Name | Bcl-2-like protein 1 | ||
UniProt ID | B2CL1_HUMAN | ||
Gene Name | BCL-xL | ||
Gene ID | 598 | ||
Synonyms |
BCL2L1, BCL-XL/S, BCL2L, BCLX, Bcl-X, PPP1R52
|
||
Sequence |
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK |
||
Pathway Map | MAP LINK | ||
T.C. Number | 1.A.21.1.1 | ||
KEGG ID | hsa598 | ||
TTD ID | T56510 | ||
Pfam | PF00452; PF02180; PF15286 |
Pair Name | Isovitexin, Cisplatin | |||
Phytochemical Name | Isovitexin | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | IVT not only inhibited cell proliferation and glucose metabolism via downregulating the expression of PKM2 to enhance the antitumor activity of DDP against lung cancer cells, and improved DDP-induced immunotoxicity in mice. It also presented a novel strategy to enhance the anti-tumor effect of platinum-based chemotherapy against NSCLC. |
Pair Name | (S)-10-Hydroxycamptothecin, Crizotinib | |||
Phytochemical | (S)-10-Hydroxycamptothecin | |||
Drug | Crizotinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells |
Pair Name | AKBA, Cisplatin | |||
Phytochemical | AKBA | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Acetyl-11-keto-beta-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway |
Pair Name | Amygdalin, Cisplatin | |||
Phytochemical | Amygdalin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Bcl-2-like protein 1 | Expression | |
Result | Our present findings suggest that amygdalin has chemo-modulatory effect when used in co-treatment with cisplatin and is able to protect normal breast cells as well as the fibroblasts during chemotherapy treatment, indicating a strong selective chemoprotective ability and may contribute to a better quality of life for cancer patients. |
Pair Name | Apigenin, Doxorubicin | |||
Phytochemical | Apigenin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells |
Pair Name | Apigenin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Apigenin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Apigenin enhances TRAIL-induced antitumor activity in NSCLC cells by APG via inhibition of the NF-kappaB, AKT and ERK prosurvival regulators |
Pair Name | Astaxanthin, Cytarabine | |||
Phytochemical | Astaxanthin | |||
Drug | Cytarabine | |||
Disease Info | [ICD-11: 2B33.3] | Acute lymphoblastic leukemia | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Co-treatment of ASX and Ara-C has synergism effects on apoptosis pathways, cell proliferation inhibition, and decreased inflammation. |
Pair Name | Bergamottin, Simvastatin | |||
Phytochemical | Bergamottin | |||
Drug | Simvastatin | |||
Disease Info | [ICD-11: 2A20.1] | Chronic myelogenous leukemia | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Discussion and conclusion Our results provide novel insight into the role of SV and BGM in potentially preventing and treating cancer through modulation of NF-κB signalling pathway and its regulated gene products. |
Pair Name | Beta-Elemene, Cisplatin | |||
Phytochemical | Beta-Elemene | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | β-elemene enhancement of cisplatin-induced apoptosis via mitochondrial activation of the caspase-mediated apoptotic pathway may account for the augmented anti-cancer potency of cisplatin in prostate cancer. Cisplatin combined with β-elemene as a chemosensitizer or adjuvant warrants further study and may be potentially useful as a first-line treatment of androgen-independent prostate carcinomas. |
Pair Name | Beta-Elemene, Cisplatin | |||
Phytochemical | Beta-Elemene | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | These data indicate that β-elemene sensitizes chemoresistant ovarian carcinoma cells to cisplatin-induced apoptosis and that the augmented effect of β-elemene on cisplatin cytotoxicity and sensitivity in resistant ovarian tumor cells is mediated through a mitochondria- and caspase-dependent cell death pathway. |
Pair Name | Betulinic Acid, Sorafenib | |||
Phytochemical | Betulinic Acid | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | We showed that combination therapy with low concentrations of sorafenib and betulinic acid had the capacity to induce high levels of cell death and abolish clonogenic activity in some NSCLC cell lines regardless of KRAS mutations. |
Pair Name | Bufalin, Hydroxycamptothecin | |||
Phytochemical | Bufalin | |||
Drug | Hydroxycamptothecin | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | The present study suggested that the combination of bufalin and hydroxycampothecin improved the inhibitory effects of both drugs on CRPC tumors in vivo, potentially via the regulation of the PI3K/AKT/GSK-3β and p53-dependent apoptosis signaling pathways. |
Pair Name | Carnosic acid, Tamoxifen | |||
Phytochemical | Carnosic acid | |||
Drug | Tamoxifen | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Our study supplies a novel therapeutic strategy to induce apoptosis for suppressing breast cancer, which was relied on Caspase-3/TRAIL activation. |
Pair Name | Casticin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Casticin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Casticin enhances TRAIL-induced apoptosis through the downregulation of cell survival proteins and the upregulation of DR5 receptors through actions on the ROS-ER stress-CHOP pathway. |
Pair Name | Chlorogenic acid, Regorafenib | |||
Phytochemical | Chlorogenic acid | |||
Drug | Regorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | This drug combination could be considered as a safe and more effective approach in HCC therapy. |
Pair Name | Curcumin, Thalidomide | |||
Phytochemical | Curcumin | |||
Drug | Thalidomide | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Our findings suggested that down-regulation of STAT3 and BCL-XL mRNA expression in response to CUR and THAL treatment lead to inhibition of cell growth and induction of apoptosis. |
Pair Name | Epigallocatechin gallate, TNF-related apoptosis inducing ligand | |||
Phytochemical | Epigallocatechin gallate | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B6B] | Nasopharyngeal carcinoma | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | EGCG sensitizes NPC cells to TRAIL-mediated apoptosis via modulation of extrinsic and intrinsic apoptotic pathways and inhibition of NF-κB activation. |
Pair Name | Evodiamine, Gemcitabine | |||
Phytochemical | Evodiamine | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2B62.Z] | Tongue cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | The results of this study showed that EVO may inhibit cancer cells by suppressing NF-κB activity, and in combination with GEM, it may increase the chemosensitivity of tongue squamous cancer cells, thereby improving the treatment response. |
Pair Name | Flavokawain A, Herceptin | |||
Phytochemical | Flavokawain A | |||
Drug | Herceptin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Our results suggest FKA as a promising and novel apoptosis inducer and G2 blocking agent that, in combination with Herceptin, enhances for the treatment of HER2-overexpressing breast cancer. |
Pair Name | Gambogic Acid, Doxorubicin | |||
Phytochemical | Gambogic Acid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | These findings indicate that GA sensitizes lung cancer cells to ADM in vitro and in vivo, providing a rationale for the combined use of GA and ADM in lung cancer chemotherapy. |
Pair Name | Gambogic Acid, TNF-related apoptosis inducing ligand | |||
Phytochemical | Gambogic Acid | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | These findings may open a new window in the treatment of breast cancer using TRAIL in combination with GA. |
Pair Name | Gamma-Tocotrienol, Capecitabine | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Capecitabine | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Our results show that γ-tocotrienol can potentiate the effects of capecitabine through suppression of NF-κB-regulated markers of proliferation, invasion, angiogenesis, and metastasis. |
Pair Name | Gamma-Tocotrienol, Gemcitabine | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Our findings suggest that γ-T3 can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing NF-κB-mediated inflammatory pathways linked to tumorigenesis. |
Pair Name | Ginsenoside Rg5, Paclitaxel | |||
Phytochemical | Ginsenoside Rg5 | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel |
Pair Name | Gossypol, Gefitinib | |||
Phytochemical | Gossypol | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | AT-101 enhances gefitinib sensitivity in non-small cell lung cancer with EGFR T790M mutations. |
Pair Name | Gossypol, Idarubicin | |||
Phytochemical | Gossypol | |||
Drug | Idarubicin | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | These findings suggest that combinatorial therapy with AT-101 and IDA selectively eliminates leukemia stem-like cells both in vitro and in vivo, representing a potent and alternative salvage therapy for the treatment of relapsed and refractory patients with AML. |
Pair Name | Gossypol, Imatinib | |||
Phytochemical | Gossypol | |||
Drug | Imatinib | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | These results suggest that (-)gossypol induced apoptosis in K562 cells through a mitochondria pathway and that the combination of imatinib and (-)gossypol might be an effective treatment for CML. |
Pair Name | Honokiol, Cabozantinib | |||
Phytochemical | Honokiol | |||
Drug | Cabozantinib | |||
Disease Info | [ICD-11: 2C90.0] | Renal cell carcinoma | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Cabozantinib + Honokiol combination can significantly inhibit c-Met-induced and Nrf2-mediated anti-oxidant pathway in renal cancer cells to promote increased oxidative stress and tumor cell death. |
Pair Name | Icariin, Fluorouracil | |||
Phytochemical | Icariin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | We suggest that combination of icariin with 5-FU might offer a therapeutic benefit to the patients with CRC; however, further studies are required to ascertain this proposition. |
Pair Name | Icariin, Gemcitabine | |||
Phytochemical | Icariin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C94] | Bladder cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Icariin, by suppressing NF-κB activity, exerts antitumor activity, and potentiates the antitumor activity of gemcitabine in gallbladder cancer. Combined administration of gemcitabine and icariin may offer a better therapeutic option for the patients with gallbladder cancer. |
Pair Name | Isoliquiritigenin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Isoliquiritigenin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Isoliquiritigenin has the potential to overcome resistance to TRAIL in cancer cells and its chemopreventive effects may depend on TRAIL function |
Pair Name | Luteolin, Erlotinib | |||
Phytochemical | Luteolin | |||
Drug | Erlotinib | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | These findings suggest that combining luteolin with erlotinib offers a potential treatment strategy for glioblastoma multiforme IV. |
Pair Name | Luteolin, SMC3 | |||
Phytochemical | Luteolin | |||
Drug | SMC3 | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | The results suggest that combination of SMC3 and luteolin is an effective approach for improving the anticancer value of SMC3, which has implications in cancer prevention and therapy. |
Pair Name | Mangiferin, Doxorubicin | |||
Phytochemical | Mangiferin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2A83] | Multiple myeloma | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Our findings suggest that the combination of mangiferin and an anticancer drug could be used as a new regime for the treatment of MM. |
Pair Name | Medicarpin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Medicarpin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B33.1] | Myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway |
Pair Name | Nobiletin, Vorinostat | |||
Phytochemical | Nobiletin | |||
Drug | Vorinostat | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | The combination of nobiletin with vorinostat increased histone H3K9 and H3K27 acetylation levels in SCLC mouse tumor tissue and enhanced the expression of the BH3-only proteins BIM and BID. We conclude that nobiletin is a novel natural BH3 mimetic that can cooperate with vorinostat to induce apoptosis and autophagy in SCLC. |
Pair Name | Oridonin, Venetoclax | |||
Phytochemical | Oridonin | |||
Drug | Venetoclax | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Oridonin and venetoclax synergistically promote AML cell apoptosis by inhibiting AKT signaling. |
Pair Name | OSW-1, Carboplatin | |||
Phytochemical | OSW-1 | |||
Drug | Carboplatin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Our data revealed the mode of action and molecular mechanism underlying the effect of OSW-1 against TNBC, and provided a useful guidance for improving the sensitivity of TNBC cells to conventional chemotherapeutic drugs, which warrants further investigation. |
Pair Name | Oxymatrine, Paclitaxel | |||
Phytochemical | Oxymatrine | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model |
Pair Name | Parthenolide, Balsalazide | |||
Phytochemical | Parthenolide | |||
Drug | Balsalazide | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | These results demonstrate that parthenolide potentiates the efficacy of balsalazide through synergistic inhibition of NF-κB activation and the combination of dual agents prevents colon carcinogenesis from chronic inflammation. |
Pair Name | Periplocin, Gemcitabine | |||
Phytochemical | Periplocin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells |
Pair Name | Platycodin D, Venetoclax | |||
Phytochemical | Platycodin D | |||
Drug | Venetoclax | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Up-regulation | Bcl-2-like protein 1 | Expression | |
Result | Platycodin D may be a potent therapeutic candidate for the treatment of AML |
Pair Name | Pterostilbene, TNF-related apoptosis inducing ligand | |||
Phytochemical | Pterostilbene | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Pterostilbene enhances TRAIL-induced apoptosis through the induction of death receptors and downregulation of cell survival proteins in TRAIL-resistance triple negative breast cancer cells |
Pair Name | Resveratrol, Olaparib | |||
Phytochemical | Resveratrol | |||
Drug | Olaparib | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | RES + OLA combination treatment enhanced breast cancer cell death by causing excessive DNA damage and also simultaneously inhibiting the HR pathway. |
Pair Name | Resveratrol, Rapamycin | |||
Phytochemical | Resveratrol | |||
Drug | Rapamycin | |||
Disease Info | [ICD-11: 2D10.1] | Papillary thyroid cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | The present study suggests that the combination of rapamycin and resveratrol may be a promising strategy for the treatment of papillary thyroid cancer. |
Pair Name | Rosmarinic acid, Anti-MUC1 antibody | |||
Phytochemical | Rosmarinic acid | |||
Drug | Anti-MUC1 antibody | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Results of the study indicate that combined action of anti-MUC1 and RA is more effective than monotherapy in relation to examined cancer related factors. Such treatment can be considered as new, promising strategy in gastric cancer therapy. |
Pair Name | Sanguinarium, Bortezomib | |||
Phytochemical | Sanguinarium | |||
Drug | Bortezomib | |||
Disease Info | [ICD-11: 2A83] | Multiple myeloma | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Our findings demonstrate that SNG induces mitochondrial and caspase-dependent apoptosis, generates oxidative stress, and suppresses MM cell lines proliferation. In addition, co-treatment of MM cell lines with sub-toxic doses of SNG and BTZ potentiated the cytotoxic activity. These results would suggest that SNG could be developed into therapeutic agent either alone or in combination with other anticancer drugs in MM. |
Pair Name | Shikonin, Gemcitabine | |||
Phytochemical | Shikonin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Our results suggest that shikonin can suppress the growth of human pancreatic tumors and potentiate the antitumor effects of gemcitabine through the suppression of NF-κB and NF-κB-regulated gene products. |
Pair Name | Shikonin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Shikonin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | The results indicated that shikonin sensitized resistant cancer cells to TRAIL-induced cytotoxicity via the modulation of the JNK, STAT3 and AKT pathways, the downregulation of antiapoptotic proteins and the upregulation of proapoptotic proteins. |
Pair Name | Silibinin, Trichostatin A | |||
Phytochemical | Silibinin | |||
Drug | Trichostatin A | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Combinations of TSA with silibinin synergistically augmented the cytotoxic effects of the single agent, which was associated with a dramatic increase in p21 (Cdkn1a) |
Pair Name | Sulforaphane, CB-5083 | |||
Phytochemical | Sulforaphane | |||
Drug | CB-5083 | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | The combination of Sulforaphane and CB-5083 may be a useful treatment strategy to combat CB-5083 resistance. |
Pair Name | Sulforaphane, TNF-related apoptosis inducing ligand | |||
Phytochemical | Sulforaphane | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | The ability of sulforaphane to inhibit tumor growth, metastasis, and angiogenesis and to enhance the therapeutic potential of TRAIL suggests that sulforaphane alone or in combination with TRAIL can be used for the management of prostate cancer. |
Pair Name | Tectorigenin, Paclitaxel | |||
Phytochemical | Tectorigenin | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | These data suggest that tectorigenin could sensitize paclitaxel-resistant human ovarian cancer cells through inactivation of the Akt/IKK/IκB/NFκB signaling pathway, and promise a new intervention to chemosensitize paclitaxel-induced cytotoxicity in ovarian cancer. |
Pair Name | Tetrandrine, Sorafenib | |||
Phytochemical | Tetrandrine | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | The antitumour activity of sorafenib plus tetrandrine may be attributed to the induction of the intrinsic apoptosis pathway through ROS/Akt signaling. This finding provides a novel approach that may broaden the clinical application of sorafenib. |
Pair Name | Fisetin, Paclitaxel | |||
Phytochemical | Fisetin | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Our study shows that PTX-FA and Fis-FA PBM NPs directly target platinum-resistant OvCa cells, induce cytotoxic/apoptotic effects, and reverse multi-drug resistance (MDR). These findings allow us to create new clinical applications using PTX-FA and Fis-FA combination nanoparticles to treat drug-resistant cancers. |
Pair Name | Gamma-Tocotrienol, Simvastatin | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Simvastatin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol |
Pair Name | Gossypol, Gemcitabine | |||
Phytochemical | Gossypol | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Combination therapy with gossypol reveals synergism against gemcitabine resistance in cancer cells with high BCL-2 expression |
Pair Name | Mitocurcumin, Cytarabine | |||
Phytochemical | Mitocurcumin | |||
Drug | Cytarabine | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis. |
Pair Name | Sanguinarium, Gefitinib | |||
Phytochemical | Sanguinarium | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Targeting EGFR by elevating ROS and redox imbalance is a potential new strategy to develop a new EGFR inhibitor for TKI-resistant patients with a wide therapeutic window between EGFR(T790M) and EGFR(WT) |
Pair Name | Shikonin, Gefitinib | |||
Phytochemical | Shikonin | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Bcl-2-like protein 1 | Expression | |
Result | Shikonin-induced cell apoptosis is closely associated with ROS elevation in the cells. These findings indicate that Shikonin can be an effective small molecule treating gefitinib-resistant NSCLC. |
No. | Title | Href |
---|---|---|
1 | Isovitexin potentiated the antitumor activity of cisplatin by inhibiting the glucose metabolism of lung cancer cells and reduced cisplatin-induced immunotoxicity in mice. Int Immunopharmacol. 2021 May;94:107357. doi: 10.1016/j.intimp.2020.107357. | Click |
2 | Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells. J Enzyme Inhib Med Chem. 2023 Dec;38(1):1-11. doi: 10.1080/14756366.2022.2132487. | Click |
3 | Acetyl-11-keto-β-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway. Cell Biol Toxicol. 2021 Apr;37(2):209-228. doi: 10.1007/s10565-020-09541-5. | Click |
4 | Amygdalin as a chemoprotective agent in co-treatment with cisplatin. Front Pharmacol. 2022 Sep 20;13:1013692. doi: 10.3389/fphar.2022.1013692. | Click |
5 | Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells. Exp Oncol. 2021 Jun;43(2):125-134. doi: 10.32471/exp-oncology.2312-8852.vol-43-no-2.16096. | Click |
6 | Apigenin potentiates TRAIL therapy of non-small cell lung cancer via upregulating DR4/DR5 expression in a p53-dependent manner. Sci Rep. 2016 Oct 18;6:35468. doi: 10.1038/srep35468. | Click |
7 | Astaxanthin decreases the growth-inhibitory dose of cytarabine and inflammatory response in the acute lymphoblastic leukemia cell line NALM-6. Mol Biol Rep. 2022 Jul;49(7):6415-6422. doi: 10.1007/s11033-022-07452-8. | Click |
8 | Simvastatin in combination with bergamottin potentiates TNF-induced apoptosis through modulation of NF-κB signalling pathway in human chronic myelogenous leukaemia. Pharm Biol. 2016 Oct;54(10):2050-60. doi: 10.3109/13880209.2016.1141221. | Click |
9 | Evaluation of cisplatin in combination with β-elemene as a regimen for prostate cancer chemotherapy. Basic Clin Pharmacol Toxicol. 2010 Nov;107(5):868-76. doi: 10.1111/j.1742-7843.2010.00592.x. | Click |
10 | Enhancement of cisplatin-induced apoptosis by β-elemene in resistant human ovarian cancer cells. Med Oncol. 2013 Mar;30(1):424. doi: 10.1007/s12032-012-0424-4. | Click |
11 | Synergistic activity of sorafenib and betulinic acid against clonogenic activity of non-small cell lung cancer cells. Cancer Sci. 2017 Nov;108(11):2265-2272. doi: 10.1111/cas.13386. | Click |
12 | Effects of low-dose bufalin combined with hydroxycamptothecin on human castration-resistant prostate cancer xenografts in nude mice. Exp Ther Med. 2021 Sep;22(3):1015. doi: 10.3892/etm.2021.10447. | Click |
13 | Carnosic acid cooperates with tamoxifen to induce apoptosis associated with Caspase-3 activation in breast cancer cells in vitro and in vivo. Biomed Pharmacother. 2017 May;89:827-837. doi: 10.1016/j.biopha.2017.01.084. | Click |
14 | Casticin potentiates TRAIL-induced apoptosis of gastric cancer cells through endoplasmic reticulum stress. PLoS One. 2013;8(3):e58855. doi: 10.1371/journal.pone.0058855. | Click |
15 | Chlorogenic Acid Improves the Regorafenib Effects in Human Hepatocellular Carcinoma Cells. Int J Mol Sci. 2018 May 19;19(5):1518. doi: 10.3390/ijms19051518. | Click |
16 | Curcumin Combined with Thalidomide Reduces Expression of STAT3 and Bcl-xL, Leading to Apoptosis in Acute Myeloid Leukemia Cell Lines. Drug Des Devel Ther. 2020 Jan 15;14:185-194. doi: 10.2147/DDDT.S228610. | Click |
17 | EGCG sensitizes human nasopharyngeal carcinoma cells to TRAIL-mediated apoptosis by activation NF-κB. Neoplasma. 2017;64(1):74-80. doi: 10.4149/neo_2017_109. | Click |
18 | Evodiamine inactivates NF-κB and potentiates the antitumor effects of gemcitabine on tongue cancer both in vitro and in vivo. Onco Targets Ther. 2018;12:257-267. Published 2018 Dec 27. doi:10.2147/OTT.S181062 | Click |
19 | Induction of G2M Arrest by Flavokawain A, a Kava Chalcone, Increases the Responsiveness of HER2-Overexpressing Breast Cancer Cells to Herceptin. Molecules. 2017 Mar 14;22(3):462. doi: 10.3390/molecules22030462. | Click |
20 | Suppression of NF-κB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103. doi: 10.2174/1568009613666131113100634. | Click |
21 | Gambogic acid sensitizes breast cancer cells to TRAIL-induced apoptosis by promoting the crosstalk of extrinsic and intrinsic apoptotic signalings. Food Chem Toxicol. 2018 Sep;119:334-341. doi: 10.1016/j.fct.2018.02.037. | Click |
22 | First evidence that γ-tocotrienol inhibits the growth of human gastric cancer and chemosensitizes it to capecitabine in a xenograft mouse model through the modulation of NF-κB pathway. Clin Cancer Res. 2012 Apr 15;18(8):2220-9. doi: 10.1158/1078-0432.CCR-11-2470. | Click |
23 | {Gamma}-tocotrienol inhibits pancreatic tumors and sensitizes them to gemcitabine treatment by modulating the inflammatory microenvironment. Cancer Res. 2010 Nov 1;70(21):8695-705. doi: 10.1158/0008-5472.CAN-10-2318. Epub 2010 Sep 23. | Click |
24 | Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel. Genes (Basel). 2022 Jun 24;13(7):1142. doi: 10.3390/genes13071142. | Click |
25 | AT-101 enhances gefitinib sensitivity in non-small cell lung cancer with EGFR T790M mutations. BMC Cancer. 2016 Jul 18;16:491. doi: 10.1186/s12885-016-2519-3. | Click |
26 | Synthetic lethality of combined AT-101 with idarubicin in acute myeloid leukemia via blockade of DNA repair and activation of intrinsic apoptotic pathway. Cancer Lett. 2019 Oct 1;461:31-43. doi: 10.1016/j.canlet.2019.07.003. | Click |
27 | (-)Gossypol and its combination with imatinib induce apoptosis in human chronic myeloid leukemic cells. Leuk Lymphoma. 2007 Nov;48(11):2204-12. doi: 10.1080/10428190701583991. | Click |
28 | A novel combination therapy with Cabozantinib and Honokiol effectively inhibits c-Met-Nrf2-induced renal tumor growth through increased oxidative stress. Redox Biol. 2023 Dec;68:102945. doi: 10.1016/j.redox.2023.102945. | Click |
29 | Icariin-mediated inhibition of NF-κB activity enhances the in vitro and in vivo antitumour effect of 5-fluorouracil in colorectal cancer. Cell Biochem Biophys. 2014 Jul;69(3):523-30. doi: 10.1007/s12013-014-9827-5. | Click |
30 | Icariin potentiates the antitumor activity of gemcitabine in gallbladder cancer by suppressing NF-κB. Acta Pharmacol Sin. 2013 Feb;34(2):301-8. doi: 10.1038/aps.2012.162. | Click |
31 | Combination of isoliquiritigenin and tumor necrosis factor-related apoptosis-inducing ligand induces apoptosis in colon cancer HT29 cells. Environ Health Prev Med. 2008 Sep;13(5):281-7. doi: 10.1007/s12199-008-0041-1. | Click |
32 | Luteolin enhances erlotinib's cell proliferation inhibitory and apoptotic effects in glioblastoma cell lines. Front Pharmacol. 2022 Sep 19;13:952169. doi: 10.3389/fphar.2022.952169. | Click |
33 | Attenuating Smac mimetic compound 3-induced NF-kappaB activation by luteolin leads to synergistic cytotoxicity in cancer cells. J Cell Biochem. 2009 Dec 1;108(5):1125-31. doi: 10.1002/jcb.22346. | Click |
34 | Mangiferin enhances the sensitivity of human multiple myeloma cells to anticancer drugs through suppression of the nuclear factor κB pathway. Int J Oncol. 2016 Jun;48(6):2704-12. doi: 10.3892/ijo.2016.3470. | Click |
35 | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. | Click |
36 | The novel small molecule BH3 mimetic nobiletin synergizes with vorinostat to induce apoptosis and autophagy in small cell lung cancer. Biochem Pharmacol. 2023 Oct;216:115807. doi: 10.1016/j.bcp.2023.115807. | Click |
37 | Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195. | Click |
38 | OSW-1 induces apoptosis and cyto-protective autophagy, and synergizes with chemotherapy on triple negative breast cancer metastasis. Cell Oncol (Dordr). 2022 Dec;45(6):1255-1275. doi: 10.1007/s13402-022-00716-2. | Click |
39 | Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model. Cancers (Basel). 2019 Jan 7;11(1):49. doi: 10.3390/cancers11010049. | Click |
40 | Combined Parthenolide and Balsalazide Have Enhanced Antitumor Efficacy Through Blockade of NF-κB Activation. Mol Cancer Res. 2017 Feb;15(2):141-151. doi: 10.1158/1541-7786.MCR-16-0101. | Click |
41 | Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells. Biomed Pharmacother. 2023 Jan;157:114039. doi: 10.1016/j.biopha.2022.114039. | Click |
42 | Platycodin D induces apoptotic cell death through PI3K/AKT and MAPK/ERK pathways and synergizes with venetoclax in acute myeloid leukemia. Eur J Pharmacol. 2023 Oct 5;956:175957. doi: 10.1016/j.ejphar.2023.175957. | Click |
43 | Pterostilbene Enhances TRAIL-Induced Apoptosis through the Induction of Death Receptors and Downregulation of Cell Survival Proteins in TRAIL-Resistance Triple Negative Breast Cancer Cells. J Agric Food Chem. 2017 Dec 27;65(51):11179-11191. doi: 10.1021/acs.jafc.7b02358. | Click |
44 | Olaparib enhances the Resveratrol-mediated apoptosis in breast cancer cells by inhibiting the homologous recombination repair pathway. Exp Cell Res. 2022 Nov 1;420(1):113338. doi: 10.1016/j.yexcr.2022.113338. | Click |
45 | Resveratrol potentiates the anti-tumor effects of rapamycin in papillary thyroid cancer: PI3K/AKT/mTOR pathway involved. Arch Biochem Biophys. 2020 Aug 15;689:108461. doi: 10.1016/j.abb.2020.108461. | Click |
46 | Anti-cancer effect of combined action of anti-MUC1 and rosmarinic acid in AGS gastric cancer cells. Eur J Pharmacol. 2021 Jul 5;902:174119. doi: 10.1016/j.ejphar.2021.174119. | Click |
47 | Sanguinarine Induces Apoptosis Pathway in Multiple Myeloma Cell Lines via Inhibition of the JaK2/STAT3 Signaling. Front Oncol. 2019 Apr 17;9:285. doi: 10.3389/fonc.2019.00285. | Click |
48 | Shikonin suppresses tumor growth and synergizes with gemcitabine in a pancreatic cancer xenograft model: Involvement of NF-κB signaling pathway. Biochem Pharmacol. 2014 Apr 1;88(3):322-33. doi: 10.1016/j.bcp.2014.01.041. | Click |
49 | Shikonin sensitizes A549 cells to TRAIL-induced apoptosis through the JNK, STAT3 and AKT pathways. BMC Cell Biol. 2018 Dec 29;19(1):29. doi: 10.1186/s12860-018-0179-7. | Click |
50 | Epigenetic modifications and p21-cyclin B1 nexus in anticancer effect of histone deacetylase inhibitors in combination with silibinin on non-small cell lung cancer cells. Epigenetics. 2012 Oct;7(10):1161-72. doi: 10.4161/epi.22070. | Click |
51 | Sulforaphane is Synergistic with CB-5083 and Inhibits Colony Formation of CB-5083-Resistant HCT116 Cells. ChemMedChem. 2022 Jun 3;17(11):e202200030. doi: 10.1002/cmdc.202200030. | Click |
52 | Sulforaphane enhances the therapeutic potential of TRAIL in prostate cancer orthotopic model through regulation of apoptosis, metastasis, and angiogenesis. Clin Cancer Res. 2008 Nov 1;14(21):6855-66. doi: 10.1158/1078-0432.CCR-08-0903. | Click |
53 | Tectorigenin sensitizes paclitaxel-resistant human ovarian cancer cells through downregulation of the Akt and NFκB pathway. Carcinogenesis. 2012 Dec;33(12):2488-98. doi: 10.1093/carcin/bgs302. | Click |
54 | Synergistic antitumour activity of sorafenib in combination with tetrandrine is mediated by reactive oxygen species (ROS)/Akt signaling. Br J Cancer. 2013 Jul 23;109(2):342-50. doi: 10.1038/bjc.2013.334. | Click |
55 | The effect of paclitaxel- and fisetin-loaded PBM nanoparticles on apoptosis and reversal of drug resistance gene ABCG2 in ovarian cancer. J Ovarian Res. 2023 Nov 21;16(1):220. doi: 10.1186/s13048-023-01308-w. | Click |
56 | Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol. Cancer Lett. 2013 Jan 28;328(2):285-96. doi: 10.1016/j.canlet.2012.10.003. | Click |
57 | Combination therapy with gossypol reveals synergism against gemcitabine resistance in cancer cells with high BCL-2 expression. PLoS One. 2012;7(12):e50786. doi: 10.1371/journal.pone.0050786. | Click |
58 | Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004 | Click |
59 | Targeting Tyrosine Kinase Inhibitor-Resistant Non-Small Cell Lung Cancer by Inducing Epidermal Growth Factor Receptor Degradation via Methionine 790 Oxidation. Antioxid Redox Signal. 2016;24(5):263-279. doi:10.1089/ars.2015.6420 | Click |
60 | Shikonin inhibits gefitinib-resistant non-small cell lung cancer by inhibiting TrxR and activating the EGFR proteasomal degradation pathway. Pharmacol Res. 2017;115:45-55. doi:10.1016/j.phrs.2016.11.011 | Click |