TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Baculoviral IAP repeat-containing protein 5
UniProt ID BIRC5_HUMAN
Gene Name BIRC5
Gene ID 332
Synonyms
BIRC5, API4, EPR-1
Sequence
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
KKEFEETAEKVRRAIEQLAAMD
Pathway Map MAP LINK
T.C. Number 9.B.87.1.14
KEGG ID hsa332
TTD ID T02677
Pfam PF00653
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 659
Pair Name Morusin, TNF-related apoptosis inducing ligand
Phytochemical Name Morusin
Anticancer drug Name TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result These results suggest that morusin enhances TRAIL sensitivity in human glioblastoma cells through regulating expression of DR5 and EGFR. Therefore, the combination treatment of TRAIL and morusin may be a new therapeutic strategy for malignant glioma patients.
Combination Pair ID: 1013
Pair Name Oleanolic Acid, Doxorubicin
Phytochemical Name Oleanolic Acid
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result This approach may increase the efficiency of chemotherapy and reduce unintended side effects by lowering the prescribed dose of DOX.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 8
Pair Name Harmine, Paclitaxel
Phytochemical Harmine
Drug Paclitaxel
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer
Combination Pair ID: 9
Pair Name Piperlongumine, Doxorubicin
Phytochemical Piperlongumine
Drug Doxorubicin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells
Combination Pair ID: 10
Pair Name Piperlongumine, Paclitaxel
Phytochemical Piperlongumine
Drug Paclitaxel
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells
Combination Pair ID: 18
Pair Name Oxymatrine, Paclitaxel
Phytochemical Oxymatrine
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model
Combination Pair ID: 20
Pair Name Narciclasine, Tamoxifen
Phytochemical Narciclasine
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Our findings successfully highlight the STAT3 as the direct therapeutic target of Nar in ER-positive breast cancer cells, especially, Nar leaded STAT3 degradation as a promising strategy for the tamoxifen-resistant breast cancer treatment.
Combination Pair ID: 22
Pair Name Evodiamine, Doxorubicin
Phytochemical Evodiamine
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Our results indicated that EVO enhanced the apoptotic action of DOX by inhibiting the Ras/MEK/ERK cascade and the expression of IAPs without inhibiting the expression and activity of P-glycoprotein (P-gp). Taken together, our data indicate that EVO, a natural product, may be useful applied alone or in combination with DOX for the treatment of resistant breast cancer.
Combination Pair ID: 653
Pair Name Silibinin, Trichostatin A
Phytochemical Silibinin
Drug Trichostatin A
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Combinations of TSA with silibinin synergistically augmented the cytotoxic effects of the single agent, which was associated with a dramatic increase in p21 (Cdkn1a)
Combination Pair ID: 654
Pair Name Silibinin, Trichostatin A
Phytochemical Silibinin
Drug Trichostatin A
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Combination of HDAC inhibitor TSA and silibinin induces cell cycle arrest and apoptosis by targeting survivin and cyclinB1/Cdk1 in pancreatic cancer cells
Combination Pair ID: 115
Pair Name Morusin, MAPK pathway inhibitors
Phytochemical Morusin
Drug MAPK pathway inhibitors
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Our results suggested that the combination of morusin and MAPK pathway inhibitors may be a more effective treatment strategy for BRAF-mutant melanoma than MAPK pathway inhibitors alone.
Combination Pair ID: 661
Pair Name Epigallocatechin gallate, TNF-related apoptosis inducing ligand
Phytochemical Epigallocatechin gallate
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis
Combination Pair ID: 663
Pair Name Epigallocatechin gallate, TNF-related apoptosis inducing ligand
Phytochemical Epigallocatechin gallate
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B6B] Nasopharyngeal carcinoma Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result EGCG sensitizes NPC cells to TRAIL-mediated apoptosis via modulation of extrinsic and intrinsic apoptotic pathways and inhibition of NF-κB activation.
Combination Pair ID: 131
Pair Name Casticin, TNF-related apoptosis inducing ligand
Phytochemical Casticin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Casticin enhances TRAIL-induced apoptosis through the downregulation of cell survival proteins and the upregulation of DR5 receptors through actions on the ROS-ER stress-CHOP pathway.
Combination Pair ID: 192
Pair Name Ursolic acid, Oxaliplatin
Phytochemical Ursolic acid
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result These observations suggested that a combination of UA and Oxa elicited synergistically anticancer effects in RKO cells and provided new evidence for potential application of UA and Oxa for CRC treatment.
Combination Pair ID: 209
Pair Name Ginsenoside, Regorafenib
Phytochemical Ginsenoside
Drug Regorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result The findings in this study offered a theoretical insight into clinical use of regorafenib and ginsenoside for treatment of liver cancer.
Combination Pair ID: 689
Pair Name Cucurbitacin B, Doxorubicin
Phytochemical Cucurbitacin B
Drug Doxorubicin
Disease Info [ICD-11: 2D10.Z] Thyroid cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Synergistic cytotoxicity of doxorubicin with cucurbitacin B is mediated by B-cell chronic lymphocytic leukemia/lymphoma 2 family proteins, survivin, and reactive oxygen species and modulated by Janus kinase 2/signal transducer and activator of transcription 3 and extracellular signal-regulated kinase 1/2 in anaplastic thyroid carcinoma cells.
Combination Pair ID: 246
Pair Name Oleuropein, Doxorubicin
Phytochemical Oleuropein
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result The key findings clearly indicate the synergistic efficacy of DOX with natural and nontoxic OL against breast tumor xenografts.
Combination Pair ID: 256
Pair Name Alpha-Hederin, Cisplatin
Phytochemical Alpha-Hederin
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result α-Hederin enhances cisplatin-induced anti-tumour effects in GC both in vitro and in vivo by promoting the accumulation of ROS and decreasing MMP. Our data strongly suggested that α-Hederin is a promising candidate for intervention in gastric cancer.
Combination Pair ID: 258
Pair Name Raddeanin A, Cisplatin
Phytochemical Raddeanin A
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result All these consequences reflect RA plays an important role in enhancing the therapeutic effect of cisplatin in HCC. This finding may guide for the drug usage of cisplatin in clinic practice.
Combination Pair ID: 273
Pair Name Eurycomalactone, Cisplatin
Phytochemical Eurycomalactone
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result This finding provides a rationale for the combined use of chemotherapy drugs with ECL to improve their efficacy in NSCLC treatment.
Combination Pair ID: 332
Pair Name Bergamottin, Simvastatin
Phytochemical Bergamottin
Drug Simvastatin
Disease Info [ICD-11: 2A20.1] Chronic myelogenous leukemia Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Discussion and conclusion Our results provide novel insight into the role of SV and BGM in potentially preventing and treating cancer through modulation of NF-κB signalling pathway and its regulated gene products.
Combination Pair ID: 335
Pair Name Decursin, Doxorubicin
Phytochemical Decursin
Drug Doxorubicin
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result The combination treatment of decursin and doxorubicin can enhance apoptotic activity via mTOR and/or STAT3 signaling pathway in multiple myeloma cells.
Combination Pair ID: 787
Pair Name Bufalin, 2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one
Phytochemical Bufalin
Drug 2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Bufalin is a potential regimen to be used in combination with conventional chemotherapeutic drugs to improve acute promyelocytic leukemia therapy.
Combination Pair ID: 802
Pair Name Pterostilbene, TNF-related apoptosis inducing ligand
Phytochemical Pterostilbene
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Pterostilbene enhances TRAIL-induced apoptosis through the induction of death receptors and downregulation of cell survival proteins in TRAIL-resistance triple negative breast cancer cells
Combination Pair ID: 376
Pair Name Resveratrol, Temozolomide
Phytochemical Resveratrol
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Our results demonstrated synergistic effects of Res/TMZ on RG-2 cells and their bilaterally sensitizing effects to LN-18 and LN-428 cells. Frequent upregulation of MGMT and activation of STAT3 are the unfavorable factors for the treatment of GBMs and they may be the potential targets of Res/TMZ therapy.
Combination Pair ID: 388
Pair Name Curcumin, Apatinib
Phytochemical Curcumin
Drug Apatinib
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Apa-Cur combination therapy exerts more profound anti-proliferation effects on breast cancer cell than Apatinib or Curcumin monotherapy. However, further studies are required to identify other possible signaling pathways and mechanisms involved in the anticancer effects of Apatinib, Curcumin, and Apa-Cur.
Combination Pair ID: 406
Pair Name Capsaicin, Arsenic trioxide
Phytochemical Capsaicin
Drug Arsenic trioxide
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Combination index (CI) values were < 1 in all matched combination groups. Additional evaluation of As2O3 combined with ACM as a potential therapeutic benefit for AML seems warranted.
Combination Pair ID: 833
Pair Name Capsaicin, TNF-related apoptosis inducing ligand
Phytochemical Capsaicin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result A combined regimen using capsaicin and TRAIL may provide a safe and effective strategy for treating malignant gliomas.
Combination Pair ID: 417
Pair Name Icariin, Gemcitabine
Phytochemical Icariin
Drug Gemcitabine
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Icariin, by suppressing NF-κB activity, exerts antitumor activity, and potentiates the antitumor activity of gemcitabine in gallbladder cancer. Combined administration of gemcitabine and icariin may offer a better therapeutic option for the patients with gallbladder cancer.
Combination Pair ID: 863
Pair Name Alpha-Mangostin, Tamoxifen
Phytochemical Alpha-Mangostin
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result This study establishes the benefits of incorporating AM as a co-adjuvant for first-line ER+ breast cancer therapy.
Combination Pair ID: 454
Pair Name Mangiferin, Doxorubicin
Phytochemical Mangiferin
Drug Doxorubicin
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Our findings suggest that the combination of mangiferin and an anticancer drug could be used as a new regime for the treatment of MM.
Combination Pair ID: 870
Pair Name Shogaol, Gemcitabine
Phytochemical Shogaol
Drug Gemcitabine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Our results suggest that 6-shogaol can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing of TLR4/NF-κB-mediated inflammatory pathways linked to tumorigenesis.
Combination Pair ID: 463
Pair Name Biochanin A, Fluorouracil
Phytochemical Biochanin A
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result The synergistic antitumor effect of Bio-A/ 5-FU combination can be, at least partly, attributed to Bio-A-mediated suppression of ER-α/Akt axis and the augmentation of 5-FU-mediated proapoptotic effects.
Combination Pair ID: 875
Pair Name Gossypol, Zoledronic acid
Phytochemical Gossypol
Drug Zoledronic acid
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result GP significantly enhances the anti-tumor activity of ZA in hormone- and drug-resistant prostate cancer cells by targeting many pivotal apoptosis-related proteins.
Combination Pair ID: 479
Pair Name Bakuchiol, TNF-related apoptosis inducing ligand
Phytochemical Bakuchiol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result The collective results suggest that bakuchiol facilitates TRAIL-induced apoptosis in colon cancer cells through up-regulation of the TRAIL receptors; DR4 and DR5 via ROS/JNK pathway signals.
Combination Pair ID: 879
Pair Name Gambogic Acid, Cisplatin
Phytochemical Gambogic Acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Gambogic acid sensitises lung cancer cells to CDDP in vitro and in vivo in NSCLC through inactivation of NF-κB and MAPK/HO-1 signalling pathways, providing a rationale for the combined use of CDDP and GA in lung cancer chemotherapy.
Combination Pair ID: 881
Pair Name Gambogic Acid, TNF-related apoptosis inducing ligand
Phytochemical Gambogic Acid
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result These findings may open a new window in the treatment of breast cancer using TRAIL in combination with GA.
Combination Pair ID: 886
Pair Name Gambogic Acid, Doxorubicin
Phytochemical Gambogic Acid
Drug Doxorubicin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result These findings indicate that GA sensitizes lung cancer cells to ADM in vitro and in vivo, providing a rationale for the combined use of GA and ADM in lung cancer chemotherapy.
Combination Pair ID: 497
Pair Name Medicarpin, TNF-related apoptosis inducing ligand
Phytochemical Medicarpin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B33.1] Myeloid leukemia Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway
Combination Pair ID: 499
Pair Name Bisdemethoxycucurmin, Icotinib
Phytochemical Bisdemethoxycucurmin
Drug Icotinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.
Combination Pair ID: 518
Pair Name All-trans retinoic acid, Salinomycin
Phytochemical All-trans-retinoic acid
Drug Salinomycin
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result S+RA induced differentiation by β-catenin-inhibition-mediated up-regulation of C/EBPs and PU.1 and suppression of c-Myc. S+RA triggered apoptosis through β-catenin-inhibition-regulated ΔΨm collapse and caspase-3/7 activation. Taken together, our findings may provide novel therapeutic strategies for AML patients by targeting the WNT/β-catenin pathway.
Combination Pair ID: 562
Pair Name Brassinolid, Doxorubicin
Phytochemical Brassinolid
Drug Doxorubicin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result These data indicate that EB, a natural product with widespread occurrence in plants, is pharmacologically active in both drug-sensitive and drug-resistant SCLC cells and acts through the Wnt signaling pathway.
Combination Pair ID: 563
Pair Name Arachidin-1, Paclitaxel
Phytochemical Arachidin-1
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result A-1 in combination with Pac inhibited cell proliferation, induced apoptosis through mitochondrial oxidative stress, and reduced TNBC spheroid growth. These findings underscore the impactful effects of the prenylated stilbenoid A-1 as a novel adjuvant for Pac chemotherapy in TNBC treatment.
Combination Pair ID: 926
Pair Name Gamma-Tocotrienol, Capecitabine
Phytochemical Gamma-Tocotrienol
Drug Capecitabine
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Our results show that γ-tocotrienol can potentiate the effects of capecitabine through suppression of NF-κB-regulated markers of proliferation, invasion, angiogenesis, and metastasis.
Combination Pair ID: 929
Pair Name Gamma-Tocotrienol, Capecitabine
Phytochemical Gamma-Tocotrienol
Drug Capecitabine
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Our findings suggest that γ-T3 inhibited the growth of human CRC and sensitised CRC to capecitabine by regulating proteins linked to tumourigenesis.
Combination Pair ID: 930
Pair Name Gamma-Tocotrienol, Docetaxel
Phytochemical Gamma-Tocotrienol
Drug Docetaxel
Disease Info [ICD-11: 2B66.Z] Oral cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result These findings suggest that the combination treatment with these agents may provide enhanced therapeutic response in oral cancer patients, while avoiding the toxicity associated with high-dose β-tubulin stabilization monotherapy.
Combination Pair ID: 950
Pair Name Phenethyl isothiocyanate, Dibenzoylmethane
Phytochemical Phenethyl isothiocyanate
Drug Dibenzoylmethane
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Our results indicate that administration of DBM and PEITC in combination may be an effective strategy for inhibiting/delaying the progression of prostate cancer to androgen independence.
Combination Pair ID: 610
Pair Name Noscapine, Cisplatin
Phytochemical Noscapine
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Noscapine Increases the Sensitivity of Drug-Resistant Ovarian Cancer Cell Line SKOV3/DDP to Cisplatin by Regulating Cell Cycle and Activating Apoptotic Pathways
Combination Pair ID: 955
Pair Name Noscapine, Cisplatin
Phytochemical Noscapine
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Our results suggest that Nos enhanced the anticancer activity of Cis in an additive to synergistic manner by activating multiple signaling pathways including apoptosis. These findings suggest potential benefit for use of Nos and Cis combination in treatment of lung cancer.
Combination Pair ID: 957
Pair Name Noscapine, Gemcitabine
Phytochemical Noscapine
Drug Gemcitabine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Nos potentiated the anticancer activity of Gem in an additive to synergistic manner against lung cancer via antiangiogenic and apoptotic pathways. These findings suggest potential benefit for use of NGC chemotherapy for treatment of lung cancer.
Combination Pair ID: 959
Pair Name Periplocin, Gemcitabine
Phytochemical Periplocin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells
Combination Pair ID: 960
Pair Name Periplocin, TNF-related apoptosis inducing ligand
Phytochemical Periplocin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B70.1] Esophageal squamous cell carcinoma Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Our data suggest that CPP and TRAIL could be further explored as potential therapeutic approach for esophageal cancer.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 871
Pair Name Shogaol, TNF-related apoptosis inducing ligand
Phytochemical Shogaol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result This study gives rise to the possibility of applying shogaol as an antitumor agent that can be used for the purpose of combination treatment with TRAIL in TRAIL-resistant colon tumor therapy.
Combination Pair ID: 931
Pair Name Gamma-Tocotrienol, Simvastatin
Phytochemical Gamma-Tocotrienol
Drug Simvastatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Baculoviral IAP repeat-containing protein 5 Expression
Result Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol
03. Reference
No. Title Href
1 Morusin Induces TRAIL Sensitization by Regulating EGFR and DR5 in Human Glioblastoma Cells. J Nat Prod. 2016 Feb 26;79(2):317-23. doi: 10.1021/acs.jnatprod.5b00919. Click
2 Oleanolic acid increases the anticancer potency of doxorubicin in pancreatic cancer cells. J Biochem Mol Toxicol. 2023 Oct;37(10):e23426. doi: 10.1002/jbt.23426. Click
3 Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer. Oncol Lett. 2016 Aug;12(2):983-988. doi: 10.3892/ol.2016.4696. Click
4 Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells. Chem Biol Interact. 2022 Feb 25;354:109832. doi: 10.1016/j.cbi.2022.109832. Click
5 Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells. Biomed Pharmacother. 2020 Aug;128:110243. doi: 10.1016/j.biopha.2020.110243. Click
6 Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model. Cancers (Basel). 2019 Jan 7;11(1):49. doi: 10.3390/cancers11010049. Click
7 Narciclasine targets STAT3 via distinct mechanisms in tamoxifen-resistant breast cancer cells. Mol Ther Oncolytics. 2022 Jan 3;24:340-354. doi: 10.1016/j.omto.2021.12.025. Click
8 Evodiamine synergizes with doxorubicin in the treatment of chemoresistant human breast cancer without inhibiting P-glycoprotein. PLoS One. 2014 May 15;9(5):e97512. doi: 10.1371/journal.pone.0097512. Click
9 Epigenetic modifications and p21-cyclin B1 nexus in anticancer effect of histone deacetylase inhibitors in combination with silibinin on non-small cell lung cancer cells. Epigenetics. 2012 Oct;7(10):1161-72. doi: 10.4161/epi.22070. Click
10 Combination of HDAC inhibitor TSA and silibinin induces cell cycle arrest and apoptosis by targeting survivin and cyclinB1/Cdk1 in pancreatic cancer cells. Biomed Pharmacother. 2015 Aug;74:257-64. doi: 10.1016/j.biopha.2015.08.017. Click
11 Morusin enhances the antitumor activity of MAPK pathway inhibitors in BRAF-mutant melanoma by inhibiting the feedback activation of STAT3. Eur J Cancer. 2022 Apr;165:58-70. doi: 10.1016/j.ejca.2022.01.004. Click
12 Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63. doi: 10.1038/sj.onc.1210840. Click
13 EGCG sensitizes human nasopharyngeal carcinoma cells to TRAIL-mediated apoptosis by activation NF-κB. Neoplasma. 2017;64(1):74-80. doi: 10.4149/neo_2017_109. Click
14 Casticin potentiates TRAIL-induced apoptosis of gastric cancer cells through endoplasmic reticulum stress. PLoS One. 2013;8(3):e58855. doi: 10.1371/journal.pone.0058855. Click
15 Ursolic acid potentiated oxaliplatin to induce apoptosis in colorectal cancer RKO cells. Pharmazie. 2020 Jun 1;75(6):246-249. doi: 10.1691/ph.2020.0417. Click
16 Regorafenib and ginsenoside combination therapy: inhibition of HepG2 cell growth through modulating survivin and caspase-3 gene expression. Clin Transl Oncol. 2020 Sep;22(9):1491-1498. doi: 10.1007/s12094-019-02283-9. Click
17 Doxorubicin has a synergistic cytotoxicity with cucurbitacin B in anaplastic thyroid carcinoma cells. Tumour Biol. 2017 Feb;39(2):1010428317692252. doi: 10.1177/1010428317692252. Click
18 Synergistic Anti-Breast-Cancer Effects of Combined Treatment With Oleuropein and Doxorubicin In Vivo. Altern Ther Health Med. 2019 May;25(3):17-24. Click
19 Combining α-Hederin with cisplatin increases the apoptosis of gastric cancer in vivo and in vitro via mitochondrial related apoptosis pathway. Biomed Pharmacother. 2019 Dec;120:109477. doi: 10.1016/j.biopha.2019.109477. Click
20 Synergy of Raddeanin A and cisplatin induced therapeutic effect enhancement in human hepatocellular carcinoma. Biochem Biophys Res Commun. 2017 Apr 1;485(2):335-341. doi: 10.1016/j.bbrc.2017.02.079. Click
21 Inactivation of AKT/NF‑κB signaling by eurycomalactone decreases human NSCLC cell viability and improves the chemosensitivity to cisplatin. Oncol Rep. 2020 Oct;44(4):1441-1454. doi: 10.3892/or.2020.7710. Click
22 Simvastatin in combination with bergamottin potentiates TNF-induced apoptosis through modulation of NF-κB signalling pathway in human chronic myelogenous leukaemia. Pharm Biol. 2016 Oct;54(10):2050-60. doi: 10.3109/13880209.2016.1141221. Click
23 Decursin and Doxorubicin Are in Synergy for the Induction of Apoptosis via STAT3 and/or mTOR Pathways in Human Multiple Myeloma Cells. Evid Based Complement Alternat Med. 2013;2013:506324. doi: 10.1155/2013/506324. Click
24 Bufalin induces the apoptosis of acute promyelocytic leukemia cells via the downregulation of survivin expressionBufalin induces the apoptosis of acute promyelocytic leukemia cells via the downregulation of survivin expression. Acta Haematol. 2012;128(3):144-50. doi: 10.1159/000339424. Click
25 Pterostilbene Enhances TRAIL-Induced Apoptosis through the Induction of Death Receptors and Downregulation of Cell Survival Proteins in TRAIL-Resistance Triple Negative Breast Cancer Cells. J Agric Food Chem. 2017 Dec 27;65(51):11179-11191. doi: 10.1021/acs.jafc.7b02358. Click
26 Synergistic Effects of Resveratrol and Temozolomide Against Glioblastoma Cells: Underlying Mechanism and Therapeutic Implications. Cancer Manag Res. 2020 Sep 11;12:8341-8354. doi: 10.2147/CMAR.S258584. Click
27 Anti-proliferation effects of Apatinib in combination with Curcumin in breast cancer cells. Horm Mol Biol Clin Investig. 2022 Sep 5;44(1):27-32. doi: 10.1515/hmbci-2022-0036. Click
28 Low-dose arsenic trioxide combined with aclacinomycin A synergistically enhances the cytotoxic effect on human acute myelogenous leukemia cell lines by induction of apoptosis. Leuk Lymphoma. 2015;56(11):3159-67. doi: 10.3109/10428194.2015.1011155. Click
29 Capsaicin sensitizes malignant glioma cells to TRAIL-mediated apoptosis via DR5 upregulation and survivin downregulation. Carcinogenesis. 2010 Mar;31(3):367-75. doi: 10.1093/carcin/bgp298. Click
30 Icariin potentiates the antitumor activity of gemcitabine in gallbladder cancer by suppressing NF-κB. Acta Pharmacol Sin. 2013 Feb;34(2):301-8. doi: 10.1038/aps.2012.162. Click
31 Enhancing Tamoxifen Therapy with α-Mangostin: Synergistic Antiproliferative Effects on Breast Cancer Cells and Potential Reduced Endometrial Impact. Pharmaceuticals (Basel). 2023 Nov 8;16(11):1576. doi: 10.3390/ph16111576. Click
32 Mangiferin enhances the sensitivity of human multiple myeloma cells to anticancer drugs through suppression of the nuclear factor κB pathway. Int J Oncol. 2016 Jun;48(6):2704-12. doi: 10.3892/ijo.2016.3470. Click
33 Antitumor activity of gemcitabine can be potentiated in pancreatic cancer through modulation of TLR4/NF-κB signaling by 6-shogaol. AAPS J. 2014 Mar;16(2):246-57. doi: 10.1208/s12248-013-9558-3. Click
34 The natural isoflavone Biochanin-A synergizes 5-fluorouracil anticancer activity in vitro and in vivo in Ehrlich solid-phase carcinoma model. Phytother Res. 2022 Mar;36(3):1310-1325. doi: 10.1002/ptr.7388. Click
35 Targeting apoptosis in the hormone- and drug-resistant prostate cancer cell line, DU-145, by gossypol/zoledronic acid combination. Cell Biol Int. 2009 Nov;33(11):1165-72. doi: 10.1016/j.cellbi.2009.08.006. Click
36 Bakuchiol sensitizes cancer cells to TRAIL through ROS- and JNK-mediated upregulation of death receptors and downregulation of survival proteins. Biochem Biophys Res Commun. 2016 Apr 29;473(2):586-92. doi: 10.1016/j.bbrc.2016.03.127. Click
37 Gambogic acid synergistically potentiates cisplatin-induced apoptosis in non-small-cell lung cancer through suppressing NF-κB and MAPK/HO-1 signalling. Br J Cancer. 2014 Jan 21;110(2):341-52. doi: 10.1038/bjc.2013.752. Click
38 Gambogic acid sensitizes breast cancer cells to TRAIL-induced apoptosis by promoting the crosstalk of extrinsic and intrinsic apoptotic signalings. Food Chem Toxicol. 2018 Sep;119:334-341. doi: 10.1016/j.fct.2018.02.037. Click
39 Suppression of NF-κB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103. doi: 10.2174/1568009613666131113100634. Click
40 Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. Click
41 Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib. Click
42 Combined Application of Salinomycin and ATRA Induces Apoptosis and Differentiation of Acute Myeloid Leukemia Cells by Inhibiting WNT/β-Catenin Pathway. Anticancer Agents Med Chem. 2023;23(9):1074-1084. doi: 10.2174/1871520623666230110121629. Click
43 The effect of brassinolide, a plant steroid hormone, on drug resistant small-cell lung carcinoma cells. Biochem Biophys Res Commun. 2017 Nov 4;493(1):783-787. doi: 10.1016/j.bbrc.2017.08.094. Click
44 Arachidin-1, a Prenylated Stilbenoid from Peanut, Enhances the Anticancer Effects of Paclitaxel in Triple-Negative Breast Cancer Cells. Cancers (Basel). 2023;15(2):399. Published 2023 Jan 7. doi:10.3390/cancers15020399 Click
45 First evidence that γ-tocotrienol inhibits the growth of human gastric cancer and chemosensitizes it to capecitabine in a xenograft mouse model through the modulation of NF-κB pathway. Clin Cancer Res. 2012 Apr 15;18(8):2220-9. doi: 10.1158/1078-0432.CCR-11-2470. Click
46 γ-Tocotrienol suppresses growth and sensitises human colorectal tumours to capecitabine in a nude mouse xenograft model by down-regulating multiple molecules. Br J Cancer. 2016 Sep 27;115(7):814-24. doi: 10.1038/bjc.2016.257. Click
47 γ-tocotrienol enhances the chemosensitivity of human oral cancer cells to docetaxel through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 Click
48 Phenethyl isothiocyanate in combination with dibenzoylmethane inhibits the androgen-independent growth of prostate cancer cells. Food Funct. 2018 Apr 25;9(4):2398-2408. doi: 10.1039/c7fo01983a. Click
49 Noscapine Increases the Sensitivity of Drug-Resistant Ovarian Cancer Cell Line SKOV3/DDP to Cisplatin by Regulating Cell Cycle and Activating Apoptotic Pathways. Cell Biochem Biophys. 2015 May;72(1):203-13. doi: 10.1007/s12013-014-0438-y. Click
50 Anticancer activity of Noscapine, an opioid alkaloid in combination with Cisplatin in human non-small cell lung cancer. Lung Cancer. 2011 Mar;71(3):271-82. doi: 10.1016/j.lungcan.2010.06.002. Click
51 Enhanced anticancer activity of gemcitabine in combination with noscapine via antiangiogenic and apoptotic pathway against non-small cell lung cancer. PLoS One. 2011;6(11):e27394. doi: 10.1371/journal.pone.0027394. Click
52 Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells. Biomed Pharmacother. 2023 Jan;157:114039. doi: 10.1016/j.biopha.2022.114039. Click
53 Combination of the natural compound Periplocin and TRAIL induce esophageal squamous cell carcinoma apoptosis in vitro and in vivo: Implication in anticancer therapy. J Exp Clin Cancer Res. 2019 Dec 21;38(1):501. doi: 10.1186/s13046-019-1498-z. Click
54 Shogaol overcomes TRAIL resistance in colon cancer cells via inhibiting of survivin. Tumour Biol. 2015 Nov;36(11):8819-29. doi: 10.1007/s13277-015-3629-2. Click
55 Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol. Cancer Lett. 2013 Jan 28;328(2):285-96. doi: 10.1016/j.canlet.2012.10.003. Click
It has been 419390 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP