
| Pair Name | Magnoflorine, Doxorubicin | |||
| Phytochemical Name | Magnoflorine | |||
| Anticancer drug Name | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Magnoflorine improves sensitivity to doxorubicin (DOX) of breast cancer cells via inducing apoptosis and autophagy through AKT/mTOR and p38 signaling pathways | |||
| Pair Name | Polyphyllin I, Cisplatin | |||
| Phytochemical | Polyphyllin I | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | The results from the present study demonstrated that PPI and PPVII may function as chemosensitizers by enhancing apoptosis via the p53 pathway, reversing EMT and suppressing the CIP2A/AKT/mTOR signaling axis, and the combination with DDP may be a promising strategy for the development of new therapeutic agents. | |||
| Pair Name | Luteolin, Erlotinib | |||
| Phytochemical | Luteolin | |||
| Drug | Erlotinib | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | These findings suggest that combining luteolin with erlotinib offers a potential treatment strategy for glioblastoma multiforme IV. | |||
| Pair Name | Fisetin, Fluorouracil | |||
| Phytochemical | Fisetin | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer | |||
| Pair Name | Fisetin, Sorafenib | |||
| Phytochemical | Fisetin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | Fisetin potentiates sorafenib-induced apoptosis and abrogates tumor growth in athymic nude mice implanted with BRAF-mutated melanoma cells. | |||
| Pair Name | Baicalein, Cisplatin | |||
| Phytochemical | Baicalein | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway | |||
| Pair Name | Baicalein, Cisplatin | |||
| Phytochemical | Baicalein | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Treatment with baicalein improved the sensitivity of ovarian cancer cells to cisplatin and inhibited cell proliferation, metastasis and tumor growth | |||
| Pair Name | Nobiletin, Vorinostat | |||
| Phytochemical | Nobiletin | |||
| Drug | Vorinostat | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | The combination of nobiletin with vorinostat increased histone H3K9 and H3K27 acetylation levels in SCLC mouse tumor tissue and enhanced the expression of the BH3-only proteins BIM and BID. We conclude that nobiletin is a novel natural BH3 mimetic that can cooperate with vorinostat to induce apoptosis and autophagy in SCLC. | |||
| Pair Name | Isorhamnetin, Doxorubicin | |||
| Phytochemical | Isorhamnetin | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | Isorhamnetin induces cell cycle arrest and apoptosis by triggering DNA damage and regulating the AMPK/mTOR/p70S6K signaling pathway in doxorubicin-resistant breast cancer | |||
| Pair Name | Celastrol, Tamoxifen | |||
| Phytochemical | Celastrol | |||
| Drug | Tamoxifen | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | The Synergistic Effects of Celastrol in combination with Tamoxifen on Apoptosis and Autophagy in MCF-7 Cells | |||
| Pair Name | Artesunate, Metformin | |||
| Phytochemical | Artesunate | |||
| Drug | Metformin | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | The study findings suggest that MET used in combination with ART can induce autophagy-dependent apoptosis in GBM cells by activating the ROS-AMPK-mTOR pathway, providing a potential new treatment for GBM. | |||
| Pair Name | Oridonin, Imatinib | |||
| Phytochemical | Oridonin | |||
| Drug | Imatinib | |||
| Disease Info | [ICD-11: 2B33.3] | Acute lymphoblastic leukemia | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | Our data showed that oridonin remarkably suppressed activations of Akt/mTOR, Raf/MEK and STAT5 pathway in these primary specimens and oridonin with imatinib exerted synergetic suppressive effects on mTOR, STAT5 and LYN signaling in one imatinib resistant patient specimen. Additional evaluation of oridonin as a potential therapeutic agent for Ph+ ALL seems warranted. | |||
| Pair Name | Astragaloside IV, Bevacizumab | |||
| Phytochemical | Astragaloside IV | |||
| Drug | Bevacizumab | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | This paper demonstrates that AST-IV enhances the effect of BV on inhibiting proliferation and promoting apoptosis of lung adenocarcinoma cells through inhibiting autophagy pathway. | |||
| Pair Name | Betulinic Acid, Sorafenib | |||
| Phytochemical | Betulinic Acid | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | We showed that combination therapy with low concentrations of sorafenib and betulinic acid had the capacity to induce high levels of cell death and abolish clonogenic activity in some NSCLC cell lines regardless of KRAS mutations. | |||
| Pair Name | Ursolic acid, Doxorubicin | |||
| Phytochemical | Ursolic acid | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Ursolic acid augments the chemosensitivity of drug-resistant breast cancer cells to doxorubicin by AMPK-mediated mitochondrial dysfunction | |||
| Pair Name | Genipin, Everolimus | |||
| Phytochemical | Genipin | |||
| Drug | Everolimus | |||
| Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
| Regulate Info | Up-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | These results reveal novel mechanisms through which UCP2 promotes cancer cell proliferation and support the combined inhibition of UCP2 and of Akt/mTOR pathway as a novel therapeutic strategy in the treatment of pancreatic adenocarcinoma. | |||
| Pair Name | Tanshinone IIA, Nutlin-3 | |||
| Phytochemical | Tanshinone IIA | |||
| Drug | Nutlin-3 | |||
| Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | The results of this study demonstrate that the Nutlin-3 plus Tanshinone IIA combination exerts synergistic anti-leukemia effects by regulating the p53 and AKT/mTOR pathways, although further investigation is warranted. Small-molecule MDM2 antagonists plus Tanshinone IIA may thus be a promising strategy for the treatment of acute leukemia. | |||
| Pair Name | Ginsenoside Rg3, Endostar | |||
| Phytochemical | Ginsenoside Rg3 | |||
| Drug | Endostar | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | Endostar combined with ginsenoside Rg3 has stronger inhibiting effect on breast cancer tumor growth in tumor-bearing mice than single drug, and it can inhibit angiogenesis and cell invasion, and enhance cell autophagy. | |||
| Pair Name | Rhizoma Paridis saponins, Sorafenib | |||
| Phytochemical | Rhizoma Paridis saponins | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | All of that provided possibility to overcome the intolerance of sorafenib by drug compatibility through protection against mitochondria damage, inhibition of anaerobic glycolysis and suppression of lipid synthesis based on PI3K/Akt/mTOR pathway. | |||
| Pair Name | Cucurbitacin B, Cisplatin | |||
| Phytochemical | Cucurbitacin B | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C94.Z] | Bladder cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Our results showed that CuB may be a new agent that can support conventional treatment in bladder cancer. Our study is important in terms of enlightening new pathways and developing new treatment methods in the treatment of bladder cancer. | |||
| Pair Name | Tubeimoside I, Temozolomide | |||
| Phytochemical | Tubeimoside I | |||
| Drug | Temozolomide | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | We first demonstrated that synergistic effects of TBMS1 and TMZ induced apoptosis in GBM cells through reducing MGMT expression and inhibiting the EGFR induced PI3K/Akt/mTOR/NF-κB signaling pathway. This study provides a rationale for combined application of TMZ and TBMS1 as a potential chemotherapeutic treatment for MGMT+ GBM patients. | |||
| Pair Name | Shikonin, Doxorubicin | |||
| Phytochemical | Shikonin | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2B33.5] | Lymphoma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | These data suggest that shikonin may be an encouraging chemotherapeutic agent in the clinical treatment of BL. | |||
| Pair Name | Emodin, Cytarabine | |||
| Phytochemical | Emodin | |||
| Drug | Cytarabine | |||
| Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Emodin and its combination with Ara-C may be considered a promising therapeutic approach in AML and worthy of further investigation. | |||
| Pair Name | Tanshinone IIA, Imatinib | |||
| Phytochemical | Tanshinone IIA | |||
| Drug | Imatinib | |||
| Disease Info | [ICD-11: 2A20.1] | Chronic myelogenous leukemia | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | The results revealed that Tan IIA enhanced the inhibitory effect of imatinib on TIB‑152 cell proliferation, migration and invasion, and induced apoptosis, which may be associated with inhibition of the PI3K/AKT/mTOR signaling pathway. | |||
| Pair Name | Rhein, Pemetrexed | |||
| Phytochemical | Rhein | |||
| Drug | Pemetrexed | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | Our findings demonstrated that the potential application of rhein as a candidate drug in combination with PTX is promising for treatment of the human lung cancer. | |||
| Pair Name | Plumbagin, Cisplatin | |||
| Phytochemical | Plumbagin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B62.0] | Tongue squamous cell carcinoma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | PLB combined with cisplatin is a potential therapeutic strategy against therapy TSCC cisplatin resistance. | |||
| Pair Name | Aloin, Metformin | |||
| Phytochemical | Aloin | |||
| Drug | Metformin | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Serine/threonine-protein kinase mTOR | Activity | |
| Result | Our research demonstrated that the concomitant treatment with aloin and MET enhances the antitumor effect by inhibiting the growth and invasion as well as inducing apoptosis and autophagy in HCC through PI3K/AKT/mTOR pathway. | |||
| Pair Name | Aloin, Irinotecan | |||
| Phytochemical | Aloin | |||
| Drug | Irinotecan | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Our findings suggests that CPT-11 and Aloin are potential combination treatment partners against colorectal cancer. MicroRNA-133b may serve as a co-therapeutic target with IGF1R against colorectal cancer, which might overcome the existing treatment limitations. | |||
| Pair Name | Decursin, Doxorubicin | |||
| Phytochemical | Decursin | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2A83.1] | Multiple myeloma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | The combination treatment of decursin and doxorubicin can enhance apoptotic activity via mTOR and/or STAT3 signaling pathway in multiple myeloma cells. | |||
| Pair Name | Magnolin, B-RAF Inhibitors | |||
| Phytochemical | Magnolin | |||
| Drug | B-RAF Inhibitors | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway | |||
| Pair Name | Bufalin, Sorafenib | |||
| Phytochemical | Bufalin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | The results revealed a synergistic anti-hepatoma effect of bufalin combined with sorafenib via affecting the tumor vascular microenvironment by targeting mTOR/VEGF signaling. | |||
| Pair Name | OSW-1, Carboplatin | |||
| Phytochemical | OSW-1 | |||
| Drug | Carboplatin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Our data revealed the mode of action and molecular mechanism underlying the effect of OSW-1 against TNBC, and provided a useful guidance for improving the sensitivity of TNBC cells to conventional chemotherapeutic drugs, which warrants further investigation. | |||
| Pair Name | Resveratrol, Sorafenib | |||
| Phytochemical | Resveratrol | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C90.0] | Renal cell carcinoma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | PEGylated resveratrol combined with sorafenib can achieve synergistic anti-RCC activity, and the mechanism may be related to the inhibition of Akt/mTOR/p70S6k-4EBP-1 and c-Raf7MEK/ERK signaling pathways. | |||
| Pair Name | Curcumin, Docetaxel | |||
| Phytochemical | Curcumin | |||
| Drug | Docetaxel | |||
| Disease Info | [ICD-11: 2B70] | Esophageal cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | CUR combined with DTX induced apoptosis and autophagy of ESCC and probably worked through the PI3K/AKT/mTOR signaling pathway. The combination of the autophagy inhibitor, CUR and DTX may become a new treatment strategy for esophageal cancer. | |||
| Pair Name | Capsaicin, Docetaxel | |||
| Phytochemical | Capsaicin | |||
| Drug | Docetaxel | |||
| Disease Info | [ICD-11: 2C82.0] | Prostate cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | We showed that the synergistic anti-proliferative effect may be attributed to two independent effects: Inhibition of the PI3K/Akt/mTOR signaling pathway by one side, and AMPK activation by the other. In vivo experiments confirmed the synergistic effects of docetaxel and capsaicin in reducing the tumor growth of PC3 cells. | |||
| Pair Name | alpha-Mangostin, Sorafenib | |||
| Phytochemical | alpha-Mangostin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Our results highlight the synergistic effect of the combination of sorafenib and α-Mangostin, which indicates a potential treatment for advanced HCC for patients that are not sensitive to sorafenib therapy. | |||
| Pair Name | Quercitrin, Insulin | |||
| Phytochemical | Quercitrin | |||
| Drug | Insulin | |||
| Disease Info | [ICD-11: 5A80] | Polycystic ovary syndrome | Investigative | |
| Regulate Info | Up-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | PM20D1 and PI3K/Akt were required for lipolysis and endocrine regulation in PCOS-IR to restore ovarian function and maintain normal endocrine metabolism. By upregulating the expression of PM20D1, quercitrin activated the PI3K/Akt signaling pathway, improved adipocyte catabolism, corrected reproductive and metabolic abnormalities, and had a therapeutic effect on PCOS-IR. | |||
| Pair Name | Shogaol, Fluorouracil | |||
| Phytochemical | Shogaol | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Influence of 6-shogaol potentiated on 5-fluorouracil treatment of liver cancer by promoting apoptosis and cell cycle arrest by regulating AKT/mTOR/MRP1 signalling | |||
| Pair Name | Gossypol, Fluorouracil | |||
| Phytochemical | Gossypol | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | These findings suggest that gossypol-mediated down-regulation of TS, cyclin D1, and the mTOR/p70S6K1 signaling pathways enhances the anti-tumor effect of 5-FU. Ultimately, our data exposed a new action for gossypol as an enhancer of 5-FU-induced cell growth suppression. | |||
| Pair Name | Quercetin, Cisplatin | |||
| Phytochemical | Quercetin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | This study provides further new data for the mechanism by which the QU pre-treatment re-sensitizes SKOV-3/CDDP cells to cisplatin. | |||
| Pair Name | Bisdemethoxycucurmin, Rapamycin | |||
| Phytochemical | Bisdemethoxycucurmin | |||
| Drug | Rapamycin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Activity | |
| Result | Bisdemethoxycurcumin Promotes Apoptosis and Inhibits the Epithelial-Mesenchymal Transition through the Inhibition of the G-Protein-Coupled Receptor 161/Mammalian Target of Rapamycin Signaling Pathway in Triple Negative Breast Cancer Cells. | |||
| Pair Name | Vitamin C, Cimetidine | |||
| Phytochemical | Vitamin C | |||
| Drug | Cimetidine | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | We concluded that the synergistic combination provided a promising anti-neoplastic effect via reducing the angiogenesis, oxidative stress, increasing apoptosis,as well as inhibiting the activation of PI3K/AKT/mTOR cue, and suggesting its use as a treatment option for breast cancer. | |||
| Pair Name | Sulforaphane, Cisplatin | |||
| Phytochemical | Sulforaphane | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C28] | Malignant mesothelioma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Pro-oxidant activity of sulforaphane and cisplatin potentiates apoptosis and simultaneously promotes autophagy in malignant mesothelioma cells | |||
| Pair Name | Lycopene, Eicosapentaenoic acid | |||
| Phytochemical | Lycopene | |||
| Drug | Eicosapentaenoic acid | |||
| Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Our novel findings suggest that lycopene and EPA synergistically inhibited the growth of human colon cancer HT-29 cells even at low concentration. The inhibitory effects of lycopene and EPA on cell proliferation of human colon cancer HT-29 cells were, in part, associated with the down-regulation of the PI-3K/Akt/mTOR signaling pathway. | |||
| Pair Name | Cordycepin, Cisplatin | |||
| Phytochemical | Cordycepin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | This study provides comprehensive evidence that cordycepin inhibits osteosarcoma cell growth and invasion and induces osteosarcoma cell apoptosis by activating AMPK and inhibiting the AKT/mTOR signaling pathway and enhances the sensitivity of osteosarcoma cells to cisplatin, suggesting that cordycepin is a promising treatment for osteosarcoma. | |||
| Pair Name | Geraniol, Fluorouracil | |||
| Phytochemical | Geraniol | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | It can be concluded that geraniol could represent a promising avenue for breast cancer treatment as well as a potential sensitizing agent when combined with chemotherapeutic drugs. | |||
| Pair Name | Vinpocetine, Sorafenib | |||
| Phytochemical | Vinpocetine | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Vinpocetine may be a potential candidate for sorafenib sensitization and HCC treatment, and our results may help to elucidate more effective therapeutic options for HCC patients with sorafenib resistance. | |||
| Pair Name | Celastrol, Cisplatin | |||
| Phytochemical | Celastrol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | Celastrol can inhibit the proliferation of the SGC7901/DDP cells, induce their apoptosis, and reduce the expression of drug resistance genes, probably by inhibiting the expression of the proteins related to the mTOR signaling pathway | |||
| Pair Name | Epigallocatechin gallate, Osimertinib | |||
| Phytochemical | Epigallocatechin gallate | |||
| Drug | Osimertinib | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | The combined use of EGFR-TKIs and EGCG significantly reversed the Warburg effect by suppressing glycolysis while boosting mitochondrial respiration, which was accompanied by increased cellular ROS and decreased lactate secretion. The combination effectively activated the AMPK pathway while inhibited both ERK/MAPK and AKT/mTOR pathways, leading to cell cycle arrest and apoptosis, particularly in drug-resistant NSCLC cells. The in vivo results obtained from mouse tumor xenograft model confirmed that EGCG effectively overcame osimertinib resistance. | |||
| Pair Name | Caffeic acid phenethyl ester, Doxorubicin | |||
| Phytochemical | Caffeic acid phenethyl ester | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Our results suggest that CAPE treatment reversed DOX resistance in breast cancer cells, at least in part by inhibiting Akt/mTOR/SREBP1 pathway-mediated lipid metabolism, indicating that CAPE may be an effective substance to assist in the treatment of breast cancer. | |||
| Pair Name | Curcumin, Lenvatinib | |||
| Phytochemical | Curcumin | |||
| Drug | Lenvatinib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Expression | |
| Result | We report that Curcumin reverses Lenvatinib resistance in HCC, and that their combination has clinical application potential for adjunctive treatment in HCC. | |||
| Pair Name | Cordycepin, Cisplatin | |||
| Phytochemical | Cordycepin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Serine/threonine-protein kinase mTOR | Phosphorylation | |
| Result | Our results suggested that Cor in combination with DDP could be an additional therapeutic option for the treatment of DDP-resistant NSCLC. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells. J Food Sci. 2021 Jun;86(6):2700-2712. doi: 10.1111/1750-3841.15740. | Click |
| 2 | Antitumor Effects of Ononin by Modulation of Apoptosis in Non-Small-Cell Lung Cancer through Inhibiting PI3K/Akt/mTOR Pathway. Oxid Med Cell Longev. 2022 Dec 27;2022:5122448. doi: 10.1155/2022/5122448. | Click |
| 3 | Regorafenib in combination with silybin as a novel potential strategy for the treatment of metastatic colorectal cancer. Oncotarget. 2017 Aug 7;8(40):68305-68316. doi: 10.18632/oncotarget.20054. | Click |
| 4 | Artesunate alleviates 5-fluorouracil-induced intestinal damage by suppressing cellular senescence and enhances its antitumor activity. Discov Oncol. 2023 Jul 27;14(1):139. doi: 10.1007/s12672-023-00747-7. | Click |
| 5 | Magnoflorine improves sensitivity to doxorubicin (DOX) of breast cancer cells via inducing apoptosis and autophagy through AKT/mTOR and p38 signaling pathways. Biomed Pharmacother. 2020 Jan;121:109139. doi: 10.1016/j.biopha.2019.109139. | Click |
| 6 | Polyphyllin I and VII potentiate the chemosensitivity of A549/DDP cells to cisplatin by enhancing apoptosis, reversing EMT and suppressing the CIP2A/AKT/mTOR signaling axis. Oncol Lett. 2019 Nov;18(5):5428-5436. doi: 10.3892/ol.2019.10895. | Click |
| 7 | Luteolin enhances erlotinib's cell proliferation inhibitory and apoptotic effects in glioblastoma cell lines. Front Pharmacol. 2022 Sep 19;13:952169. doi: 10.3389/fphar.2022.952169. | Click |
| 8 | Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer. Int J Cancer. 2019 Dec 1;145(11):3022-3032. doi: 10.1002/ijc.32367. | Click |
| 9 | Fisetin, a phytochemical, potentiates sorafenib-induced apoptosis and abrogates tumor growth in athymic nude mice implanted with BRAF-mutated melanoma cells. Oncotarget. 2015 Sep 29;6(29):28296-311. doi: 10.18632/oncotarget.5064. | Click |
| 10 | Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway. Biochem Biophys Res Commun. 2020 Oct 20;531(3):320-327. doi: 10.1016/j.bbrc.2020.07.045. | Click |
| 11 | Baicalein improves the chemoresistance of ovarian cancer through regulation of CirSLC7A6. J Ovarian Res. 2023 Nov 8;16(1):212. doi: 10.1186/s13048-023-01285-0. | Click |
| 12 | The novel small molecule BH3 mimetic nobiletin synergizes with vorinostat to induce apoptosis and autophagy in small cell lung cancer. Biochem Pharmacol. 2023 Oct;216:115807. doi: 10.1016/j.bcp.2023.115807. | Click |
| 13 | Isorhamnetin induces cell cycle arrest and apoptosis by triggering DNA damage and regulating the AMPK/mTOR/p70S6K signaling pathway in doxorubicin-resistant breast cancer. Phytomedicine. 2023 Jun;114:154780. doi: 10.1016/j.phymed.2023.154780. | Click |
| 14 | The Synergistic Effects of Celastrol in combination with Tamoxifen on Apoptosis and Autophagy in MCF-7 Cells. J Immunol Res. 2021 Jul 22;2021:5532269. doi: 10.1155/2021/5532269. | Click |
| 15 | Lower dose of metformin combined with artesunate induced autophagy-dependent apoptosis of glioblastoma by activating ROS-AMPK-mTOR axis. Exp Cell Res. 2023 Sep 1;430(1):113691. doi: 10.1016/j.yexcr.2023.113691. | Click |
| 16 | Oridonin in combination with imatinib exerts synergetic anti-leukemia effect in Ph+ acute lymphoblastic leukemia cells in vitro by inhibiting activation of LYN/mTOR signaling pathway. Cancer Biol Ther. 2012 Nov;13(13):1244-54. doi: 10.4161/cbt.21460. | Click |
| 17 | Astragaloside IV enhances the sensibility of lung adenocarcinoma cells to bevacizumab by inhibiting autophagy. Drug Dev Res. 2022 Apr;83(2):461-469. doi: 10.1002/ddr.21878. | Click |
| 18 | Synergistic activity of sorafenib and betulinic acid against clonogenic activity of non-small cell lung cancer cells. Cancer Sci. 2017 Nov;108(11):2265-2272. doi: 10.1111/cas.13386. | Click |
| 19 | Ursolic acid augments the chemosensitivity of drug-resistant breast cancer cells to doxorubicin by AMPK-mediated mitochondrial dysfunction. Biochem Pharmacol. 2022 Nov;205:115278. doi: 10.1016/j.bcp.2022.115278. | Click |
| 20 | UCP2 inhibition induces ROS/Akt/mTOR axis: Role of GAPDH nuclear translocation in genipin/everolimus anticancer synergism. Free Radic Biol Med. 2017 Dec;113:176-189. doi: 10.1016/j.freeradbiomed.2017.09.022. | Click |
| 21 | The combination of Nutlin-3 and Tanshinone IIA promotes synergistic cytotoxicity in acute leukemic cells expressing wild-type p53 by co-regulating MDM2-P53 and the AKT/mTOR pathway. Int J Biochem Cell Biol. 2019 Jan;106:8-20. doi: 10.1016/j.biocel.2018.10.008. | Click |
| 22 | Inhibiting effect of Endostar combined with ginsenoside Rg3 on breast cancer tumor growth in tumor-bearing mice. Asian Pac J Trop Med. 2016 Feb;9(2):180-3. doi: 10.1016/j.apjtm.2016.01.010. | Click |
| 23 | Combinatorial treatment of Rhizoma Paridis saponins and sorafenib overcomes the intolerance of sorafenib. J Steroid Biochem Mol Biol. 2018 Oct;183:159-166. doi: 10.1016/j.jsbmb.2018.06.010. | Click |
| 24 | Cucurbitacin B and cisplatin induce the cell death pathways in MB49 mouse bladder cancer model. Exp Biol Med (Maywood). 2020 May;245(9):805-814. doi: 10.1177/1535370220917367. | Click |
| 25 | Tubeimoside-I sensitizes temozolomide-resistant glioblastoma cells to chemotherapy by reducing MGMT expression and suppressing EGFR induced PI3K/Akt/mTOR/NF-κB-mediated signaling pathway. Phytomedicine. 2022 May;99:154016. doi: 10.1016/j.phymed.2022.154016. | Click |
| 26 | Shikonin exerts antitumor activity in Burkitt's lymphoma by inhibiting C-MYC and PI3K/AKT/mTOR pathway and acts synergistically with doxorubicin. Sci Rep. 2018 Feb 20;8(1):3317. doi: 10.1038/s41598-018-21570-z. | Click |
| 27 | Emodin and Its Combination with Cytarabine Induce Apoptosis in Resistant Acute Myeloid Leukemia Cells in Vitro and in Vivo. Cell Physiol Biochem. 2018;48(5):2061-2073. doi: 10.1159/000492544. | Click |
| 28 | Tanshinone IIA enhances the inhibitory effect of imatinib on proliferation and motility of acute leukemia cell line TIB‑152 in vivo and in vitro by inhibiting the PI3K/AKT/mTOR signaling pathway. Oncol Rep. 2020 Feb;43(2):503-515. doi: 10.3892/or.2019.7453. | Click |
| 29 | Organic anion transporters and PI3K-AKT-mTOR pathway mediate the synergistic anticancer effect of pemetrexed and rhein. J Cell Physiol. 2020 Apr;235(4):3309-3319. doi: 10.1002/jcp.29218. | Click |
| 30 | Plumbagin Enhances the Anticancer Efficacy of Cisplatin by Increasing Intracellular ROS in Human Tongue Squamous Cell Carcinoma. Oxid Med Cell Longev. 2020 Mar 25;2020:5649174. doi: 10.1155/2020/5649174. | Click |
| 31 | Combination of aloin and metformin enhances the antitumor effect by inhibiting the growth and invasion and inducing apoptosis and autophagy in hepatocellular carcinoma through PI3K/AKT/mTOR pathway. Cancer Med. 2020 Feb;9(3):1141-1151. doi: 10.1002/cam4.2723. | Click |
| 32 | Aloin and CPT-11 combination activates miRNA-133b and downregulates IGF1R- PI3K/AKT/mTOR and MEK/ERK pathways to inhibit colorectal cancer progression. Biomed Pharmacother. 2023 Dec 31;169:115911. doi: 10.1016/j.biopha.2023.115911. | Click |
| 33 | Decursin and Doxorubicin Are in Synergy for the Induction of Apoptosis via STAT3 and/or mTOR Pathways in Human Multiple Myeloma Cells. Evid Based Complement Alternat Med. 2013;2013:506324. doi: 10.1155/2013/506324. | Click |
| 34 | Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway. Am J Transl Res. 2019 Jun 15;11(6):3816-3824. | Click |
| 35 | Synergistic anti-hepatoma effect of bufalin combined with sorafenib via mediating the tumor vascular microenvironment by targeting mTOR/VEGF signaling. Int J Oncol. 2018;52(6):2051-2060. doi:10.3892/ijo.2018.4351 | Click |
| 36 | OSW-1 induces apoptosis and cyto-protective autophagy, and synergizes with chemotherapy on triple negative breast cancer metastasis. Cell Oncol (Dordr). 2022 Dec;45(6):1255-1275. doi: 10.1007/s13402-022-00716-2. | Click |
| 37 | Synergistic anti-tumour activity of sorafenib in combination with pegylated resveratrol is mediated by Akt/mTOR/p70S6k-4EBP-1 and c-Raf7MEK/ERK signaling pathways. Heliyon. 2023 Aug 19;9(8):e19154. doi: 10.1016/j.heliyon.2023.e19154. | Click |
| 38 | Combination effect of curcumin with docetaxel on the PI3K/AKT/mTOR pathway to induce autophagy and apoptosis in esophageal squamous cell carcinoma. Am J Transl Res. 2021 Jan 15;13(1):57-72. | Click |
| 39 | Combination of the natural product capsaicin and docetaxel synergistically kills human prostate cancer cells through the metabolic regulator AMP-activated kinase. Cancer Cell Int. 2019;19:54. Published 2019 Mar 8. doi:10.1186/s12935-019-0769-2. | Click |
| 40 | Synergistic effects of α-Mangostin and sorafenib in hepatocellular carcinoma: New insights into α-mangostin cytotoxicity. Biochem Biophys Res Commun. 2021 Jun 18;558:14-21. doi: 10.1016/j.bbrc.2021.04.047. | Click |
| 41 | Quercitrin alleviates lipid metabolism disorder in polycystic ovary syndrome-insulin resistance by upregulating PM20D1 in the PI3K/Akt pathway. Phytomedicine. 2023 Aug;117:154908. doi: 10.1016/j.phymed.2023.154908. | Click |
| 42 | Influence of 6-shogaol potentiated on 5-fluorouracil treatment of liver cancer by promoting apoptosis and cell cycle arrest by regulating AKT/mTOR/MRP1 signalling. Chin J Nat Med. 2022 May;20(5):352-363. doi: 10.1016/S1875-5364(22)60174-2. | Click |
| 43 | Gossypol sensitizes the antitumor activity of 5-FU through down-regulation of thymidylate synthase in human colon carcinoma cells. Cancer Chemother Pharmacol. 2015 Sep;76(3):575-86. doi: 10.1007/s00280-015-2749-0. | Click |
| 44 | Potentiation of Cisplatin Cytotoxicity in Resistant Ovarian Cancer SKOV3/Cisplatin Cells by Quercetin Pre-Treatment. Int J Mol Sci. 2023;24(13):10960. Published 2023 Jun 30. doi:10.3390/ijms241310960 | Click |
| 45 | Bisdemethoxycurcumin Promotes Apoptosis and Inhibits the Epithelial-Mesenchymal Transition through the Inhibition of the G-Protein-Coupled Receptor 161/Mammalian Target of Rapamycin Signaling Pathway in Triple Negative Breast Cancer Cells. J Agric Food Chem. 2021 Dec 8;69(48):14557-14567. doi: 10.1021/acs.jafc.1c05585. | Click |
| 46 | Anti-neoplastic action of Cimetidine/Vitamin C on histamine and the PI3K/AKT/mTOR pathway in Ehrlich breast cancer. Sci Rep. 2022;12(1):11514. Published 2022 Jul 7. doi:10.1038/s41598-022-15551-6 | Click |
| 47 | Pro-oxidant activity of sulforaphane and cisplatin potentiates apoptosis and simultaneously promotes autophagy in malignant mesothelioma cells. Mol Med Rep. 2017 Aug;16(2):2133-2141. doi: 10.3892/mmr.2017.6789. | Click |
| 48 | Concomitant supplementation of lycopene and eicosapentaenoic acid inhibits the proliferation of human colon cancer cells. J Nutr Biochem. 2009 Jun;20(6):426-34. doi: 10.1016/j.jnutbio.2008.05.001. | Click |
| 49 | Cordycepin augments the chemosensitivity of osteosarcoma to cisplatin by activating AMPK and suppressing the AKT signaling pathway. Cancer Cell Int. 2021 Dec 25;21(1):706. doi: 10.1186/s12935-021-02411-y. | Click |
| 50 | Geraniol suppresses tumour growth and enhances chemosensitivity of 5-fluorouracil on breast carcinoma in mice: involvement of miR-21/PTEN signalling. J Pharm Pharmacol. 2023 Aug 1;75(8):1130-1139. doi: 10.1093/jpp/rgad060. | Click |
| 51 | Enhanced anticancer activity by the combination of vinpocetine and sorafenib via PI3K/AKT/GSK-3β signaling axis in hepatocellular carcinoma cells. Anticancer Drugs. 2021 Aug 1;32(7):727-733. doi: 10.1097/CAD.0000000000001056. | Click |
| 52 | Celastrol Inhibits the Proliferation and Decreases Drug Resistance of Cisplatin- Resistant Gastric Cancer SGC7901/DDP Cells. Anticancer Agents Med Chem. 2022;22(2):270-279. doi: 10.2174/1871520621666210528144006. | Click |
| 53 | Epigallocatechin gallate circumvents drug-induced resistance in non-small-cell lung cancer by modulating glucose metabolism and AMPK/AKT/MAPK axis. Phytother Res. 2023;37(12):5837-5853. doi:10.1002/ptr.7990 | Click |
| 54 | Caffeic acid phenethyl ester reverses doxorubicin resistance in breast cancer cells via lipid metabolism regulation at least partly by suppressing the Akt/mTOR/SREBP1 pathway. Kaohsiung J Med Sci. 2023 Jun;39(6):605-615. doi: 10.1002/kjm2.12675. | Click |
| 55 | Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma. Cells. 2023;12(4):612. Published 2023 Feb 14. doi:10.3390/cells12040612. | Click |
| 56 | Cordycepin Reverses Cisplatin Resistance in Non-small Cell Lung Cancer by Activating AMPK and Inhibiting AKT Signaling Pathway. Front Cell Dev Biol. 2021 Jan 15;8:609285. doi: 10.3389/fcell.2020.609285. | Click |