TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Signal transducer and activator of transcription 3
UniProt ID STAT3_HUMAN
Gene Name STAT3
Gene ID 6774
Synonyms
STAT3, ADMIO, ADMIO1, APRF, HIES
Sequence
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Pathway Map MAP LINK
T.C. Number 8.A.143.1.1; 8.A.152.1.12; 8.A.23.4.1
KEGG ID hsa6774
TTD ID T29130
Pfam PF00017; PF01017; PF02864; PF02865; PF04513; PF11570; PF21354
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 446
Pair Name Corilagin, Paclitaxel
Phytochemical Name Corilagin
Anticancer drug Name Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result Our observations indicate that corilagin sensitized epithelial ovarian cancer cells to paclitaxel and carboplatin treatment by primarily inhibiting Snail-glycolysis pathways. Corilagin is a herbal medicine with low toxic effects to normal cells, particularly hepatoprotective, and may be an ideal complimentary medicine when combined with highly toxic chemotherapeutic agents.
Combination Pair ID: 261
Pair Name Ilexgenin A, Sorafenib
Phytochemical Name Ilexgenin A
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result The results described in the present study identifies Ilexgenin A as a promising therapeutic candidate that modulates inflammation, angiogenesis, and HCC growth.
Combination Pair ID: 130
Pair Name Isovitexin, Cisplatin
Phytochemical Name Isovitexin
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result IVT not only inhibited cell proliferation and glucose metabolism via downregulating the expression of PKM2 to enhance the antitumor activity of DDP against lung cancer cells, and improved DDP-induced immunotoxicity in mice. It also presented a novel strategy to enhance the anti-tumor effect of platinum-based chemotherapy against NSCLC.
Combination Pair ID: 508
Pair Name Mahanine, Cisplatin
Phytochemical Name Mahanine
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Our results revealed that mahanine may be a prospective agent to reduce the concentration of cisplatin in adjunct for the treatment of cancer and thereby decreasing its toxicity.
Combination Pair ID: 659
Pair Name Morusin, TNF-related apoptosis inducing ligand
Phytochemical Name Morusin
Anticancer drug Name TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result These results suggest that morusin enhances TRAIL sensitivity in human glioblastoma cells through regulating expression of DR5 and EGFR. Therefore, the combination treatment of TRAIL and morusin may be a new therapeutic strategy for malignant glioma patients.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 240
Pair Name Alantolactone, Erlotinib
Phytochemical Alantolactone
Drug Erlotinib
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result Our results suggested that Alantolactone could sensitize human pancreatic cancer cells to EGFR inhibitors possibly through down-regulating the STAT3 signaling. Alantolactone, when combined with other EGFR targeted agents, could be further developed as a potential therapy for pancreatic cancer.
Combination Pair ID: 1006
Pair Name Artesunate, Sorafenib
Phytochemical Artesunate
Drug Sorafenib
Disease Info [ICD-11: XH50P3] Non‑hodgkin lymphoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result Artesunate synergistically promotes sorafenib‑induced apoptosis and ferroptosis in non‑Hodgkin lymphoma cells through inhibition of the STAT3 pathway
Combination Pair ID: 1015
Pair Name Astaxanthin, Sorafenib
Phytochemical Astaxanthin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Astaxanthin Augmented the Anti-Hepatocellular Carcinoma Efficacy of Sorafenib Through the Inhibition of the JAK2/STAT3 Signaling Pathway and Mitigation of Hypoxia within the Tumor Microenvironment
Combination Pair ID: 31
Pair Name Berbamine, Arcyriaflavin A
Phytochemical Berbamine
Drug Arcyriaflavin A
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells.
Combination Pair ID: 29
Pair Name Berbamine, Sorafenib
Phytochemical Berbamine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result These findings identify a new type of natural STAT3 inhibitor and provide a novel approach to the enhancement of SORA efficacy by blocking the activation of STAT3.
Combination Pair ID: 589
Pair Name Beta-Caryophyllene, Doxorubicin
Phytochemical Beta-Caryophyllene
Drug Doxorubicin
Disease Info [ICD-11: 2C17] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result This evidence highlighted a possible role of STAT3 as a final effector of a complex network regulated by β-caryophyllene, which leads to an enhanced doxorubicin-sensitivity of cholangiocarcinoma cells and a lowered chemotherapy toxicity in nonmalignant cholangiocytes, thus strengthening the interest for this natural sesquiterpene as a dual-acting chemosensitizing and chemopreventive agent.
Combination Pair ID: 703
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2B63] Gingival squamous cell carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result The results indicated that β-elemene promoted the anti-proliferative and apoptotic effect of cisplatin by inhibiting STAT3 and blocking the JAK2-STAT3 signaling pathway in GSCC in vitro and in vivo.
Combination Pair ID: 1038
Pair Name Cryptotanshinone, Temozolomide
Phytochemical Cryptotanshinone
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Combined treatment with CTS and TMZ might be an effective option to overcome the chemoresistance of GBM cells in a long-term treatment strategy.
Combination Pair ID: 292
Pair Name Cryptotanshinone, Trifluridine
Phytochemical Cryptotanshinone
Drug Trifluridine
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result FTD combined with CTS has a synergistic anti-gastric cancer effect as shown by in vitro and in vivo experiments, and the combined treatment of FTD and CTS will be a promising treatment option for advanced gastric cancer.
Combination Pair ID: 219
Pair Name Cucurbitacin B, Sorafenib
Phytochemical Cucurbitacin B
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Sorafenib and CuB exert synergistic antitumor effects through a pathway that may involve STAT3 phosphorylation, and this may represent a promising therapeutic approach for treatment of HCC.
Combination Pair ID: 690
Pair Name Cucurbitacin I, Fluorouracil
Phytochemical Cucurbitacin I
Drug Fluorouracil
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Our results suggest that cucurbitacin I may be a potent adjuvant chemotherapeutic agent for colon cancer with anti-migration, anti-invasion and chemosensitizing activities.
Combination Pair ID: 400
Pair Name Curcumin, Arsenic trioxide
Phytochemical Curcumin
Drug Arsenic trioxide
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result Our results suggested that curcumin and As2O3 combination therapy exerts more significant anti-leukemia effects in the treatment of AML than curcumin or As2O3 monotherapy by up-regulating p53 pathway and down-regulating the JAK2/STAT3 pathway.
Combination Pair ID: 814
Pair Name Curcumin, Thalidomide
Phytochemical Curcumin
Drug Thalidomide
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result Our findings suggested that down-regulation of STAT3 and BCL-XL mRNA expression in response to CUR and THAL treatment lead to inhibition of cell growth and induction of apoptosis.
Combination Pair ID: 335
Pair Name Decursin, Doxorubicin
Phytochemical Decursin
Drug Doxorubicin
Disease Info [ICD-11: 2A83] Multiple myeloma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result The combination treatment of decursin and doxorubicin can enhance apoptotic activity via mTOR and/or STAT3 signaling pathway in multiple myeloma cells.
Combination Pair ID: 166
Pair Name Dihydroartemisinin, Oxaliplatin
Phytochemical Dihydroartemisinin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result We demonstrated an improved therapeutic strategy for CRC patients by combining DHA and oxaliplatin treatments.
Combination Pair ID: 427
Pair Name Erianin, Afatinib
Phytochemical Erianin
Drug Afatinib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result EBTP/Afa targets VEGF and EGFR signaling pathways in liver cancer cells and tumor vasculature, thereby inhibiting the proliferation, motion and angiogenesis of liver cancer cells. Overall, this study provides a new combined strategy for the clinical treatment of hepatocellular carcinoma.
Combination Pair ID: 577
Pair Name Falcarindiol, Cisplatin
Phytochemical Falcarindiol
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Our study illustrated that FAD is a potential anticancer drug and strengthens the chemosensitivity of HCC cells to DDP by inhibiting the STAT3/PTTG1 pathway.
Combination Pair ID: 934
Pair Name Gallic acid, Cisplatin
Phytochemical Gallic acid
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result GA enhanced the anticancer effect of Pira on K562 and K562/Dox cancer cells through cellular energy status impairment, and was able to reverse drug resistance in living K562/Dox cancer cells by inhibiting the function of P‑glycoprotein.
Combination Pair ID: 69
Pair Name Kaempferol, Gefitinib
Phytochemical Kaempferol
Drug Gefitinib
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Kaempferol suppresses glioma progression and synergistically enhances the antitumor activity of gefitinib by inhibiting the EGFR/SRC/STAT3 signaling pathway
Combination Pair ID: 133
Pair Name Kurarinone, TNF-related apoptosis inducing ligand
Phytochemical Kurarinone
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result Kurarinone Synergizes TRAIL-Induced Apoptosis in Gastric Cancer Cells
Combination Pair ID: 63
Pair Name Luteolin, Erlotinib
Phytochemical Luteolin
Drug Erlotinib
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result These findings suggest that combining luteolin with erlotinib offers a potential treatment strategy for glioblastoma multiforme IV.
Combination Pair ID: 494
Pair Name Lycopene, Anti-PD-1 antibody
Phytochemical Lycopene
Drug Anti-PD-1 antibody
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result lycopene promoted anti-PD-1 therapeutic efficiency of lung cancer by promoting IFNγ-expressing CD8+ cells infiltrated in tumor tissues and increasing IFNγ expression in tumor cells.
Combination Pair ID: 660
Pair Name Morin, MST312
Phytochemical Morin
Drug MST312
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Our study suggests that novel targeted-therapy can be implemented by using flavonoid morin and telomerase inhibitor MST‑312 for improved cancer prognosis.
Combination Pair ID: 115
Pair Name Morusin, MAPK pathway inhibitors
Phytochemical Morusin
Drug MAPK pathway inhibitors
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Our results suggested that the combination of morusin and MAPK pathway inhibitors may be a more effective treatment strategy for BRAF-mutant melanoma than MAPK pathway inhibitors alone.
Combination Pair ID: 20
Pair Name Narciclasine, Tamoxifen
Phytochemical Narciclasine
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Our findings successfully highlight the STAT3 as the direct therapeutic target of Nar in ER-positive breast cancer cells, especially, Nar leaded STAT3 degradation as a promising strategy for the tamoxifen-resistant breast cancer treatment.
Combination Pair ID: 81
Pair Name Nobiletin, Bicalutamide
Phytochemical Nobiletin
Drug Bicalutamide
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result NBT and BCT combination reduced key cellular signaling regulators including: p-Erk/Erk, p-STAT3/STAT3 and NF-κB. Overall, these results suggest that NBT combination with BCT may be an effective treatment for prostate cancer.
Combination Pair ID: 657
Pair Name Norizalpinin, Cisplatin
Phytochemical Norizalpinin
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result Our data indicated a novel therapeutic strategy to potentiate DDP-induced anti-tumor effect in lung cancer cells with DDP resistance by GG through inactivating p-STAT3/p65 and Bcl-2 pathways.
Combination Pair ID: 474
Pair Name Oxidized tea polyphenol, Nimotuzumab
Phytochemical Oxidized tea polyphenol
Drug Nimotuzumab
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result OTP-3 can also serve as an effective therapeutic agent in NSCLC where it can augment the effects of nimotuzumab, a valuable property for combination agents.
Combination Pair ID: 948
Pair Name Phenethyl isothiocyanate, Dasatinib
Phytochemical Phenethyl isothiocyanate
Drug Dasatinib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result The inhibition of FAK/STAT3 signalling led to increased E-cadherin expression and reduced VEGF secretion, reducing HCC metastatic potential. Therefore, a combination of PEITC and dasatinib could be a potential therapeutic strategy for the treatment of HCC.
Combination Pair ID: 736
Pair Name Plumbagin, Celecoxib
Phytochemical Plumbagin
Drug Celecoxib
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result Combination of Celecoxib and Plumbagin decreased melanoma cell proliferation and retarded vascular development of tumors mediated by inhibition of COX-2 and STAT3 leading to decreased levels of key cyclins key on which melanoma cell were dependent for survival.
Combination Pair ID: 801
Pair Name Pterostilbene, Osimertinib
Phytochemical Pterostilbene
Drug Osimertinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result The results of this study indicate that pterostilbene may be used to abrogate the activated resistance pathways of single osimertinib treatment in EGFR-mutation positive NSCLC. Future studies should focus on in vivo translation and confirmation of these results.
Combination Pair ID: 476
Pair Name Quercetin, Cisplatin
Phytochemical Quercetin
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result This study provides further new data for the mechanism by which the QU pre-treatment re-sensitizes SKOV-3/CDDP cells to cisplatin.
Combination Pair ID: 376
Pair Name Resveratrol, Temozolomide
Phytochemical Resveratrol
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Our results demonstrated synergistic effects of Res/TMZ on RG-2 cells and their bilaterally sensitizing effects to LN-18 and LN-428 cells. Frequent upregulation of MGMT and activation of STAT3 are the unfavorable factors for the treatment of GBMs and they may be the potential targets of Res/TMZ therapy.
Combination Pair ID: 382
Pair Name Resveratrol, Temozolomide
Phytochemical Resveratrol
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result Res inhibited STAT3 signaling through modulation of PIAS3, SHP1, SHP2, and SOCS3, thereby attenuating tumor growth and increasing sensitivity to TMZ. Therefore, Res is an ideal candidate to be used in TMZ combined chemotherapy for GBM.
Combination Pair ID: 38
Pair Name Rutaecarpine, Fluorouracil
Phytochemical Rutaecarpine
Drug Fluorouracil
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Combined therapy with 5-FU and RUT exerted a superior curative effect in CRC than treatment with either single drug alone and has potential as a novel therapeutic modality for the treatment of CRC.
Combination Pair ID: 227
Pair Name Saikosaponin D, Gefitinib
Phytochemical Saikosaponin D
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result These results indicated that the combination of SSD with gefitinib had an increased antitumor effect in NSCLC cells and that the molecular mechanisms were associated with the inhibition of STAT3/Bcl-2 signaling pathway. Our findings suggest a promising approach for the treatment of NSCLC patients with EGFR-TKI resistance.
Combination Pair ID: 51
Pair Name Sanguinarium, Bortezomib
Phytochemical Sanguinarium
Drug Bortezomib
Disease Info [ICD-11: 2A83] Multiple myeloma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result Our findings demonstrate that SNG induces mitochondrial and caspase-dependent apoptosis, generates oxidative stress, and suppresses MM cell lines proliferation. In addition, co-treatment of MM cell lines with sub-toxic doses of SNG and BTZ potentiated the cytotoxic activity. These results would suggest that SNG could be developed into therapeutic agent either alone or in combination with other anticancer drugs in MM.
Combination Pair ID: 286
Pair Name Shikonin, Gefitinib
Phytochemical Shikonin
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result These results provide a promising therapeutic approach for the treatment of wild-type EGFR non-small cell lung cancer.
Combination Pair ID: 724
Pair Name Shikonin, TNF-related apoptosis inducing ligand
Phytochemical Shikonin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result The results indicated that shikonin sensitized resistant cancer cells to TRAIL-induced cytotoxicity via the modulation of the JNK, STAT3 and AKT pathways, the downregulation of antiapoptotic proteins and the upregulation of proapoptotic proteins.
Combination Pair ID: 99
Pair Name Silibinin, Sorafenib
Phytochemical Silibinin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result These results suggested that silibinin improved the efficacy of sorafenib in HCC therapy, indicating a clinical promising therapeutic strategy for HCC patients.
Combination Pair ID: 732
Pair Name Tanshinone IIA, Sorafenib
Phytochemical Tanshinone IIA
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result A combination therapy using Tan-IIA and sorafenib or SC-1 could be a promising approach to target HCC, and further preclinical investigations are warranted to establish their synergetic advantage.
Combination Pair ID: 296
Pair Name Tanshinone IIA, TNF-related apoptosis inducing ligand
Phytochemical Tanshinone IIA
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result T-IIA increases TRAIL-induced apoptosis by downregulating STAT3 and upregulating DR4 and DR5, indicating T-IIA therapy as a novel treatment strategy for TRAIL-resistant GBM.
Combination Pair ID: 691
Pair Name Toosendanin, Regorafenib
Phytochemical Toosendanin
Drug Regorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result TSN and RGF combination (TRC) synergistically inhibited the proliferation and migration of MHCC-97L cells. The upregulation of WWOX (WW-domain containing oxidoreductase) played a vital role in the HCC cell growth treated with TRC
Combination Pair ID: 350
Pair Name Ursodiol, Sorafenib
Phytochemical Ursodiol
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result The present findings may represent a promising therapeutic strategy for patients with advanced hepatocellular carcinoma.
Combination Pair ID: 568
Pair Name Zerumbone, Cisplatin
Phytochemical Zerumbone
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Expression
Result The current study indicates that the treatment of 4.62 μM of ZER combined with 1.93 μM of CIS in human liver cancer cells exerts synergistic effects on cell growth inhibition, apoptosis induction, angiogenesis, and invasion by modulating gene expression.
Combination Pair ID: 918
Pair Name Zerumbone, Gefitinib
Phytochemical Zerumbone
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Our study suggested that zerumbone combined with gefitinib could effectively inhibit lung cancer for multi-model therapies, including the inhibition of tumor growth, angiogenesis, induce cell apoptosis, and ferroptosis.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 218
Pair Name Cucurbitacin B, Gefitinib
Phytochemical Cucurbitacin B
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result CuB reduced the proliferation of GR PC9 cells by modulating the miR‑17‑5p/STAT3 axis, and may represent a promising potential novel strategy for the reversal of GR.
Combination Pair ID: 931
Pair Name Gamma-Tocotrienol, Simvastatin
Phytochemical Gamma-Tocotrienol
Drug Simvastatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Data demonstrate that SVA and γT3 alone or in combination possess the ability to eliminate CSCs in drug resistant human breast cancer cells.
Combination Pair ID: 498
Pair Name Isocorydine, Gemcitabine
Phytochemical Isocorydine
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result The synergistic treatment effect of the combination treatment of ICD and gemcitabine in pancreatic cancer cells was confirmed in established xenograft models.
Combination Pair ID: 362
Pair Name Oleanolic Acid, Cisplatin
Phytochemical Oleanolic Acid
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result OLO-2 treatment also exhibited up to 4.6-fold selectivity against human lung adenocarcinoma cells. Taken together, the results of the present study shed light on the drug resistance-reversing effects of OLO-2 in lung cancer cells.
Combination Pair ID: 121
Pair Name Troxerutin, Fluorouracil
Phytochemical Troxerutin
Drug Fluorouracil
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation Signal transducer and activator of transcription 3 Phosphorylation
Result Our data indicated a novel therapeutic strategy to potentiate 5-FU-induced anti-tumor effect in gastric cancer cells with resistance to 5-FU by TXN through suppression of p-STAT3/NF-κB (p65 and p50) and Bcl-2.
03. Reference
No. Title Href
1 Corilagin sensitizes epithelial ovarian cancer to chemotherapy by inhibiting Snail‑glycolysis pathways. Oncol Rep. 2017 Oct;38(4):2464-2470. doi: 10.3892/or.2017.5886. Click
2 Ilexgenin A exerts anti-inflammation and anti-angiogenesis effects through inhibition of STAT3 and PI3K pathways and exhibits synergistic effects with Sorafenib on hepatoma growth. Toxicol Appl Pharmacol. 2017 Jan 15;315:90-101. doi: 10.1016/j.taap.2016.12.008. Click
3 Isovitexin potentiated the antitumor activity of cisplatin by inhibiting the glucose metabolism of lung cancer cells and reduced cisplatin-induced immunotoxicity in mice. Int Immunopharmacol. 2021 May;94:107357. doi: 10.1016/j.intimp.2020.107357. Click
4 Improved chemosensitivity in cervical cancer to cisplatin: synergistic activity of mahanine through STAT3 inhibition. Cancer Lett. 2014 Aug 28;351(1):81-90. doi: 10.1016/j.canlet.2014.05.005. Click
5 Morusin Induces TRAIL Sensitization by Regulating EGFR and DR5 in Human Glioblastoma Cells. J Nat Prod. 2016 Feb 26;79(2):317-23. doi: 10.1021/acs.jnatprod.5b00919. Click
6 Alantolactone sensitizes human pancreatic cancer cells to EGFR inhibitors through the inhibition of STAT3 signaling. Mol Carcinog. 2019 Apr;58(4):565-576. doi: 10.1002/mc.22951. Click
7 Artesunate synergistically promotes sorafenib‑induced apoptosis and ferroptosis in non‑Hodgkin lymphoma cells through inhibition of the STAT3 pathway. Oncol Rep. 2023 Jul;50(1):147. doi: 10.3892/or.2023.8584. Click
8 Astaxanthin Augmented the Anti-Hepatocellular Carcinoma Efficacy of Sorafenib Through the Inhibition of the JAK2/STAT3 Signaling Pathway and Mitigation of Hypoxia within the Tumor Microenvironment. Mol Nutr Food Res. 2024 Jan;68(2):e2300569. doi: 10.1002/mnfr.202300569. Click
9 Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. Click
10 Berbamine (BBM), a Natural STAT3 Inhibitor, Synergistically Enhances the Antigrowth and Proapoptotic Effects of Sorafenib on Hepatocellular Carcinoma Cells. ACS Omega. 2020 Sep 18;5(38):24838-24847. doi: 10.1021/acsomega.0c03527. Click
11 Modulation of STAT3 Signaling, Cell Redox Defenses and Cell Cycle Checkpoints by β-Caryophyllene in Cholangiocarcinoma Cells: Possible Mechanisms Accounting for Doxorubicin Chemosensitization and Chemoprevention. Cells. 2020 Apr 2;9(4):858. doi: 10.3390/cells9040858. Click
12 Synergistic Cytotoxicity of β-Elemene and Cisplatin in Gingival Squamous Cell Carcinoma by Inhibition of STAT3 Signaling Pathway. Med Sci Monit. 2017 Mar 29;23:1507-1513. doi: 10.12659/msm.903783. Click
13 Synergistic effect of cryptotanshinone and temozolomide treatment against human glioblastoma cells. Sci Rep. 2023 Dec 9;13(1):21835. doi: 10.1038/s41598-023-48777-z. Click
14 Effects and mechanisms of trifluridine alone or in combination with cryptotanshinone in inhibiting malignant biological behavior of gastric cancer. Cell Cycle. 2023 Jun;22(12):1463-1477. doi: 10.1080/15384101.2023.2215678. Click
15 Sorafenib and CuB exert synergistic antitumor effects against hepatocellular carcinoma cells via inhibition of STAT3 phosphorylation. FEBS Open Bio. 2021 Jan;11(1):133-145. doi: 10.1002/2211-5463.13035. Click
16 Cucurbitacin I inhibits cell migration and invasion and enhances chemosensitivity in colon cancer. Oncol Rep. 2015 Apr;33(4):1867-71. doi: 10.3892/or.2015.3749. Click
17 Curcumin combined with arsenic trioxide in the treatment of acute myeloid leukemia: network pharmacology analysis and experimental validation. J Cancer Res Clin Oncol. 2023 Jan;149(1):219-230. doi: 10.1007/s00432-022-04463-7. Click
18 Curcumin Combined with Thalidomide Reduces Expression of STAT3 and Bcl-xL, Leading to Apoptosis in Acute Myeloid Leukemia Cell Lines. Drug Des Devel Ther. 2020 Jan 15;14:185-194. doi: 10.2147/DDDT.S228610. Click
19 Decursin and Doxorubicin Are in Synergy for the Induction of Apoptosis via STAT3 and/or mTOR Pathways in Human Multiple Myeloma Cells. Evid Based Complement Alternat Med. 2013;2013:506324. doi: 10.1155/2013/506324. Click
20 Dihydroartemisinin enhances the anti-tumor activity of oxaliplatin in colorectal cancer cells by altering PRDX2-reactive oxygen species-mediated multiple signaling pathways. Phytomedicine. 2022 Apr;98:153932. doi: 10.1016/j.phymed.2022.153932. Click
21 Ethoxy-erianin phosphate and afatinib synergistically inhibit liver tumor growth and angiogenesis via regulating VEGF and EGFR signaling pathways. Toxicol Appl Pharmacol. 2022 Mar 1;438:115911. doi: 10.1016/j.taap.2022.115911. Click
22 Falcarindiol Enhances Cisplatin Chemosensitivity of Hepatocellular Carcinoma via Down-Regulating the STAT3-Modulated PTTG1 Pathway. Front Pharmacol. 2021 May 7;12:656697. doi: 10.3389/fphar.2021.656697. Click
23 Gallic acid has anticancer activity and enhances the anticancer effects of cisplatin in non‑small cell lung cancer A549 cells via the JAK/STAT3 signaling pathway. Oncol Rep. 2019 Mar;41(3):1779-1788. doi: 10.3892/or.2019.6976. Click
24 Kaempferol suppresses glioma progression and synergistically enhances the antitumor activity of gefitinib by inhibiting the EGFR/SRC/STAT3 signaling pathway. Drug Dev Res. 2023 May;84(3):592-610. doi: 10.1002/ddr.22048. Click
25 Kurarinone Synergizes TRAIL-Induced Apoptosis in Gastric Cancer Cells. Cell Biochem Biophys. 2015 May;72(1):241-9. doi: 10.1007/s12013-014-0444-0. Click
26 Luteolin enhances erlotinib's cell proliferation inhibitory and apoptotic effects in glioblastoma cell lines. Front Pharmacol. 2022 Sep 19;13:952169. doi: 10.3389/fphar.2022.952169. Click
27 Lycopene improves the efficiency of anti-PD-1 therapy via activating IFN signaling of lung cancer cells. Cancer Cell Int. 2019 Mar 21;19:68. doi: 10.1186/s12935-019-0789-y. Click
28 Combination treatment with flavonoid morin and telomerase inhibitor MST‑312 reduces cancer stem cell traits by targeting STAT3 and telomerase. Int J Oncol. 2016 Aug;49(2):487-98. doi: 10.3892/ijo.2016.3546. Click
29 Morusin enhances the antitumor activity of MAPK pathway inhibitors in BRAF-mutant melanoma by inhibiting the feedback activation of STAT3. Eur J Cancer. 2022 Apr;165:58-70. doi: 10.1016/j.ejca.2022.01.004. Click
30 Narciclasine targets STAT3 via distinct mechanisms in tamoxifen-resistant breast cancer cells. Mol Ther Oncolytics. 2022 Jan 3;24:340-354. doi: 10.1016/j.omto.2021.12.025. Click
31 Nobiletin, a citrus polymethoxyflavone, enhances the effects of bicalutamide on prostate cancer cells via down regulation of NF-κB, STAT3, and ERK activation. RSC Adv. 2020 Mar 10;10(17):10254-10262. doi: 10.1039/c9ra10020b. Click
32 Galangin (GG) combined with cisplatin (DDP) to suppress human lung cancer by inhibition of STAT3-regulated NF-κB and Bcl-2/Bax signaling pathways. Biomed Pharmacother. 2018 Jan;97:213-224. doi: 10.1016/j.biopha.2017.10.059. Click
33 Oxidized tea polyphenol (OTP-3) targets EGFR synergistic nimotuzumab at inhibition of non-small cell lung tumor growth. Bioorg Chem. 2022 Nov;128:106084. doi: 10.1016/j.bioorg.2022.106084. Click
34 Combination of Phenethyl Isothiocyanate and Dasatinib Inhibits Hepatocellular Carcinoma Metastatic Potential through FAK/STAT3/Cadherin Signalling and Reduction of VEGF Secretion. Pharmaceutics. 2023 Sep 27;15(10):2390. doi: 10.3390/pharmaceutics15102390. Click
35 Synergistic inhibitory effects of Celecoxib and Plumbagin on melanoma tumor growth. Cancer Lett. 2017 Jan 28;385:243-250. doi: 10.1016/j.canlet.2016.10.016. Click
36 Osimertinib and pterostilbene in EGFR-mutation-positive non-small cell lung cancer (NSCLC). Int J Biol Sci. 2019 Sep 7;15(12):2607-2614. doi: 10.7150/ijbs.32889. Click
37 Potentiation of Cisplatin Cytotoxicity in Resistant Ovarian Cancer SKOV3/Cisplatin Cells by Quercetin Pre-Treatment. Int J Mol Sci. 2023;24(13):10960. Published 2023 Jun 30. doi:10.3390/ijms241310960 Click
38 Synergistic Effects of Resveratrol and Temozolomide Against Glioblastoma Cells: Underlying Mechanism and Therapeutic Implications. Cancer Manag Res. 2020 Sep 11;12:8341-8354. doi: 10.2147/CMAR.S258584. Click
39 Resveratrol Enhances Temozolomide Efficacy in Glioblastoma Cells through Downregulated MGMT and Negative Regulators-Related STAT3 Inactivation. Int J Mol Sci. 2023 May 29;24(11):9453. doi: 10.3390/ijms24119453. Click
40 5-Fluorouracil Combined with Rutaecarpine Synergistically Suppresses the Growth of Colon Cancer Cells by Inhibiting STAT3. Drug Des Devel Ther. 2023 Mar 30;17:993-1006. doi: 10.2147/DDDT.S402824. Click
41 The Effects and Mechanisms by which Saikosaponin-D Enhances the Sensitivity of Human Non-small Cell Lung Cancer Cells to Gefitinib. J Cancer. 2019 Oct 22;10(26):6666-6672. doi: 10.7150/jca.30361. Click
42 Sanguinarine Induces Apoptosis Pathway in Multiple Myeloma Cell Lines via Inhibition of the JaK2/STAT3 Signaling. Front Oncol. 2019 Apr 17;9:285. doi: 10.3389/fonc.2019.00285. Click
43 Shikonin enhances sensitization of gefitinib against wild-type EGFR non-small cell lung cancer via inhibition PKM2/stat3/cyclinD1 signal pathway. Life Sci. 2018 Jul 1;204:71-77. doi: 10.1016/j.lfs.2018.05.012. Click
44 Shikonin sensitizes A549 cells to TRAIL-induced apoptosis through the JNK, STAT3 and AKT pathways. BMC Cell Biol. 2018 Dec 29;19(1):29. doi: 10.1186/s12860-018-0179-7. Click
45 Combined treatment with sorafenib and silibinin synergistically targets both HCC cells and cancer stem cells by enhanced inhibition of the phosphorylation of STAT3/ERK/AKT. Eur J Pharmacol. 2018 Aug 5;832:39-49. doi: 10.1016/j.ejphar.2018.05.027. Click
46 Synergistic antitumor effects of tanshinone IIA and sorafenib or its derivative SC-1 in hepatocellular carcinoma cells. Onco Targets Ther. 2018 Mar 29;11:1777-1785. doi: 10.2147/OTT.S161534. Click
47 Tanshinone IIA sensitizes TRAIL-induced apoptosis in glioblastoma through inducing the expression of death receptors (and suppressing STAT3 activation). Brain Res. 2021 Sep 1;1766:147515. doi: 10.1016/j.brainres.2021.147515. Click
48 Synergistic effect of toosendanin and regorafenib against cell proliferation and migration by regulating WWOX signaling pathway in hepatocellular carcinoma. Phytother Res. 2021 Aug;35(8):4567-4578. doi: 10.1002/ptr.7174. Click
49 Synergistic effect of ursodeoxycholic acid on the antitumor activity of sorafenib in hepatocellular carcinoma cells via modulation of STAT3 and ERK. Int J Mol Med. 2018 Nov;42(5):2551-2559. doi: 10.3892/ijmm.2018.3807. Click
50 Zerumbone Sensitizes the Anti-Cancer Efficacy of Cisplatin in Hepatocellular Carcinoma Cells. Anticancer Agents Med Chem. 2022 Aug 4;22(16):2885-2895. doi: 10.2174/1871520622666220324090801. Click
51 Zerumbone combined with gefitinib alleviates lung cancer cell growth through the AKT/STAT3/SLC7A11 axis. Neoplasma. 2023 Feb;70(1):58-70. doi: 10.4149/neo_2022_220418N423. Click
52 Cucurbitacin B enhances apoptosis in gefitinib resistant non‑small cell lung cancer by modulating the miR‑17‑5p/STAT3 axis. Mol Med Rep. 2021 Oct;24(4):710. doi: 10.3892/mmr.2021.12349. Click
53 Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol. Cancer Lett. 2013 Jan 28;328(2):285-96. doi: 10.1016/j.canlet.2012.10.003. Click
54 Isocorydine decrease gemcitabine-resistance by inhibiting epithelial-mesenchymal transition via STAT3 in pancreatic cancer cells. Am J Transl Res. 2020 Jul 15;12(7):3702-3714. Click
55 Olean-28,13b-olide 2 plays a role in cisplatin-mediated apoptosis and reverses cisplatin resistance in human lung cancer through multiple signaling pathways. Biochem Pharmacol. 2019;170:113642. doi:10.1016/j.bcp.2019.113642 Click
56 Troxerutin (TXN) potentiated 5-Fluorouracil (5-Fu) treatment of human gastric cancer through suppressing STAT3/NF-κB and Bcl-2 signaling pathways. Biomed Pharmacother. 2017 Aug;92:95-107. doi: 10.1016/j.biopha.2017.04.059. Click
It has been 26231 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP