TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Mitogen-activated protein kinase 8
UniProt ID MK08_HUMAN
Gene Name MAPK8
Gene ID 5599
Synonyms
MAPK8, JNK, JNK-46, JNK1, JNK1A2, JNK21B1/2, PRKM8, SAPK1, SAPK1c
Sequence
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR
Pathway Map MAP LINK
KEGG ID hsa5599
Pfam PF00069; PF01163; PF01636; PF03109; PF04409; PF06293; PF07714; PF13095; PF14531
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 356
Pair Name Withaferin A, Oxaliplatin
Phytochemical Name Withaferin A
Anticancer drug Name Oxaliplatin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result These results support the notion that combination treatment with oxaliplatin and WA could facilitate development of an effective strategy for PC treatment.
Combination Pair ID: 443
Pair Name Paeonol, Epirubicin
Phytochemical Name Paeonol
Anticancer drug Name Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Expression
Result These findings suggest that combination of Paeonol and Epirubicin is potentially applicable for breast cancer treatment.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 969
Pair Name Piperlongumine, HSP90 inhibitors
Phytochemical Piperlongumine
Drug HSP90 inhibitors
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Combination therapy with HSP90 inhibitors and piperlongumine promotes ROS-mediated ER stress in colon cancer cells
Combination Pair ID: 972
Pair Name Berbamine, Cisplatin
Phytochemical Berbamine
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result These findings indicate that Ber might be a promising adjuvant for enhancing the cancer cell killing effect of chemotherapy via the inhibition of autophagy. In this process, Nox2 might be a significant mediator of Ber-induced aberrant lysosomal acidification.
Combination Pair ID: 32
Pair Name (S)-10-Hydroxycamptothecin, Crizotinib
Phytochemical (S)-10-Hydroxycamptothecin
Drug Crizotinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells
Combination Pair ID: 47
Pair Name Dihydroberberine, Sunitinib
Phytochemical Dihydroberberine
Drug Sunitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result DCS induced the expression of cell cycle signal molecules that are known to be affected by JNK and p38. The change of cell cycle, in turn, led to down-regulation of JNK and p38, and further reduced IL-1 secretion. Collectively, these findings highlight potential molecular mechanisms of DCS chemotherapeutic activity and suggest that DCS is an efficacious strategy in NSCLC therapy.
Combination Pair ID: 52
Pair Name Sanguinarium, Cisplatin
Phytochemical Sanguinarium
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Our findings demonstrate that SNG induces mitochondrial and caspase-dependent apoptosis, generates oxidative stress, and suppresses MM cell lines proliferation. In addition, co-treatment of MM cell lines with sub-toxic doses of SNG and BTZ potentiated the cytotoxic activity. These results would suggest that SNG could be developed into therapeutic agent either alone or in combination with other anticancer drugs in MM.
Combination Pair ID: 83
Pair Name Isoliquiritigenin, Docosahexaenoic acid
Phytochemical Isoliquiritigenin
Drug Docosahexaenoic acid
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Excessive ROS-induced JNK activation and cytochrome c release from mitochondria played a key role in the synergistic anticancer activity of CRC cells by cotreating with DHA and ISL.
Combination Pair ID: 645
Pair Name Tangeretin, Fluorouracil
Phytochemical Tangeretin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result To our knowledge gained from literature, this study is the first to describe synergistic activity of TAN and 5-FU against colorectal cancer cells.
Combination Pair ID: 89
Pair Name Daidzein, Gefitinib
Phytochemical Daidzein
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Activity
Result Daidzein Synergizes with Gefitinib to Induce ROS/JNK/c-Jun Activation and Inhibit EGFR-STAT/AKT/ERK Pathways to enhance Lung Adenocarcinoma cells chemosensitivity
Combination Pair ID: 96
Pair Name Licochalcone A, Sorafenib
Phytochemical Licochalcone A
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Expression
Result These findings first revealed the synergistic effects of LicA and Sor cotreatment against human HCC cells, further suggesting that beneficial effects on tumor regression could be confirmed through prospective clinical trials.
Combination Pair ID: 107
Pair Name Liquiritin, TNF-related apoptosis inducing ligand
Phytochemical Liquiritin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation
Combination Pair ID: 119
Pair Name Morin Hydrate, Cisplatin
Phytochemical Morin Hydrate
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Our findings indicate that CP-Mh in combination served as a prominent regulator of autophagy and significant inducer of apoptosis that maintains a homeostatic balance towards HepG2 cells and the subcutaneous tumor model.
Combination Pair ID: 129
Pair Name Licochalcone B, TNF-related apoptosis inducing ligand
Phytochemical Licochalcone B
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC.
Combination Pair ID: 166
Pair Name Dihydroartemisinin, Oxaliplatin
Phytochemical Dihydroartemisinin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Expression
Result We demonstrated an improved therapeutic strategy for CRC patients by combining DHA and oxaliplatin treatments.
Combination Pair ID: 168
Pair Name Resveratrol, Temozolomide
Phytochemical Resveratrol
Drug Temozolomide
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Activity
Result TMZ in combination with resveratrol remarkably increased reactive oxygen species (ROS) production, which serves as an upstream signal for AMP-activated protein kinase (AMPK) activation. Subsequently, activated AMPK inhibited mTOR signaling and downregulated antiapoptosis protein Bcl-2, which was contributed to the additive antiproliferation effects of combination treatment. In an orthotopic xenograft model of GBM, TMZ plus resveratrol treatment significantly reduced the volume of tumor, which was confirmed by decreased expression of Ki-67, a marker of proliferation index
Combination Pair ID: 674
Pair Name Artesunate, Cisplatin
Phytochemical Artesunate
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result ART exhibited significant anti-tumor effect on A549 cells and this efficiency could be enhanced by combination with CIS
Combination Pair ID: 181
Pair Name Oridonin, Fluorouracil
Phytochemical Oridonin
Drug Fluorouracil
Disease Info [ICD-11: 2C90.Z] Renal carcinoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Activity
Result Oridonin enhances the cytotoxicity of 5-FU in renal cancer cells partially through inducing necroptosis, providing evidence of using necroptosis inducers in combination with chemotherapeutic agents for cancer treatment.
Combination Pair ID: 184
Pair Name Oridonin, Cetuximab
Phytochemical Oridonin
Drug Cetuximab
Disease Info [ICD-11: 2C23.Z] Laryngeal cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Expression
Result Combined oridonin with cetuximab treatment shows synergistic anticancer effects on laryngeal squamous cell carcinoma: Involvement of inhibition of EGFR and activation of reactive oxygen species-mediated JNK pathway
Combination Pair ID: 686
Pair Name Ginsenoside Rg3, Endostar
Phytochemical Ginsenoside Rg3
Drug Endostar
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Expression
Result Endostar combined with ginsenoside Rg3 has stronger inhibiting effect on breast cancer tumor growth in tumor-bearing mice than single drug, and it can inhibit angiogenesis and cell invasion, and enhance cell autophagy.
Combination Pair ID: 231
Pair Name Costunolide, Doxorubicin
Phytochemical Costunolide
Drug Doxorubicin
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result We suggested that costunolide in combination with doxorubicin was a new potential chemotherapeutic strategy for treating prostate cancer.
Combination Pair ID: 239
Pair Name Alantolactone, Oxaliplatin
Phytochemical Alantolactone
Drug Oxaliplatin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result These results suggest that the combination treatment with ALT and oxaliplatin may become a potential therapeutic strategy for colon cancer.
Combination Pair ID: 716
Pair Name Nimbolide, Tumor necrosis factor-alpha
Phytochemical Nimbolide
Drug Tumor necrosis factor-alpha
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Our findings overall indicate that nimbolide may enhance TNF-α-mediated cellular proliferation inhibition through increasing cell apoptosis of HT-29 cells by up-reglation of DR5 expression via the JNK pathway.
Combination Pair ID: 254
Pair Name Alpha-Hederin, Carboplatin
Phytochemical Alpha-Hederin
Drug Carboplatin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Chemopreventive effect of α-hederin/carboplatin combination against experimental colon hyperplasia and impact on JNK signaling
Combination Pair ID: 276
Pair Name Isodeoxyelephantopin, Cisplatin
Phytochemical Isodeoxyelephantopin
Drug Cisplatin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Activity
Result Our study provide a preclinical proof-of-concept for ESI as a potential strategy for colon cancer treatment.
Combination Pair ID: 724
Pair Name Shikonin, TNF-related apoptosis inducing ligand
Phytochemical Shikonin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result The results indicated that shikonin sensitized resistant cancer cells to TRAIL-induced cytotoxicity via the modulation of the JNK, STAT3 and AKT pathways, the downregulation of antiapoptotic proteins and the upregulation of proapoptotic proteins.
Combination Pair ID: 1037
Pair Name Shikonin, BEZ235
Phytochemical Shikonin
Drug BEZ235
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result We found that low doses shikonin and dual PI3K-mTOR inhibitor (BEZ235) have a synergistic effect that inhibits the spheroid formation from chemoresistant lung cancer sublines. Inhibiting the proliferation of lung cancer stem cells is believed to reduce the recurrence of lung cancer; therefore, shikonin's anti-drug resistance and anti-cancer stem cell activities make it a highly interesting molecule for future combined lung cancer therapy.
Combination Pair ID: 301
Pair Name Plumbagin, Cisplatin
Phytochemical Plumbagin
Drug Cisplatin
Disease Info [ICD-11: 2B62.0] Tongue squamous cell carcinoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Activity
Result PLB combined with cisplatin is a potential therapeutic strategy against therapy TSCC cisplatin resistance.
Combination Pair ID: 334
Pair Name Chicoric acid, TNF-related apoptosis inducing ligand
Phytochemical Chicoric acid
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Activity
Result Our results suggest that TO plays an important role in TRAIL-induced apoptosis, and further functional studies are warranted to confirm the importance of TO as a novel TRAIL sensitizer for cancer therapy.
Combination Pair ID: 788
Pair Name Bufalin, TNF-related apoptosis inducing ligand
Phytochemical Bufalin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Expression
Result Bufalin enhanced TRAIL-induced apoptosis by up-regulating the expression of DR4 and DR5. Bufalin-induced down-regulation of Cbl-b contributed to the up-regulation of DR4 and DR5, which might be partially mediated by the activation of ERK, JNK and p38 MAPK.
Combination Pair ID: 371
Pair Name Epsilon-Viniferin, alpha-Viniferin
Phytochemical Epsilon-Viniferin
Drug alpha-Viniferin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result ε-viniferin and α-viniferin may prove to be new approaches and effective therapeutic agents for osteosarcoma and lung cancer treatment.
Combination Pair ID: 813
Pair Name Resveratrol, Cisplatin
Phytochemical Resveratrol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Resveratrol Enhances Cytotoxic Effects of Cisplatin by Inducing Cell Cycle Arrest and Apoptosis in Ovarian Adenocarcinoma SKOV-3 Cells through Activating the p38 MAPK and Suppressing AKT
Combination Pair ID: 407
Pair Name Luteolin, TNF-related apoptosis inducing ligand
Phytochemical Luteolin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result TRAIL combined with luteolin could be as an effective chemotherapeutic strategy for NSCLC.
Combination Pair ID: 409
Pair Name Luteolin, Paclitaxel
Phytochemical Luteolin
Drug Paclitaxel
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result The molecular mechanism of inhibiting cell migration and EMT processes may be related to the inhibition of SIRT1, and the mechanism of apoptosis induction is associated with the reactive oxygen species (ROS)/c-Jun N-terminal kinase (JNK) pathway-mediated activation of mitochondrial apoptotic pathway.
Combination Pair ID: 846
Pair Name Luteolin, Sorafenib
Phytochemical Luteolin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Sorafenib and luteolin combination synergistically kills HCC cells through JNK-mediated apoptosis, and luteolin may be an ideal candidate for increasing the activity of sorafenib in HCC therapy.
Combination Pair ID: 426
Pair Name Acteoside, Temozolomide
Phytochemical Acteoside
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result It was also determined that TMZ + acteoside induced apoptosis and autophagy through the mitogen‑activated protein kinase signaling pathway. These findings suggest that acteoside has beneficial effects on TMZ‑based glioblastoma therapy.
Combination Pair ID: 479
Pair Name Bakuchiol, TNF-related apoptosis inducing ligand
Phytochemical Bakuchiol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result The collective results suggest that bakuchiol facilitates TRAIL-induced apoptosis in colon cancer cells through up-regulation of the TRAIL receptors; DR4 and DR5 via ROS/JNK pathway signals.
Combination Pair ID: 491
Pair Name Wogonin, Cisplatin
Phytochemical Wogonin
Drug Cisplatin
Disease Info Head and neck cancer
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Wogonin induced selective cell death by targeting the antioxidant defense mechanisms enhanced in the resistant HNC cells and activating cell death pathways involving PUMA and PARP. Hence, wogonin significantly sensitized resistant HNC cells to cisplatin both in vitro and in vivo. Wogonin is a promising anticancer candidate that induces ROS accumulation and selective cytotoxicity in HNC cells and can help to overcome cisplatin-resistance in this cancer.
Combination Pair ID: 879
Pair Name Gambogic Acid, Cisplatin
Phytochemical Gambogic Acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Gambogic acid sensitises lung cancer cells to CDDP in vitro and in vivo in NSCLC through inactivation of NF-κB and MAPK/HO-1 signalling pathways, providing a rationale for the combined use of CDDP and GA in lung cancer chemotherapy.
Combination Pair ID: 495
Pair Name Chebulagic acid, Doxorubicin
Phytochemical Chebulagic acid
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Activity
Result The present study shows the efficacy of CA to overcome MDR-1 mediated drug resistance in HepG2 cells through COX-2 dependant modulation of MDR-1.
Combination Pair ID: 497
Pair Name Medicarpin, TNF-related apoptosis inducing ligand
Phytochemical Medicarpin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B33.1] Myeloid leukemia Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway
Combination Pair ID: 499
Pair Name Bisdemethoxycucurmin, Icotinib
Phytochemical Bisdemethoxycucurmin
Drug Icotinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.
Combination Pair ID: 909
Pair Name Glaucocalyxin B, Cisplatin
Phytochemical Glaucocalyxin B
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result GLB enhances the sensitivity of ovarian cancer cells to cisplatin via increasing reactive oxygen species (ROS) levels, the phosphorylation of c-Jun N-terminal kinase (JNK), and DNA damage. A synergistic inhibitory effect of GLB with cisplatin was also observed in the cells which were resistance to cisplatin. These data suggest that GLB can sensitize ovarian cancer cells to cisplatin by increasing ROS levels.
Combination Pair ID: 582
Pair Name Eriocalyxin B, Gemcitabine
Phytochemical Eriocalyxin B
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Gem and EriB (or Isodon extract) taken together in combination regulated PDK1/AKT1/caspase and JNK signaling and promoted apoptosis synergistically, which may contribute to the much increased anti-proliferative activity compared to either agent alone.
Combination Pair ID: 590
Pair Name Delta-Tocotrienol, Cisplatin
Phytochemical Delta-Tocotrienol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis
Combination Pair ID: 602
Pair Name Berberine, Cisplatin
Phytochemical Berberine
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway
Combination Pair ID: 946
Pair Name Guggulsterone, Gemcitabine
Phytochemical Guggulsterone
Drug Gemcitabine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result The combination of guggulsterone to gemcitabine enhanced antitumor efficacy through apoptosis induction by suppressing Akt and nuclear factor KappaB activity and by modulating apoptosis-related protein expression in pancreatic cancer
Combination Pair ID: 419
Pair Name Piperlongumine, Oxaliplatin
Phytochemical Piperlongumine
Drug Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Piperlongumine significantly enhanced oxaliplatin-induced growth inhibition of these cells and that TrxR1 activity is involved in their synergistic effect both in vitro and in vivo. These data suggest that PL and oxaliplatin combination treatment of gastric cancer may be more effective than oxaliplatin alone.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 15
Pair Name Cepharanthine, Cisplatin
Phytochemical Cepharanthine
Drug Cisplatin
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals
Combination Pair ID: 259
Pair Name Sclareol, Cisplatin
Phytochemical Sclareol
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 8 Expression
Result Sclareol has potential as an adjuvant for the treatment in NSCLC patients with cisplatin resistance.
Combination Pair ID: 316
Pair Name Honokiol, Paclitaxel
Phytochemical Honokiol
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction
Combination Pair ID: 770
Pair Name Mitocurcumin, Cytarabine
Phytochemical Mitocurcumin
Drug Cytarabine
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis.
Combination Pair ID: 871
Pair Name Shogaol, TNF-related apoptosis inducing ligand
Phytochemical Shogaol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 8 Phosphorylation
Result This study gives rise to the possibility of applying shogaol as an antitumor agent that can be used for the purpose of combination treatment with TRAIL in TRAIL-resistant colon tumor therapy.
03. Reference
No. Title Href
1 Synergistic antitumor activity of withaferin A combined with oxaliplatin triggers reactive oxygen species-mediated inactivation of the PI3K/AKT pathway in human pancreatic cancer cells. Cancer Lett. 2015 Feb 1;357(1):219-230. doi: 10.1016/j.canlet.2014.11.026. Click
2 Enhanced antitumor activity and attenuated cardiotoxicity of Epirubicin combined with Paeonol against breast cancer. Tumour Biol. 2016 Sep;37(9):12301-12313. doi: 10.1007/s13277-016-5088-9. Click
3 Combination therapy with HSP90 inhibitors and piperlongumine promotes ROS-mediated ER stress in colon cancer cells. Cell Death Discov. 2023 Oct 13;9(1):375. doi: 10.1038/s41420-023-01672-y. Click
4 Berbamine Hydrochloride inhibits lysosomal acidification by activating Nox2 to potentiate chemotherapy-induced apoptosis via the ROS-MAPK pathway in human lung carcinoma cells. Cell Biol Toxicol. 2023 Aug;39(4):1297-1317. doi: 10.1007/s10565-022-09756-8. Click
5 Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells. J Enzyme Inhib Med Chem. 2023 Dec;38(1):1-11. doi: 10.1080/14756366.2022.2132487. Click
6 Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178. Click
7 Sanguinarine promotes ovarian cancer chemosensitivity to cisplatin by blocking the EGFR/erbB2 signaling pathway. Acta Medica Mediterranea. 2022 Oct 20;39:481-486. doi: 10.19193/0393-6384_2023_2_68. Click
8 Synergistic anticancer effect of docosahexaenoic acid and isoliquiritigenin on human colorectal cancer cells through ROS-mediated regulation of the JNK and cytochrome c release. Mol Biol Rep. 2021 Feb;48(2):1171-1180. doi: 10.1007/s11033-021-06159-6. Click
9 Synergistic therapy with tangeretin and 5-fluorouracil accelerates the ROS/JNK mediated apoptotic pathway in human colorectal cancer cell. Food Chem Toxicol. 2020 Sep;143:111529. doi: 10.1016/j.fct.2020.111529. Click
10 Daidzein Synergizes with Gefitinib to Induce ROS/JNK/c-Jun Activation and Inhibit EGFR-STAT/AKT/ERK Pathways to enhance Lung Adenocarcinoma cells chemosensitivity. Int J Biol Sci. 2022 May 16;18(9):3636-3652. doi: 10.7150/ijbs.71870. Click
11 Synergistic antimetastatic effect of cotreatment with licochalcone A and sorafenib on human hepatocellular carcinoma cells through the inactivation of MKK4/JNK and uPA expression. Environ Toxicol. 2018 Dec;33(12):1237-1244. doi: 10.1002/tox.22630. Click
12 Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation. Biomed Pharmacother. 2017 Sep;93:948-960. doi: 10.1016/j.biopha.2017.06.095. Click
13 Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253. Click
14 Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. Click
15 Dihydroartemisinin enhances the anti-tumor activity of oxaliplatin in colorectal cancer cells by altering PRDX2-reactive oxygen species-mediated multiple signaling pathways. Phytomedicine. 2022 Apr;98:153932. doi: 10.1016/j.phymed.2022.153932. Click
16 Resveratrol enhances the antitumor effects of temozolomide in glioblastoma via ROS-dependent AMPK-TSC-mTOR signaling pathway. CNS Neurosci Ther. 2012;18(7):536-546. doi:10.1111/j.1755-5949.2012.00319.x Click
17 Artesunate exhibits synergistic anti-cancer effects with cisplatin on lung cancer A549 cells by inhibiting MAPK pathway. Gene. 2021 Jan 15;766:145134. doi: 10.1016/j.gene.2020.145134. Click
18 Oridonin enhances the cytotoxicity of 5-FU in renal carcinoma cells by inducting necroptotic death. Biomed Pharmacother. 2018 Oct;106:175-182. doi: 10.1016/j.biopha.2018.06.111. Click
19 Combined oridonin with cetuximab treatment shows synergistic anticancer effects on laryngeal squamous cell carcinoma: involvement of inhibition of EGFR and activation of reactive oxygen species-mediated JNK pathway. Int J Oncol. 2016 Nov;49(5):2075-2087. doi: 10.3892/ijo.2016.3696. Click
20 Inhibiting effect of Endostar combined with ginsenoside Rg3 on breast cancer tumor growth in tumor-bearing mice. Asian Pac J Trop Med. 2016 Feb;9(2):180-3. doi: 10.1016/j.apjtm.2016.01.010. Click
21 Costunolide enhances doxorubicin-induced apoptosis in prostate cancer cells via activated mitogen-activated protein kinases and generation of reactive oxygen species. Oncotarget. 2017 Nov 21;8(64):107701-107715. doi: 10.18632/oncotarget.22592. Click
22 Enhancement of oxaliplatin-induced colon cancer cell apoptosis by alantolactone, a natural product inducer of ROS. Int J Biol Sci. 2019 Jun 4;15(8):1676-1684. doi: 10.7150/ijbs.35265. Click
23 Combination of Nimbolide and TNF-α-Increases Human Colon Adenocarcinoma Cell Death through JNK-mediated DR5 Up- regulation. Asian Pac J Cancer Prev. 2016;17(5):2637-41. Click
24 Chemopreventive effect of α-hederin/carboplatin combination against experimental colon hyperplasia and impact on JNK signaling. Toxicol Mech Methods. 2021 Feb;31(2):138-149. doi: 10.1080/15376516.2020.1849483. Click
25 Isodeoxyelephantopin Inactivates Thioredoxin Reductase 1 and Activates ROS-Mediated JNK Signaling Pathway to Exacerbate Cisplatin Effectiveness in Human Colon Cancer Cells. Front Cell Dev Biol. 2020 Sep 22;8:580517. doi: 10.3389/fcell.2020.580517. Click
26 Shikonin sensitizes A549 cells to TRAIL-induced apoptosis through the JNK, STAT3 and AKT pathways. BMC Cell Biol. 2018 Dec 29;19(1):29. doi: 10.1186/s12860-018-0179-7. Click
27 Attenuation of PI3K-Akt-mTOR Pathway to Reduce Cancer Stemness on Chemoresistant Lung Cancer Cells by Shikonin and Synergy with BEZ235 Inhibitor. Int J Mol Sci. 2024 Jan 3;25(1):616. doi: 10.3390/ijms25010616. Click
28 Plumbagin Enhances the Anticancer Efficacy of Cisplatin by Increasing Intracellular ROS in Human Tongue Squamous Cell Carcinoma. Oxid Med Cell Longev. 2020 Mar 25;2020:5649174. doi: 10.1155/2020/5649174. Click
29 Novel TRAIL sensitizer Taraxacum officinale F.H. Wigg enhances TRAIL-induced apoptosis in Huh7 cells. Mol Carcinog. 2016;55(4):387-396. doi:10.1002/mc.22288 Click
30 Down-regulation of Cbl-b by bufalin results in up-regulation of DR4/DR5 and sensitization of TRAIL-induced apoptosis in breast cancer cells. J Cancer Res Clin Oncol. 2012 Aug;138(8):1279-89. doi: 10.1007/s00432-012-1204-4. Click
31 ε-Viniferin and α-viniferin alone or in combination induced apoptosis and necrosis in osteosarcoma and non-small cell lung cancer cells. Food Chem Toxicol. 2021;158:112617. doi:10.1016/j.fct.2021.112617. Click
32 Resveratrol Enhances Cytotoxic Effects of Cisplatin by Inducing Cell Cycle Arrest and Apoptosis in Ovarian Adenocarcinoma SKOV-3 Cells through Activating the p38 MAPK and Suppressing AKT. Pharmaceuticals (Basel). 2023 May 17;16(5):755. doi: 10.3390/ph16050755. Click
33 Luteolin enhances TRAIL sensitivity in non-small cell lung cancer cells through increasing DR5 expression and Drp1-mediated mitochondrial fission. Arch Biochem Biophys. 2020 Oct 15;692:108539. doi: 10.1016/j.abb.2020.108539. Click
34 Luteolin combined with low-dose paclitaxel synergistically inhibits epithelial-mesenchymal transition and induces cell apoptosis on esophageal carcinoma in vitro and in vivo. Phytother Res. 2021 Nov;35(11):6228-6240. doi: 10.1002/ptr.7267. Click
35 Luteolin and sorafenib combination kills human hepatocellular carcinoma cells through apoptosis potentiation and JNK activation. Oncol Lett. 2018 Jul;16(1):648-653. doi: 10.3892/ol.2018.8640. Click
36 Synergistic anticancer effect of acteoside and temozolomide-based glioblastoma chemotherapy. Int J Mol Med. 2019 Mar;43(3):1478-1486. doi: 10.3892/ijmm.2019.4061. Click
37 Bakuchiol sensitizes cancer cells to TRAIL through ROS- and JNK-mediated upregulation of death receptors and downregulation of survival proteins. Biochem Biophys Res Commun. 2016 Apr 29;473(2):586-92. doi: 10.1016/j.bbrc.2016.03.127. Click
38 Targeting Nrf2 with wogonin overcomes cisplatin resistance in head and neck cancer. Apoptosis. 2016;21(11):1265-1278. doi:10.1007/s10495-016-1284-8 Click
39 Gambogic acid synergistically potentiates cisplatin-induced apoptosis in non-small-cell lung cancer through suppressing NF-κB and MAPK/HO-1 signalling. Br J Cancer. 2014 Jan 21;110(2):341-52. doi: 10.1038/bjc.2013.752. Click
40 Chebulagic acid synergizes the cytotoxicity of doxorubicin in human hepatocellular carcinoma through COX-2 dependant modulation of MDR-1. Med Chem. 2011 Sep;7(5):432-42. doi: 10.2174/157340611796799087. Click
41 Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. Click
42 Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib. Click
43 Glaucocalyxin B Attenuates Ovarian Cancer Cell Growth and Cisplatin Resistance In Vitro via Activating Oxidative Stress. Oxid Med Cell Longev. 2022;2022:6324292. Published 2022 Feb 25. doi:10.1155/2022/6324292 Click
44 Isodon eriocalyx and its bioactive component Eriocalyxin B enhance cytotoxic and apoptotic effects of gemcitabine in pancreatic cancer. Phytomedicine. 2018 May 15;44:56-64. doi: 10.1016/j.phymed.2018.03.055. Click
45 δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis. Cell Prolif. 2021 Nov;54(11):e13111. doi: 10.1111/cpr.13111. Click
46 Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway. Molecules. 2021 Mar 17;26(6):1666. doi: 10.3390/molecules26061666. Click
47 Enhanced antitumor effect of combination therapy with gemcitabine and guggulsterone in pancreatic cancer. Pancreas. 2012 Oct;41(7):1048-57. doi: 10.1097/MPA.0b013e318249d62e. Click
48 Piperlongumine potentiates the antitumor efficacy of oxaliplatin through ROS induction in gastric cancer cells. Cell Oncol (Dordr). 2019;42(6):847-860. doi:10.1007/s13402-019-00471-x Click
49 Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals. Oncotarget. 2017 Nov 27;8(67):111144-111160. doi: 10.18632/oncotarget.22676. Click
50 Sclareol ameliorated ERCC1-mediated cisplatin resistance in A549 human lung adenocarcinoma cells and a murine xenograft tumor model by suppressing AKT-GSK3β-AP1/Snail and JNK-AP1 pathways. Chem Biol Interact. 2020 Dec 1;332:109304. doi: 10.1016/j.cbi.2020.109304. Click
51 Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction. Cell Oncol (Dordr). 2021 Feb;44(1):135-150. doi: 10.1007/s13402-020-00557-x. Click
52 Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004 Click
53 Shogaol overcomes TRAIL resistance in colon cancer cells via inhibiting of survivin. Tumour Biol. 2015 Nov;36(11):8819-29. doi: 10.1007/s13277-015-3629-2. Click
It has been 589654 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP