TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
UniProt ID PK3CA_HUMAN
Gene Name PIK3CA
Gene ID 5290
Synonyms
PIK3CA, CCM4, CLAPO, CLOVE, CWS5, MCAP, MCM, MCMTC, PI3K, PI3K-alpha, p110-alpha
Sequence
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Pathway Map MAP LINK
KEGG ID hsa5290
TTD ID T80276
Pfam PF00312; PF00454; PF00613; PF00792; PF00794; PF02192; PF03109; PF10083
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 90
Pair Name Kuromanin chloride, Cisplatin
Phytochemical Name Kuromanin chloride
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells
Combination Pair ID: 140
Pair Name Silibinin, Regorafenib
Phytochemical Name Silibinin
Anticancer drug Name Regorafenib
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result The present study suggests that silybin in combination with regorafenib is a promising strategy for treatment of metastatic colorectal patients.
Combination Pair ID: 261
Pair Name Ilexgenin A, Sorafenib
Phytochemical Name Ilexgenin A
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result The results described in the present study identifies Ilexgenin A as a promising therapeutic candidate that modulates inflammation, angiogenesis, and HCC growth.
Combination Pair ID: 366
Pair Name Polydatin, 2-Deoxy-d-glucose
Phytochemical Name Polydatin
Anticancer drug Name 2-Deoxy-d-glucose
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result Our study demonstrates that PD synergised with 2-DG to enhance its anti-cancer efficacy by inhibiting the ROS/PI3K/AKT/HIF-1α/HK2 signalling axis, providing a potential anti-cancer strategy.
Combination Pair ID: 385
Pair Name Curcumin, Quinacrine
Phytochemical Name Curcumin
Anticancer drug Name Quinacrine
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result Quinacrine and Curcumin in combination decreased the breast cancer angiogenesis by modulating ABCG2 via VEGF A
Combination Pair ID: 453
Pair Name Mangiferin, Cisplatin
Phytochemical Name Mangiferin
Anticancer drug Name Cisplatin
Disease Info Nephrotoxicity Investigative
Regulate Info Up-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result The study reveals a mechanistic basis of mangiferin action against cisplatin induced nephrotoxicity. Since Mangiferin shows synergistic anticancer activity with cisplatin, it can be considered as a promising drug candidate, to be used in combination with cisplatin.
Combination Pair ID: 505
Pair Name Magnoflorine, Doxorubicin
Phytochemical Name Magnoflorine
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result Magnoflorine improves sensitivity to doxorubicin (DOX) of breast cancer cells via inducing apoptosis and autophagy through AKT/mTOR and p38 signaling pathways
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 48
Pair Name Jervine, Decitabine
Phytochemical Jervine
Drug Decitabine
Disease Info [ICD-11: 2A3Z] Myelodysplastic syndrome Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result The Smo inhibitor jervine and its combination with decitabine have a synergistic effect on the proliferation, cell cycle, and apoptosis of MUTZ-1 cells, and its mechanism may be achieved by interfering with the Shh signaling pathway.
Combination Pair ID: 65
Pair Name Kaempferol, Fluorouracil
Phytochemical Kaempferol
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Activity
Result The present study demonstrated that kaempferol has a synergistic effect with 5‑FU by inhibiting cell proliferation and inducing apoptosis in colorectal cancer cells via suppression of TS or attenuation of p‑Akt activation. The combination of kaempferol and 5‑FU may be used as an effective therapeutic strategy for colorectal cancer.
Combination Pair ID: 66
Pair Name Kaempferol, Erlotinib
Phytochemical Kaempferol
Drug Erlotinib
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result These data imply that KAE may be a valid therapeutic candidate to potentiate PC cell sensitivity to ERL via inhibiting PI3K/AKT and EGFR signaling.
Combination Pair ID: 73
Pair Name Fisetin, Fluorouracil
Phytochemical Fisetin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer
Combination Pair ID: 634
Pair Name Fisetin, Sorafenib
Phytochemical Fisetin
Drug Sorafenib
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result Fisetin potentiates sorafenib-induced apoptosis and abrogates tumor growth in athymic nude mice implanted with BRAF-mutated melanoma cells.
Combination Pair ID: 76
Pair Name Apigenin, Doxorubicin
Phytochemical Apigenin
Drug Doxorubicin
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells
Combination Pair ID: 991
Pair Name Nobiletin, Vorinostat
Phytochemical Nobiletin
Drug Vorinostat
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result The combination of nobiletin with vorinostat increased histone H3K9 and H3K27 acetylation levels in SCLC mouse tumor tissue and enhanced the expression of the BH3-only proteins BIM and BID. We conclude that nobiletin is a novel natural BH3 mimetic that can cooperate with vorinostat to induce apoptosis and autophagy in SCLC.
Combination Pair ID: 101
Pair Name Liquiritigenin, Cisplatin
Phytochemical Liquiritigenin
Drug Cisplatin
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result The results suggested that LQ plays an intensive role on CDDP suppressing invasion and metastasis through regulating the PI3 K/AKT signal pathway and suppressing the protein expression of MMP-2/9.
Combination Pair ID: 152
Pair Name 4'-Hydroxywogonin, Wortmannin
Phytochemical 4'-Hydroxywogonin
Drug Wortmannin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result 4'-HW decreased the viability and reduced angiogenesis in CRC, which was associated with downregulation of VEGF-A expression by disrupting the PI3K/AKT pathway. Our discoveries suggested 4'-HW as a promising anticancer agent against CRC targeting angiogenesis.
Combination Pair ID: 190
Pair Name Ursolic acid, Epirubicin
Phytochemical Ursolic acid
Drug Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result These findings indicate that UA can dramatically enhance the sensitivity of MCF-7 and MDA-MB-231 cells to EPI by modulating the autophagy pathway. Our study may provide a new therapeutic strategy for combination therapy.
Combination Pair ID: 199
Pair Name Tanshinone IIA, Cisplatin
Phytochemical Tanshinone IIA
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result The combination of Tan IIA and cisplatin exhibited the most significant difference. Tanshinone IIA may function as a novel option for combination therapy for non-small-cell lung cancer treatment.
Combination Pair ID: 203
Pair Name Ginsenoside Rg3, Sorafenib
Phytochemical Ginsenoside Rg3
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result Rg3 has a synergistic effect on the sensitivity of HepG2 and Bel7404 hepatoma cells to SFN, which is related to HK2-mediated glycolysis and the PI3K/Akt signaling pathway.
Combination Pair ID: 686
Pair Name Ginsenoside Rg3, Endostar
Phytochemical Ginsenoside Rg3
Drug Endostar
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result Endostar combined with ginsenoside Rg3 has stronger inhibiting effect on breast cancer tumor growth in tumor-bearing mice than single drug, and it can inhibit angiogenesis and cell invasion, and enhance cell autophagy.
Combination Pair ID: 210
Pair Name Rhizoma Paridis saponins, Sorafenib
Phytochemical Rhizoma Paridis saponins
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result All of that provided possibility to overcome the intolerance of sorafenib by drug compatibility through protection against mitochondria damage, inhibition of anaerobic glycolysis and suppression of lipid synthesis based on PI3K/Akt/mTOR pathway.
Combination Pair ID: 706
Pair Name Costunolide, Doxorubicin
Phytochemical Costunolide
Drug Doxorubicin
Disease Info [ICD-11: 2B33.3] Acute lymphoblastic leukemia Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result These results demonstrate that costunolide may be a potent therapeutic agent against chronic myeloid leukemia.
Combination Pair ID: 236
Pair Name Beta-Elemene, Fluorouracil
Phytochemical Beta-Elemene
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result The conclusion obtained, considering that the results suggest that the combination may be important specifically in the treatment of TNBC.
Combination Pair ID: 236
Pair Name Beta-Elemene, Fluorouracil
Phytochemical Beta-Elemene
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result The conclusion obtained, considering that the results suggest that the combination may be important specifically in the treatment of TNBC.
Combination Pair ID: 249
Pair Name Tubeimoside I, Temozolomide
Phytochemical Tubeimoside I
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result We first demonstrated that synergistic effects of TBMS1 and TMZ induced apoptosis in GBM cells through reducing MGMT expression and inhibiting the EGFR induced PI3K/Akt/mTOR/NF-κB signaling pathway. This study provides a rationale for combined application of TMZ and TBMS1 as a potential chemotherapeutic treatment for MGMT+ GBM patients.
Combination Pair ID: 254
Pair Name Alpha-Hederin, Carboplatin
Phytochemical Alpha-Hederin
Drug Carboplatin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result Chemopreventive effect of α-hederin/carboplatin combination against experimental colon hyperplasia and impact on JNK signaling
Combination Pair ID: 284
Pair Name Shikonin, 4-hydroxytamoxifen
Phytochemical Shikonin
Drug 4-hydroxytamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result The combination of SK and 4-OHT shows highly efficient anticancer effects on breast cancer therapy. SK may be a promising candidate as an adjuvant to 4-OHT for breast cancer treatments, especially for ER- breast cancer.
Combination Pair ID: 287
Pair Name Shikonin, Doxorubicin
Phytochemical Shikonin
Drug Doxorubicin
Disease Info [ICD-11: 2B33.5] Lymphoma Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result These data suggest that shikonin may be an encouraging chemotherapeutic agent in the clinical treatment of BL.
Combination Pair ID: 295
Pair Name Tanshinone IIA, Imatinib
Phytochemical Tanshinone IIA
Drug Imatinib
Disease Info [ICD-11: 2A20.1] Chronic myelogenous leukemia Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result The results revealed that Tan IIA enhanced the inhibitory effect of imatinib on TIB‑152 cell proliferation, migration and invasion, and induced apoptosis, which may be associated with inhibition of the PI3K/AKT/mTOR signaling pathway.
Combination Pair ID: 298
Pair Name Rhein, Oxaliplatin
Phytochemical Rhein
Drug Oxaliplatin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result These data demonstrate that Rhein can induce apoptosis and enhance the oxaliplatin sensitivity of PC cells, suggesting that Rhein may be an effective strategy to overcome drug resistance in the chemotherapeutic treatment of PC.
Combination Pair ID: 300
Pair Name Rhein, Pemetrexed
Phytochemical Rhein
Drug Pemetrexed
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result Our findings demonstrated that the potential application of rhein as a candidate drug in combination with PTX is promising for treatment of the human lung cancer.
Combination Pair ID: 303
Pair Name Aloe emodin, Gefitinib
Phytochemical Aloe emodin
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result AE could enhance the gefitinib sensitivity of PC9-GR cells and reverse EMT by blocking PI3K/Akt/TWIS1 signal pathway.
Combination Pair ID: 314
Pair Name Aloin, Metformin
Phytochemical Aloin
Drug Metformin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Activity
Result Our research demonstrated that the concomitant treatment with aloin and MET enhances the antitumor effect by inhibiting the growth and invasion as well as inducing apoptosis and autophagy in HCC through PI3K/AKT/mTOR pathway.
Combination Pair ID: 761
Pair Name Aloin, Irinotecan
Phytochemical Aloin
Drug Irinotecan
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result Our findings suggests that CPT-11 and Aloin are potential combination treatment partners against colorectal cancer. MicroRNA-133b may serve as a co-therapeutic target with IGF1R against colorectal cancer, which might overcome the existing treatment limitations.
Combination Pair ID: 342
Pair Name Magnolin, B-RAF Inhibitors
Phytochemical Magnolin
Drug B-RAF Inhibitors
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway
Combination Pair ID: 360
Pair Name OSW-1, Carboplatin
Phytochemical OSW-1
Drug Carboplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result Our data revealed the mode of action and molecular mechanism underlying the effect of OSW-1 against TNBC, and provided a useful guidance for improving the sensitivity of TNBC cells to conventional chemotherapeutic drugs, which warrants further investigation.
Combination Pair ID: 389
Pair Name Curcumin, Docetaxel
Phytochemical Curcumin
Drug Docetaxel
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result CUR combined with DTX induced apoptosis and autophagy of ESCC and probably worked through the PI3K/AKT/mTOR signaling pathway. The combination of the autophagy inhibitor, CUR and DTX may become a new treatment strategy for esophageal cancer.
Combination Pair ID: 397
Pair Name Curcumin, Pyridoxine
Phytochemical Curcumin
Drug Pyridoxine
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result C + B is superior to either agent alone in preventing obesity-promoted colorectal carcinogenesis. Augmented suppression of procancerous signaling pathways may be the means by which this augmentation occurs.
Combination Pair ID: 818
Pair Name Curcumin, Nimustine
Phytochemical Curcumin
Drug Nimustine
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result Curcumin potentiates the potent antitumor activity of ACNU against glioblastoma by suppressing the PI3K/AKT and NF-kappaB/COX-2 signaling pathways
Combination Pair ID: 427
Pair Name Erianin, Afatinib
Phytochemical Erianin
Drug Afatinib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result EBTP/Afa targets VEGF and EGFR signaling pathways in liver cancer cells and tumor vasculature, thereby inhibiting the proliferation, motion and angiogenesis of liver cancer cells. Overall, this study provides a new combined strategy for the clinical treatment of hepatocellular carcinoma.
Combination Pair ID: 432
Pair Name [6]-Gingerol, Cisplatin
Phytochemical [6]-Gingerol
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result [6]-Gingerol enhances the cisplatin sensitivity of gastric cancer cells through inhibition of proliferation and invasion via PI3K/AKT signaling pathway
Combination Pair ID: 862
Pair Name Garcinol, Cisplatin
Phytochemical Garcinol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result Our data demonstrated that garcinol has the potential to be used as an anticancer agent and may synergize the effect of DDP. These actions are most likely through the regulation of the PI3K/AKT and NF-κB pathways.
Combination Pair ID: 459
Pair Name Quercitrin, Insulin
Phytochemical Quercitrin
Drug Insulin
Disease Info [ICD-11: 5A80] Polycystic ovary syndrome Investigative
Regulate Info Up-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result PM20D1 and PI3K/Akt were required for lipolysis and endocrine regulation in PCOS-IR to restore ovarian function and maintain normal endocrine metabolism. By upregulating the expression of PM20D1, quercitrin activated the PI3K/Akt signaling pathway, improved adipocyte catabolism, corrected reproductive and metabolic abnormalities, and had a therapeutic effect on PCOS-IR.
Combination Pair ID: 471
Pair Name Gossypol, Trastuzumab
Phytochemical Gossypol
Drug Trastuzumab
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result The trastuzumab/AT-101 combination may be a good candidate for patients with trastuzumab-resistant Her2-positive breast cancer and inhibition of the PI3K/AKT pathway may be one of the underlying mechanisms.
Combination Pair ID: 512
Pair Name Retinoic acid, PI3K inhibitor
Phytochemical All-trans-retinoic acid
Drug PI3K inhibitor
Disease Info [ICD-11: 2D4Y] Adenoid cystic carcinoma Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result We displayed the morphologically and genetic featured PDXs which recapitulated the heterogeneity of original ACC tumors, indicating that the models could be used as a platform for drug screening for therapy response. The feasibility of combination treatment approaches for dual targets were confirmed, providing new regimens for personalized therapies in ACC.
Combination Pair ID: 522
Pair Name Myriocin, Cisplatin
Phytochemical Myriocin
Drug Cisplatin
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result We suggest that myriocin is a novel potent anti-cancer agent that dually targets both VEGFR2 in ECs and IκBα in cancer cells, and exerts more pronounced anti-tumor effects than with either kinase being inhibited alone.
Combination Pair ID: 535
Pair Name Vitamin C, Cimetidine
Phytochemical Vitamin C
Drug Cimetidine
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result We concluded that the synergistic combination provided a promising anti-neoplastic effect via reducing the angiogenesis, oxidative stress, increasing apoptosis,as well as inhibiting the activation of PI3K/AKT/mTOR cue, and suggesting its use as a treatment option for breast cancer.
Combination Pair ID: 915
Pair Name Fucoxanthin, TNF-related apoptosis inducing ligand
Phytochemical Fucoxanthin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result The findings of this study suggest that the combined use of fucoxanthin and TRAIL might be a useful strategy against TRAIL-resistant cervical cancer.
Combination Pair ID: 567
Pair Name 2,3,5,6-Tetramethylpyrazine, Doxorubicin
Phytochemical 2,3,5,6-Tetramethylpyrazine
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result DLJ14 and Adr combination treatment may inhibit proliferation of Adr-resistant human breast cancer cells through inhibition of the EGFR/PI3K/Akt survival pathway and induction of apoptosis via the mitochondrial-mediated apoptosis pathway.
Combination Pair ID: 573
Pair Name Sulforaphene, Carboplatin
Phytochemical Sulforaphene
Drug Carboplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result This study demonstrates that the duel character of this combination therapy may be an effective replacement for conventional therapy alone against NSCLC.
Combination Pair ID: 574
Pair Name Sulforaphene, Cisplatin
Phytochemical Sulforaphene
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian Cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result SFE synergistically inhibited proliferation and induced apoptosis of SKOV3 and SNU8 cells in combination with cisplatin by activating multiple apoptotic pathways. Therefore, we suggest sulforaphene as a chemo-enhancing adjuvant to improve the efficacy of cisplatin in ovarian cancer treatment.
Combination Pair ID: 927
Pair Name Gamma-Tocotrienol, SU11274
Phytochemical Gamma-Tocotrienol
Drug SU11274
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result Suggest that combined γ-tocotrienol and Met inhibitor treatment may provide benefit in treatment of breast cancers characterized by aberrant Met activity.
Combination Pair ID: 935
Pair Name Cordycepin, Apatinib
Phytochemical Cordycepin
Drug Apatinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphorylation
Result Our findings demonstrated that the combination of cordycepin and apatinib has synergistically anticancer effect on NSCLC cells by down-regulating VEGF/PI3K/Akt signaling pathway. This result indicated that cordycepin and apatinib could be a promising drug combination against NSCLC.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 34
Pair Name Vinpocetine, Sorafenib
Phytochemical Vinpocetine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result Vinpocetine may be a potential candidate for sorafenib sensitization and HCC treatment, and our results may help to elucidate more effective therapeutic options for HCC patients with sorafenib resistance.
Combination Pair ID: 60
Pair Name Quercetin, Docetaxel
Phytochemical Quercetin
Drug Docetaxel
Disease Info [ICD-11: 2E02] Metastatic prostate cancer Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result Quercetin reverses docetaxel resistance in prostate cancer via androgen receptor and PI3K/Akt signaling pathways
Combination Pair ID: 229
Pair Name Tanshinone I, Epirubicin
Phytochemical Tanshinone I
Drug Epirubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Expression
Result Our results suggested that Tan I could effectively improve the anti-tumor effect of EADM, and synergize EADM to reverse HIF-1α mediated resistance via targeting PI3K/AKT/HIF-1α signaling pathway.
03. Reference
No. Title Href
1 Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells. J Food Sci. 2021 Jun;86(6):2700-2712. doi: 10.1111/1750-3841.15740. Click
2 Regorafenib in combination with silybin as a novel potential strategy for the treatment of metastatic colorectal cancer. Oncotarget. 2017 Aug 7;8(40):68305-68316. doi: 10.18632/oncotarget.20054. Click
3 Ilexgenin A exerts anti-inflammation and anti-angiogenesis effects through inhibition of STAT3 and PI3K pathways and exhibits synergistic effects with Sorafenib on hepatoma growth. Toxicol Appl Pharmacol. 2017 Jan 15;315:90-101. doi: 10.1016/j.taap.2016.12.008. Click
4 Targeting the ROS/PI3K/AKT/HIF-1α/HK2 axis of breast cancer cells: Combined administration of Polydatin and 2-Deoxy-d-glucose. J Cell Mol Med. 2019 May;23(5):3711-3723. doi: 10.1111/jcmm.14276. Click
5 Quinacrine and Curcumin in combination decreased the breast cancer angiogenesis by modulating ABCG2 via VEGF A. J Cell Commun Signal. 2023 Sep;17(3):609-626. doi: 10.1007/s12079-022-00692-0. Click
6 Mangiferin Ameliorates Cisplatin Induced Acute Kidney Injury by Upregulating Nrf-2 via the Activation of PI3K and Exhibits Synergistic Anticancer Activity With Cisplatin. Front Pharmacol. 2018 Jun 18;9:638. doi: 10.3389/fphar.2018.00638. Click
7 Magnoflorine improves sensitivity to doxorubicin (DOX) of breast cancer cells via inducing apoptosis and autophagy through AKT/mTOR and p38 signaling pathways. Biomed Pharmacother. 2020 Jan;121:109139. doi: 10.1016/j.biopha.2019.109139. Click
8 Synergistic inhibitory effect of Smo inhibitor jervine and its combination with decitabine can target Hedgehog signaling pathway to inhibit myelodysplastic syndrome cell line. Hematology. 2021 Dec;26(1):518-528. doi: 10.1080/16078454.2021.1950897. Click
9 Synergistic effect of kaempferol and 5‑fluorouracil on the growth of colorectal cancer cells by regulating the PI3K/Akt signaling pathway. Mol Med Rep. 2019 Jul;20(1):728-734. doi: 10.3892/mmr.2019.10296. Click
10 Kaempferol potentiates the sensitivity of pancreatic cancer cells to erlotinib via inhibition of the PI3K/AKT signaling pathway and epidermal growth factor receptor. Inflammopharmacology. 2021 Oct;29(5):1587-1601. doi: 10.1007/s10787-021-00848-1. Click
11 Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer. Int J Cancer. 2019 Dec 1;145(11):3022-3032. doi: 10.1002/ijc.32367. Click
12 Fisetin, a phytochemical, potentiates sorafenib-induced apoptosis and abrogates tumor growth in athymic nude mice implanted with BRAF-mutated melanoma cells. Oncotarget. 2015 Sep 29;6(29):28296-311. doi: 10.18632/oncotarget.5064. Click
13 Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells. Exp Oncol. 2021 Jun;43(2):125-134. doi: 10.32471/exp-oncology.2312-8852.vol-43-no-2.16096. Click
14 The novel small molecule BH3 mimetic nobiletin synergizes with vorinostat to induce apoptosis and autophagy in small cell lung cancer. Biochem Pharmacol. 2023 Oct;216:115807. doi: 10.1016/j.bcp.2023.115807. Click
15 Liquiritigenin Potentiates the Inhibitory Effects of Cisplatin on Invasion and Metastasis Via Downregulation MMP-2/9 and PI3 K/AKT Signaling Pathway in B16F10 Melanoma Cells and Mice Model. Nutr Cancer. 2015;67(5):761-70. doi: 10.1080/01635581.2015.1037962. Click
16 4'-hydroxywogonin inhibits colorectal cancer angiogenesis by disrupting PI3K/AKT signaling. Chem Biol Interact. 2018 Dec 25;296:26-33. doi: 10.1016/j.cbi.2018.09.003. Click
17 Ursolic Acid Enhances the Sensitivity of MCF-7 and MDA-MB-231 Cells to Epirubicin by Modulating the Autophagy Pathway. Molecules. 2022 May 25;27(11):3399. doi: 10.3390/molecules27113399. Click
18 Tanshinone IIA combined with cisplatin synergistically inhibits non-small-cell lung cancer in vitro and in vivo via down-regulating the phosphatidylinositol 3-kinase/Akt signalling pathway. Phytother Res. 2019 Sep;33(9):2298-2309. doi: 10.1002/ptr.6392. Click
19 Ginsenoside Rg3 and sorafenib combination therapy relieves the hepatocellular carcinomaprogression through regulating the HK2-mediated glycolysis and PI3K/Akt signaling pathway. Bioengineered. 2022 May;13(5):13919-13928. doi: 10.1080/21655979.2022.2074616. Click
20 Inhibiting effect of Endostar combined with ginsenoside Rg3 on breast cancer tumor growth in tumor-bearing mice. Asian Pac J Trop Med. 2016 Feb;9(2):180-3. doi: 10.1016/j.apjtm.2016.01.010. Click
21 Combinatorial treatment of Rhizoma Paridis saponins and sorafenib overcomes the intolerance of sorafenib. J Steroid Biochem Mol Biol. 2018 Oct;183:159-166. doi: 10.1016/j.jsbmb.2018.06.010. Click
22 Costunolide enhances sensitivity of K562/ADR chronic myeloid leukemia cells to doxorubicin through PI3K/Akt pathway. Phytother Res. 2019 Jun;33(6):1683-1688. doi: 10.1002/ptr.6355. Click
23 β-Elemene Enhances the Chemotherapeutic Effect of 5-Fluorouracil in Triple-Negative Breast Cancer via PI3K/AKT, RAF-MEK-ErK, and NF-κB Signaling Pathways. Onco Targets Ther. 2020 Jun 9;13:5207-5222. doi: 10.2147/OTT.S242820. Click
24 β-Elemene Enhances the Chemotherapeutic Effect of 5-Fluorouracil in Triple-Negative Breast Cancer via PI3K/AKT, RAF-MEK-ErK, and NF-κB Signaling Pathways. Onco Targets Ther. 2020 Jun 9;13:5207-5222. doi: 10.2147/OTT.S242820. Click
25 Tubeimoside-I sensitizes temozolomide-resistant glioblastoma cells to chemotherapy by reducing MGMT expression and suppressing EGFR induced PI3K/Akt/mTOR/NF-κB-mediated signaling pathway. Phytomedicine. 2022 May;99:154016. doi: 10.1016/j.phymed.2022.154016. Click
26 Chemopreventive effect of α-hederin/carboplatin combination against experimental colon hyperplasia and impact on JNK signaling. Toxicol Mech Methods. 2021 Feb;31(2):138-149. doi: 10.1080/15376516.2020.1849483. Click
27 Shikonin and 4-hydroxytamoxifen synergistically inhibit the proliferation of breast cancer cells through activating apoptosis signaling pathway in vitro and in vivo. Chin Med. 2020 Mar 10;15:23. doi: 10.1186/s13020-020-00305-1. Click
28 Shikonin exerts antitumor activity in Burkitt's lymphoma by inhibiting C-MYC and PI3K/AKT/mTOR pathway and acts synergistically with doxorubicin. Sci Rep. 2018 Feb 20;8(1):3317. doi: 10.1038/s41598-018-21570-z. Click
29 Tanshinone IIA enhances the inhibitory effect of imatinib on proliferation and motility of acute leukemia cell line TIB‑152 in vivo and in vitro by inhibiting the PI3K/AKT/mTOR signaling pathway. Oncol Rep. 2020 Feb;43(2):503-515. doi: 10.3892/or.2019.7453. Click
30 Inhibition of PI3K/AKT signaling via ROS regulation is involved in Rhein-induced apoptosis and enhancement of oxaliplatin sensitivity in pancreatic cancer cells. Int J Biol Sci. 2021 Jan 15;17(2):589-602. doi: 10.7150/ijbs.49514. Click
31 Organic anion transporters and PI3K-AKT-mTOR pathway mediate the synergistic anticancer effect of pemetrexed and rhein. J Cell Physiol. 2020 Apr;235(4):3309-3319. doi: 10.1002/jcp.29218. Click
32 Sensitization of Non-Small Cell Lung Cancer Cells to Gefitinib and Reversal of Epithelial-Mesenchymal Transition by Aloe-Emodin Via PI3K/Akt/TWIS1 Signal Blockage. Front Oncol. 2022 May 23;12:908031. doi: 10.3389/fonc.2022.908031. Click
33 Combination of aloin and metformin enhances the antitumor effect by inhibiting the growth and invasion and inducing apoptosis and autophagy in hepatocellular carcinoma through PI3K/AKT/mTOR pathway. Cancer Med. 2020 Feb;9(3):1141-1151. doi: 10.1002/cam4.2723. Click
34 Aloin and CPT-11 combination activates miRNA-133b and downregulates IGF1R- PI3K/AKT/mTOR and MEK/ERK pathways to inhibit colorectal cancer progression. Biomed Pharmacother. 2023 Dec 31;169:115911. doi: 10.1016/j.biopha.2023.115911. Click
35 Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway. Am J Transl Res. 2019 Jun 15;11(6):3816-3824. Click
36 OSW-1 induces apoptosis and cyto-protective autophagy, and synergizes with chemotherapy on triple negative breast cancer metastasis. Cell Oncol (Dordr). 2022 Dec;45(6):1255-1275. doi: 10.1007/s13402-022-00716-2. Click
37 Combination effect of curcumin with docetaxel on the PI3K/AKT/mTOR pathway to induce autophagy and apoptosis in esophageal squamous cell carcinoma. Am J Transl Res. 2021 Jan 15;13(1):57-72. Click
38 Combined Supplementation with Vitamin B-6 and Curcumin is Superior to Either Agent Alone in Suppressing Obesity-Promoted Colorectal Tumorigenesis in Mice. J Nutr. 2021 Dec 3;151(12):3678-3688. doi: 10.1093/jn/nxab320. Click
39 Curcumin Potentiates the Potent Antitumor Activity of ACNU Against Glioblastoma by Suppressing the PI3K/AKT and NF-κB/COX-2 Signaling Pathways [Retraction]. Onco Targets Ther. 2022 Dec 2;15:1479-1480. doi: 10.2147/OTT.S399704. Click
40 Ethoxy-erianin phosphate and afatinib synergistically inhibit liver tumor growth and angiogenesis via regulating VEGF and EGFR signaling pathways. Toxicol Appl Pharmacol. 2022 Mar 1;438:115911. doi: 10.1016/j.taap.2022.115911. Click
41 [6]-Gingerol enhances the cisplatin sensitivity of gastric cancer cells through inhibition of proliferation and invasion via PI3K/AKT signaling pathway. Phytother Res. 2019 May;33(5):1353-1362. doi: 10.1002/ptr.6325. Click
42 Garcinol Alone and in Combination With Cisplatin Affect Cellular Behavior and PI3K/AKT Protein Phosphorylation in Human Ovarian Cancer Cells. Dose Response. 2020 May 19;18(2):1559325820926732. doi: 10.1177/1559325820926732. Click
43 Quercitrin alleviates lipid metabolism disorder in polycystic ovary syndrome-insulin resistance by upregulating PM20D1 in the PI3K/Akt pathway. Phytomedicine. 2023 Aug;117:154908. doi: 10.1016/j.phymed.2023.154908. Click
44 Trastuzumab in combination with AT-101 induces cytotoxicity and apoptosis in Her2 positive breast cancer cells. Future Oncol. 2020 Jan;16(3):4485-4495. doi: 10.2217/fon-2019-0521. Click
45 Establishment of patient-derived xenograft models of adenoid cystic carcinoma to assess pre-clinical efficacy of combination therapy of a PI3K inhibitor and retinoic acid. Am J Cancer Res. 2021 Mar 1;11(3):773-792. Click
46 Dual anti-angiogenic and anti-metastatic activity of myriocin synergistically enhances the anti-tumor activity of cisplatin. Cell Oncol (Dordr). 2023 Feb;46(1):117-132. doi: 10.1007/s13402-022-00737-x. Click
47 Anti-neoplastic action of Cimetidine/Vitamin C on histamine and the PI3K/AKT/mTOR pathway in Ehrlich breast cancer. Sci Rep. 2022;12(1):11514. Published 2022 Jul 7. doi:10.1038/s41598-022-15551-6 Click
48 Sensitization of TRAIL-resistant cervical cancer cells through combination of TRAIL and fucoxanthin treatments. Eur Rev Med Pharmacol Sci. 2017 Dec;21(24):5594-5601. doi: 10.26355/eurrev_201712_14000. Click
49 Combination treatment of ligustrazine piperazine derivate DLJ14 and adriamycin inhibits progression of resistant breast cancer through inhibition of the EGFR/PI3K/Akt survival pathway and induction of apoptosis. Drug Discov Ther. 2014 Feb;8(1):33-41. doi: 10.5582/ddt.8.33. Click
50 Sulforaphene-Carboplatin Combination Synergistically Enhances Apoptosis by Disruption of Mitochondrial Membrane Potential and Cell Cycle Arrest in Human Non-Small Cell Lung Carcinoma. J Med Food. 2016 Sep;19(9):860-9. doi: 10.1089/jmf.2016.3675. Click
51 Sulforaphene Synergistically Sensitizes Cisplatin via Enhanced Mitochondrial Dysfunction and PI3K/PTEN Modulation in Ovarian Cancer Cells. Anticancer Res. 2015 Jul;35(7):3901-8. Click
52 Combined γ-tocotrienol and Met inhibitor treatment suppresses mammary cancer cell proliferation, epithelial-to-mesenchymal transition and migration. Cell Prolif. 2013 Oct;46(5):538-53. doi: 10.1111/cpr.12059. Click
53 Combination of Cordycepin and Apatinib Synergistically Inhibits NSCLC Cells by Down-Regulating VEGF/PI3K/Akt Signaling Pathway. Front Oncol. 2020 Sep 7;10:1732. doi: 10.3389/fonc.2020.01732. Click
54 Enhanced anticancer activity by the combination of vinpocetine and sorafenib via PI3K/AKT/GSK-3β signaling axis in hepatocellular carcinoma cells. Anticancer Drugs. 2021 Aug 1;32(7):727-733. doi: 10.1097/CAD.0000000000001056. Click
55 Quercetin reverses docetaxel resistance in prostate cancer via androgen receptor and PI3K/Akt signaling pathways. Int J Biol Sci. 2020 Feb 10;16(7):1121-1134. doi: 10.7150/ijbs.41686. Click
56 Combined Treatment of Tanshinone I and Epirubicin Revealed Enhanced Inhibition of Hepatocellular Carcinoma by Targeting PI3K/AKT/HIF-1α. Drug Des Devel Ther. 2022 Sep 19;16:3197-3213. doi: 10.2147/DDDT.S360691. Click
It has been 587981 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP