TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Vascular endothelial growth factor A
UniProt ID VEGFA_HUMAN
Gene Name VEGFA
Gene ID 7422
Synonyms
VEGFA, L-VEGF, MVCD1, VEGF, VPF
Sequence
MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLG
CSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWT
GEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASET
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQ
DPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Pathway Map MAP LINK
KEGG ID hsa7422
TTD ID T20761
Pfam PF00341; PF00428; PF14554
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 144
Pair Name (-)-Catechin gallate, Sorafenib
Phytochemical Name (-)-Catechin gallate
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Standard-dose Sorafenib and the combination of low-dose Sorafenib and epigallo-3-catechin gallate have similar effectivity in reducing the expression of microvascular density and could prevent resistance and lower toxicity effects.
Combination Pair ID: 36
Pair Name Amygdalin, Sorafenib
Phytochemical Name Amygdalin
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2D91] Ehrlich ascites carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Amy improved the antitumor effect of Sor and had a protective role on liver damage induced by EAC in mice.
Combination Pair ID: 429
Pair Name Carvacrol, Sorafenib
Phytochemical Name Carvacrol
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC.
Combination Pair ID: 385
Pair Name Curcumin, Quinacrine
Phytochemical Name Curcumin
Anticancer drug Name Quinacrine
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Quinacrine and Curcumin in combination decreased the breast cancer angiogenesis by modulating ABCG2 via VEGF A
Combination Pair ID: 769
Pair Name Honokiol, Celecoxib
Phytochemical Name Honokiol
Anticancer drug Name Celecoxib
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The combined treatment with PV-CXB and PV-HNK showed synergistic effect both in vitro and in vivo
Combination Pair ID: 261
Pair Name Ilexgenin A, Sorafenib
Phytochemical Name Ilexgenin A
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The results described in the present study identifies Ilexgenin A as a promising therapeutic candidate that modulates inflammation, angiogenesis, and HCC growth.
Combination Pair ID: 366
Pair Name Polydatin, 2-Deoxy-d-glucose
Phytochemical Name Polydatin
Anticancer drug Name 2-Deoxy-d-glucose
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Our study demonstrates that PD synergised with 2-DG to enhance its anti-cancer efficacy by inhibiting the ROS/PI3K/AKT/HIF-1α/HK2 signalling axis, providing a potential anti-cancer strategy.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 433
Pair Name [6]-Gingerol, Cisplatin
Phytochemical [6]-Gingerol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The findings of the present study demonstrated that the cisplatin and 6-gingerol combination is more effective in inducing apoptosis and suppressing the angiogenesis of ovarian cancer cells than using each drug alone.
Combination Pair ID: 152
Pair Name 4'-Hydroxywogonin, Wortmannin
Phytochemical 4'-Hydroxywogonin
Drug Wortmannin
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result 4'-HW decreased the viability and reduced angiogenesis in CRC, which was associated with downregulation of VEGF-A expression by disrupting the PI3K/AKT pathway. Our discoveries suggested 4'-HW as a promising anticancer agent against CRC targeting angiogenesis.
Combination Pair ID: 95
Pair Name Amentoflavone, Sorafenib
Phytochemical Amentoflavone
Drug Sorafenib
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Amentoflavone may sensitize OS to sorafenib treatment by inducing intrinsic and extrinsic apoptosis and inhibiting ERK/NF-κB signaling transduction.
Combination Pair ID: 1015
Pair Name Astaxanthin, Sorafenib
Phytochemical Astaxanthin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Astaxanthin Augmented the Anti-Hepatocellular Carcinoma Efficacy of Sorafenib Through the Inhibition of the JAK2/STAT3 Signaling Pathway and Mitigation of Hypoxia within the Tumor Microenvironment
Combination Pair ID: 70
Pair Name Baicalin, Fluorouracil
Phytochemical Baicalin
Drug Fluorouracil
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result BA is a promising preventive or adjuvant therapy in breast cancer treatment with 5-FU mainly via cooperative inhibition of inflammation, angiogenesis, and triggering apoptotic cell death.
Combination Pair ID: 332
Pair Name Bergamottin, Simvastatin
Phytochemical Bergamottin
Drug Simvastatin
Disease Info [ICD-11: 2A20.1] Chronic myelogenous leukemia Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Discussion and conclusion Our results provide novel insight into the role of SV and BGM in potentially preventing and treating cancer through modulation of NF-κB signalling pathway and its regulated gene products.
Combination Pair ID: 235
Pair Name Beta-Elemene, Bevacizumab
Phytochemical Beta-Elemene
Drug Bevacizumab
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Bevacizumab exerts a synergistic effect with β-elemene in suppressing the growth of tumors derived from HCT-116 cells, and the related mechanisms may include the inhibition of tumor cell proliferation and tumor angiogenesis and the promotion of tumor cell apoptosis.
Combination Pair ID: 463
Pair Name Biochanin A, Fluorouracil
Phytochemical Biochanin A
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The synergistic antitumor effect of Bio-A/ 5-FU combination can be, at least partly, attributed to Bio-A-mediated suppression of ER-α/Akt axis and the augmentation of 5-FU-mediated proapoptotic effects.
Combination Pair ID: 499
Pair Name Bisdemethoxycucurmin, Icotinib
Phytochemical Bisdemethoxycucurmin
Drug Icotinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.
Combination Pair ID: 562
Pair Name Brassinolid, Doxorubicin
Phytochemical Brassinolid
Drug Doxorubicin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Vascular endothelial growth factor A Expression
Result These data indicate that EB, a natural product with widespread occurrence in plants, is pharmacologically active in both drug-sensitive and drug-resistant SCLC cells and acts through the Wnt signaling pathway.
Combination Pair ID: 354
Pair Name Bufalin, Sorafenib
Phytochemical Bufalin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The results revealed a synergistic anti-hepatoma effect of bufalin combined with sorafenib via affecting the tumor vascular microenvironment by targeting mTOR/VEGF signaling.
Combination Pair ID: 935
Pair Name Cordycepin, Apatinib
Phytochemical Cordycepin
Drug Apatinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Our findings demonstrated that the combination of cordycepin and apatinib has synergistically anticancer effect on NSCLC cells by down-regulating VEGF/PI3K/Akt signaling pathway. This result indicated that cordycepin and apatinib could be a promising drug combination against NSCLC.
Combination Pair ID: 241
Pair Name Crocin, Metformin
Phytochemical Crocin
Drug Metformin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result These findings suggest that a combination of crocin and metformin could serve as a novel therapeutic approach to enhance the effectiveness of metastatic breast cancer therapy.
Combination Pair ID: 390
Pair Name Curcumin, Arsenic oxide (As2O3)
Phytochemical Curcumin
Drug Arsenic oxide (As2O3)
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The antitumor effects of combination therapy with As2O3 and Curcumin have been displayed on prostate cancer cell lines (LNCaP and PC3), which probably originates from their potential to induce apoptosis and inhibit the growth of prostate cancer cells simultaneously.
Combination Pair ID: 122
Pair Name Epigallocatechin gallate, Metformin
Phytochemical Epigallocatechin gallate
Drug Metformin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Anti-proliferative and anti-apoptotic potential effects of epigallocatechin-3-gallate and/or metformin on hepatocellular carcinoma cells: in vitro study
Combination Pair ID: 661
Pair Name Epigallocatechin gallate, TNF-related apoptosis inducing ligand
Phytochemical Epigallocatechin gallate
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis
Combination Pair ID: 427
Pair Name Erianin, Afatinib
Phytochemical Erianin
Drug Afatinib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result EBTP/Afa targets VEGF and EGFR signaling pathways in liver cancer cells and tumor vasculature, thereby inhibiting the proliferation, motion and angiogenesis of liver cancer cells. Overall, this study provides a new combined strategy for the clinical treatment of hepatocellular carcinoma.
Combination Pair ID: 604
Pair Name Evening primrose oil, Tamoxifen
Phytochemical Evening primrose oil
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The most significant finding of this study was the confirmation of the anticancer activity of the natural product EPO, which potentiated the activity of the anticancer drug TAM against MCF-7 and MDA-MB-231 BC cell lines through the induction of apoptosis, inhibiting angiogenesis and halting cell proliferation.
Combination Pair ID: 883
Pair Name Gambogic Acid, Sunitinib
Phytochemical Gambogic Acid
Drug Sunitinib
Disease Info [ICD-11: 2C90.0] Renal cell carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Our results show that the joint use of GA and SU can provide greater antitumor efficacy compared to either drug alone and thus may offer a new treatment strategy for renal cell carcinoma.
Combination Pair ID: 926
Pair Name Gamma-Tocotrienol, Capecitabine
Phytochemical Gamma-Tocotrienol
Drug Capecitabine
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Our results show that γ-tocotrienol can potentiate the effects of capecitabine through suppression of NF-κB-regulated markers of proliferation, invasion, angiogenesis, and metastasis.
Combination Pair ID: 929
Pair Name Gamma-Tocotrienol, Capecitabine
Phytochemical Gamma-Tocotrienol
Drug Capecitabine
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Our findings suggest that γ-T3 inhibited the growth of human CRC and sensitised CRC to capecitabine by regulating proteins linked to tumourigenesis.
Combination Pair ID: 928
Pair Name Gamma-Tocotrienol, Gemcitabine
Phytochemical Gamma-Tocotrienol
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Our findings suggest that γ-T3 can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing NF-κB-mediated inflammatory pathways linked to tumorigenesis.
Combination Pair ID: 435
Pair Name Garcinol, Paclitaxel
Phytochemical Garcinol
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model
Combination Pair ID: 686
Pair Name Ginsenoside Rg3, Endostar
Phytochemical Ginsenoside Rg3
Drug Endostar
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Endostar combined with ginsenoside Rg3 has stronger inhibiting effect on breast cancer tumor growth in tumor-bearing mice than single drug, and it can inhibit angiogenesis and cell invasion, and enhance cell autophagy.
Combination Pair ID: 507
Pair Name Glucosinalbate, Doxorubicin
Phytochemical Glucosinalbate
Drug Doxorubicin
Disease Info [ICD-11: 2C90] Ehrlich ascites carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host.
Combination Pair ID: 465
Pair Name Gossypol, Ponatinib
Phytochemical Gossypol
Drug Ponatinib
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Gossypol could be used as an adjuvant medication for ponatinib in cancer treatment, possibly leading to successful dose reductions and fewer side effects; however, further research is needed before a clinical application could be feasible.
Combination Pair ID: 151
Pair Name Liquiritigenin, [4-({6-[Allyl(methyl)amino]hexyl}oxy)-2-fluorophenyl](4-bromophenyl)methanone
Phytochemical Liquiritigenin
Drug [4-({6-[Allyl(methyl)amino]hexyl}oxy)-2-fluorophenyl](4-bromophenyl)methanone
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The ERβ ligand LQ significantly enhanced the inhibition of breast-cancer cell viability and tumor-xenograft growth by RO. The anti-tumor properties of RO may in part be due to an off-target effect that reduces ERα and increases ERβ, the latter of which can then interact with LQ to promote anti-proliferative effects. The RO + LQ combination may have value when considering novel treatment strategies for hormone-dependent breast cancer.
Combination Pair ID: 347
Pair Name Matairesinol, Fluorouracil
Phytochemical Matairesinol
Drug Fluorouracil
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Matairesinol Induces Mitochondrial Dysfunction and Exerts Synergistic Anticancer Effects with 5-Fluorouracil in Pancreatic Cancer Cells
Combination Pair ID: 956
Pair Name Noscapine, Doxorubicin
Phytochemical Noscapine
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Noscapine potentiated the anticancer activity of Doxorubicin in a synergistic manner against TNBC tumors via inactivation of NF-KB and anti-angiogenic pathways while stimulating apoptosis. These findings suggest potential benefit for use of oral Noscapine and Doxorubicin combination therapy for treatment of more aggressive TNBC.
Combination Pair ID: 957
Pair Name Noscapine, Gemcitabine
Phytochemical Noscapine
Drug Gemcitabine
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Nos potentiated the anticancer activity of Gem in an additive to synergistic manner against lung cancer via antiangiogenic and apoptotic pathways. These findings suggest potential benefit for use of NGC chemotherapy for treatment of lung cancer.
Combination Pair ID: 18
Pair Name Oxymatrine, Paclitaxel
Phytochemical Oxymatrine
Drug Paclitaxel
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model
Combination Pair ID: 175
Pair Name Parthenolide, Balsalazide
Phytochemical Parthenolide
Drug Balsalazide
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result These results demonstrate that parthenolide potentiates the efficacy of balsalazide through synergistic inhibition of NF-κB activation and the combination of dual agents prevents colon carcinogenesis from chronic inflammation.
Combination Pair ID: 948
Pair Name Phenethyl isothiocyanate, Dasatinib
Phytochemical Phenethyl isothiocyanate
Drug Dasatinib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The inhibition of FAK/STAT3 signalling led to increased E-cadherin expression and reduced VEGF secretion, reducing HCC metastatic potential. Therefore, a combination of PEITC and dasatinib could be a potential therapeutic strategy for the treatment of HCC.
Combination Pair ID: 803
Pair Name Pterostilbene, Vorinostat
Phytochemical Pterostilbene
Drug Vorinostat
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Our study provides preclinical evidence that Pter/SAHA combination treatment inhibits MTA1/HIF-1α tumor-promoting signaling in PCa. The beneficial outcome of combinatorial strategy using a natural agent and an approved drug for higher efficacy and less toxicity supports further development of MTA1-targeted therapies in PCa.
Combination Pair ID: 380
Pair Name Resveratrol, Gemcitabine
Phytochemical Resveratrol
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result These results suggest that VEGF-B signaling pathway plays an important role in the development of PaCa and combination of GEM and RSV would be a promising modality for clinical PaCa therapy.
Combination Pair ID: 812
Pair Name Resveratrol, Sorafenib
Phytochemical Resveratrol
Drug Sorafenib
Disease Info [ICD-11: 2C90.0] Renal cell carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result PEGylated resveratrol combined with sorafenib can achieve synergistic anti-RCC activity, and the mechanism may be related to the inhibition of Akt/mTOR/p70S6k-4EBP-1 and c-Raf7MEK/ERK signaling pathways.
Combination Pair ID: 319
Pair Name Rosmarinic acid, Paclitaxel
Phytochemical Rosmarinic acid
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Rosmarinic acid exerted chemo-preventive and therapeutic potential alone or in combination with Paclitaxel. Moreover, rosmarinic acid targets numerous signaling pathways associated with breast cancer.
Combination Pair ID: 725
Pair Name Shikonin, Gemcitabine
Phytochemical Shikonin
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Our results suggest that shikonin can suppress the growth of human pancreatic tumors and potentiate the antitumor effects of gemcitabine through the suppression of NF-κB and NF-κB-regulated gene products.
Combination Pair ID: 295
Pair Name Tanshinone IIA, Imatinib
Phytochemical Tanshinone IIA
Drug Imatinib
Disease Info [ICD-11: 2A20.1] Chronic myelogenous leukemia Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The results revealed that Tan IIA enhanced the inhibitory effect of imatinib on TIB‑152 cell proliferation, migration and invasion, and induced apoptosis, which may be associated with inhibition of the PI3K/AKT/mTOR signaling pathway.
Combination Pair ID: 478
Pair Name Tetrahydrocurcumin, Celecoxib
Phytochemical Tetrahydrocurcumin
Drug Celecoxib
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The combinational treatment effect of THC and celecoxib causing inhibition of tumor growth and tumor angiogenesis via down-regulation of VEGF, COX-2 and EGFR expression. However, this combined treatment did not show the synergistic effect on inhibiting the tumor growth and tumor angiogenesis in cervical cancer (CaSki)-implanted nude mice model.
Combination Pair ID: 620
Pair Name Tetrandrine, Cisplatin
Phytochemical Tetrandrine
Drug Cisplatin
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo
Combination Pair ID: 746
Pair Name Thymoquinone, Bortezomib
Phytochemical Thymoquinone
Drug Bortezomib
Disease Info [ICD-11: 2A85.5] Mantle cell lymphoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-KappaB regulated gene products in multiple myeloma xenograft mouse model
Combination Pair ID: 750
Pair Name Thymoquinone, Fluorouracil
Phytochemical Thymoquinone
Drug Fluorouracil
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result Our findings present the first report describing the in vivo enhancement effect of combined TQ and 5-FU against early stages of CRC; however, further studies are required to determine the value of this combination therapy in an advanced long-term model of CRC and also to realize its clinical potential.
Combination Pair ID: 754
Pair Name Thymoquinone, Propranolol
Phytochemical Thymoquinone
Drug Propranolol
Disease Info [ICD-11: 2C23.Z] Laryngeal cancer Investigative
Regulate Info Up-regulation Vascular endothelial growth factor A Expression
Result The effect of thymoquinone and propranolol combination on epidermoid laryngeal carcinoma cell.
Combination Pair ID: 568
Pair Name Zerumbone, Cisplatin
Phytochemical Zerumbone
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor A Expression
Result The current study indicates that the treatment of 4.62 μM of ZER combined with 1.93 μM of CIS in human liver cancer cells exerts synergistic effects on cell growth inhibition, apoptosis induction, angiogenesis, and invasion by modulating gene expression.
Combination Pair ID: 918
Pair Name Zerumbone, Gefitinib
Phytochemical Zerumbone
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Vascular endothelial growth factor A Expression
Result Our study suggested that zerumbone combined with gefitinib could effectively inhibit lung cancer for multi-model therapies, including the inhibition of tumor growth, angiogenesis, induce cell apoptosis, and ferroptosis.
03. Reference
No. Title Href
1 Anti-angiogenic effect of the combination of low-dose sorafenib and EGCG in HCC-induced Wistar rats. F1000Res. 2022 Mar 9;11:289. doi: 10.12688/f1000research.109142.2. Click
2 Amygdalin potentiates the anti-cancer effect of Sorafenib on Ehrlich ascites carcinoma and ameliorates the associated liver damage. Sci Rep. 2022 Apr 20;12(1):6494. doi: 10.1038/s41598-022-10517-0. Click
3 Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. Click
4 Quinacrine and Curcumin in combination decreased the breast cancer angiogenesis by modulating ABCG2 via VEGF A. J Cell Commun Signal. 2023 Sep;17(3):609-626. doi: 10.1007/s12079-022-00692-0. Click
5 Tuning mPEG-PLA/vitamin E-TPGS-based mixed micelles for combined celecoxib/honokiol therapy for breast cancer. Eur J Pharm Sci. 2020 Apr 15;146:105277. doi: 10.1016/j.ejps.2020.105277. Click
6 Ilexgenin A exerts anti-inflammation and anti-angiogenesis effects through inhibition of STAT3 and PI3K pathways and exhibits synergistic effects with Sorafenib on hepatoma growth. Toxicol Appl Pharmacol. 2017 Jan 15;315:90-101. doi: 10.1016/j.taap.2016.12.008. Click
7 Targeting the ROS/PI3K/AKT/HIF-1α/HK2 axis of breast cancer cells: Combined administration of Polydatin and 2-Deoxy-d-glucose. J Cell Mol Med. 2019 May;23(5):3711-3723. doi: 10.1111/jcmm.14276. Click
8 The inhibitory effect of 6-gingerol and cisplatin on ovarian cancer and antitumor activity: In silico, in vitro, and in vivo. Front Oncol. 2023 Mar 3;13:1098429. doi: 10.3389/fonc.2023.1098429. Click
9 4'-hydroxywogonin inhibits colorectal cancer angiogenesis by disrupting PI3K/AKT signaling. Chem Biol Interact. 2018 Dec 25;296:26-33. doi: 10.1016/j.cbi.2018.09.003. Click
10 Reinforcement of Sorafenib Anti-osteosarcoma Effect by Amentoflavone Is Associated With the Induction of Apoptosis and Inactivation of ERK/NF-κB. In Vivo. 2022 May-Jun;36(3):1136-1143. doi: 10.21873/invivo.12812. Click
11 Astaxanthin Augmented the Anti-Hepatocellular Carcinoma Efficacy of Sorafenib Through the Inhibition of the JAK2/STAT3 Signaling Pathway and Mitigation of Hypoxia within the Tumor Microenvironment. Mol Nutr Food Res. 2024 Jan;68(2):e2300569. doi: 10.1002/mnfr.202300569. Click
12 Baicalin; a promising chemopreventive agent, enhances the antitumor effect of 5-FU against breast cancer and inhibits tumor growth and angiogenesis in Ehrlich solid tumor. Biomed Pharmacother. 2022 Feb;146:112599. doi: 10.1016/j.biopha.2021.112599. Click
13 Simvastatin in combination with bergamottin potentiates TNF-induced apoptosis through modulation of NF-κB signalling pathway in human chronic myelogenous leukaemia. Pharm Biol. 2016 Oct;54(10):2050-60. doi: 10.3109/13880209.2016.1141221. Click
14 Synergistic effects of bevacizumab in combination with β-elemene on subcutaneous xenografts derived from HCT-116 human colon cancer cells. Transl Cancer Res. 2020 Feb;9(2):1001-1011. doi: 10.21037/tcr.2019.12.35. Click
15 The natural isoflavone Biochanin-A synergizes 5-fluorouracil anticancer activity in vitro and in vivo in Ehrlich solid-phase carcinoma model. Phytother Res. 2022 Mar;36(3):1310-1325. doi: 10.1002/ptr.7388. Click
16 Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib. Click
17 The effect of brassinolide, a plant steroid hormone, on drug resistant small-cell lung carcinoma cells. Biochem Biophys Res Commun. 2017 Nov 4;493(1):783-787. doi: 10.1016/j.bbrc.2017.08.094. Click
18 Synergistic anti-hepatoma effect of bufalin combined with sorafenib via mediating the tumor vascular microenvironment by targeting mTOR/VEGF signaling. Int J Oncol. 2018;52(6):2051-2060. doi:10.3892/ijo.2018.4351 Click
19 Combination of Cordycepin and Apatinib Synergistically Inhibits NSCLC Cells by Down-Regulating VEGF/PI3K/Akt Signaling Pathway. Front Oncol. 2020 Sep 7;10:1732. doi: 10.3389/fonc.2020.01732. Click
20 Crocin and Metformin suppress metastatic breast cancer progression via VEGF and MMP9 downregulations: in vitro and in vivo studies. Mol Cell Biochem. 2021 Sep;476(9):3341-3351. doi: 10.1007/s11010-020-04043-8. Click
21 Human prostate cancer cell epithelial-to-mesenchymal transition as a novel target of arsenic trioxide and curcumin therapeutic approach. Tissue Cell. 2022 Jun;76:101805. doi: 10.1016/j.tice.2022.101805. Click
22 Anti-proliferative and anti-apoptotic potential effects of epigallocatechin-3-gallate and/or metformin on hepatocellular carcinoma cells: in vitro study. Mol Biol Rep. 2019 Apr;46(2):2039-2047. doi: 10.1007/s11033-019-04653-6. Click
23 Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63. doi: 10.1038/sj.onc.1210840. Click
24 Ethoxy-erianin phosphate and afatinib synergistically inhibit liver tumor growth and angiogenesis via regulating VEGF and EGFR signaling pathways. Toxicol Appl Pharmacol. 2022 Mar 1;438:115911. doi: 10.1016/j.taap.2022.115911. Click
25 Evening Primrose Oil Enhances Tamoxifen's Anticancer Activity against Breast Cancer Cells by Inducing Apoptosis, Inhibiting Angiogenesis, and Arresting the Cell Cycle. Molecules. 2022 Apr 7;27(8):2391. doi: 10.3390/molecules27082391 Click
26 Targeting renal cell carcinoma with gambogic acid in combination with sunitinib in vitro and in vivo. Asian Pac J Cancer Prev. 2012;13(12):6463-8. doi: 10.7314/apjcp.2012.13.12.6463. Click
27 First evidence that γ-tocotrienol inhibits the growth of human gastric cancer and chemosensitizes it to capecitabine in a xenograft mouse model through the modulation of NF-κB pathway. Clin Cancer Res. 2012 Apr 15;18(8):2220-9. doi: 10.1158/1078-0432.CCR-11-2470. Click
28 γ-Tocotrienol suppresses growth and sensitises human colorectal tumours to capecitabine in a nude mouse xenograft model by down-regulating multiple molecules. Br J Cancer. 2016 Sep 27;115(7):814-24. doi: 10.1038/bjc.2016.257. Click
29 {Gamma}-tocotrienol inhibits pancreatic tumors and sensitizes them to gemcitabine treatment by modulating the inflammatory microenvironment. Cancer Res. 2010 Nov 1;70(21):8695-705. doi: 10.1158/0008-5472.CAN-10-2318. Epub 2010 Sep 23. Click
30 Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. Click
31 Inhibiting effect of Endostar combined with ginsenoside Rg3 on breast cancer tumor growth in tumor-bearing mice. Asian Pac J Trop Med. 2016 Feb;9(2):180-3. doi: 10.1016/j.apjtm.2016.01.010. Click
32 Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. Click
33 The ponatinib/gossypol novel combination provides enhanced anticancer activity against murine solid Ehrlich carcinoma via triggering apoptosis and inhibiting proliferation/angiogenesis. Toxicol Appl Pharmacol. 2021 Dec 1;432:115767. doi: 10.1016/j.taap.2021.115767. Click
34 The estrogen receptor beta agonist liquiritigenin enhances the inhibitory effects of the cholesterol biosynthesis inhibitor RO 48-8071 on hormone-dependent breast-cancer growth. Breast Cancer Res Treat. 2022 Feb;192(1):53-63. doi: 10.1007/s10549-021-06487-y. Click
35 Matairesinol Induces Mitochondrial Dysfunction and Exerts Synergistic Anticancer Effects with 5-Fluorouracil in Pancreatic Cancer Cells. Mar Drugs. 2022 Jul 25;20(8):473. doi: 10.3390/md20080473. Click
36 Antitumor activity of Noscapine in combination with Doxorubicin in triple negative breast cancer. PLoS One. 2011 Mar 15;6(3):e17733. doi: 10.1371/journal.pone.0017733. Click
37 Enhanced anticancer activity of gemcitabine in combination with noscapine via antiangiogenic and apoptotic pathway against non-small cell lung cancer. PLoS One. 2011;6(11):e27394. doi: 10.1371/journal.pone.0027394. Click
38 Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model. Cancers (Basel). 2019 Jan 7;11(1):49. doi: 10.3390/cancers11010049. Click
39 Combined Parthenolide and Balsalazide Have Enhanced Antitumor Efficacy Through Blockade of NF-κB Activation. Mol Cancer Res. 2017 Feb;15(2):141-151. doi: 10.1158/1541-7786.MCR-16-0101. Click
40 Combination of Phenethyl Isothiocyanate and Dasatinib Inhibits Hepatocellular Carcinoma Metastatic Potential through FAK/STAT3/Cadherin Signalling and Reduction of VEGF Secretion. Pharmaceutics. 2023 Sep 27;15(10):2390. doi: 10.3390/pharmaceutics15102390. Click
41 Targeting MTA1/HIF-1α signaling by pterostilbene in combination with histone deacetylase inhibitor attenuates prostate cancer progression. Cancer Med. 2017 Nov;6(11):2673-2685. doi: 10.1002/cam4.1209. Click
42 Gemcitabine potentiates anti-tumor effect of resveratrol on pancreatic cancer via down-regulation of VEGF-B. J Cancer Res Clin Oncol. 2021 Jan;147(1):93-103. doi: 10.1007/s00432-020-03384-7. Click
43 Synergistic anti-tumour activity of sorafenib in combination with pegylated resveratrol is mediated by Akt/mTOR/p70S6k-4EBP-1 and c-Raf7MEK/ERK signaling pathways. Heliyon. 2023 Aug 19;9(8):e19154. doi: 10.1016/j.heliyon.2023.e19154. Click
44 Rosmarinic acid suppresses inflammation, angiogenesis, and improves paclitaxel induced apoptosis in a breast cancer model via NF3 κB-p53-caspase-3 pathways modulation. J Appl Biomed. 2021 Dec;19(4):202-209. doi: 10.32725/jab.2021.024. Click
45 Shikonin suppresses tumor growth and synergizes with gemcitabine in a pancreatic cancer xenograft model: Involvement of NF-κB signaling pathway. Biochem Pharmacol. 2014 Apr 1;88(3):322-33. doi: 10.1016/j.bcp.2014.01.041. Click
46 Tanshinone IIA enhances the inhibitory effect of imatinib on proliferation and motility of acute leukemia cell line TIB‑152 in vivo and in vitro by inhibiting the PI3K/AKT/mTOR signaling pathway. Oncol Rep. 2020 Feb;43(2):503-515. doi: 10.3892/or.2019.7453. Click
47 Combinational Treatment Effect of Tetrahydrocurcumin and Celecoxib on Cervical Cancer Cell-Induced Tumor Growth and Tumor Angiogenesis in Nude Mice. J Med Assoc Thai. 2016 Jul;99 Suppl 4:S23-31. Click
48 Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo. Cancer Lett. 2011 May 1;304(1):21-32. doi: 10.1016/j.canlet.2011.01.022. Click
49 Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-κB regulated gene products in multiple myeloma xenograft mouse model. Oncotarget. 2014 Feb 15;5(3):634-48. doi: 10.18632/oncotarget.1596. Click
50 Thymoquinone subdues tumor growth and potentiates the chemopreventive effect of 5-fluorouracil on the early stages of colorectal carcinogenesis in rats. Drug Des Devel Ther. 2016 Jul 11;10:2239-53. doi: 10.2147/DDDT.S109721. Click
51 The effect of thymoquinone and propranolol combination on epidermoid laryngeal carcinoma cell. Eur Arch Otorhinolaryngol. 2023 Jun;280(6):2849-2858. doi: 10.1007/s00405-023-07825-0. Click
52 Zerumbone Sensitizes the Anti-Cancer Efficacy of Cisplatin in Hepatocellular Carcinoma Cells. Anticancer Agents Med Chem. 2022 Aug 4;22(16):2885-2895. doi: 10.2174/1871520622666220324090801. Click
53 Zerumbone combined with gefitinib alleviates lung cancer cell growth through the AKT/STAT3/SLC7A11 axis. Neoplasma. 2023 Feb;70(1):58-70. doi: 10.4149/neo_2022_220418N423. Click
It has been 26128 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP