Name | Tumor necrosis factor receptor superfamily member 10B | ||
UniProt ID | TR10B_HUMAN | ||
Gene Name | TNFRSF10B | ||
Gene ID | 8795 | ||
Synonyms |
TNFRSF10B, CD262, DR5, KILLER, KILLER/DR5, TRAIL-R2, TRAILR2, TRICK2, TRICK2A, TRICK2B, TRICKB, ZTNFR9
|
||
Sequence |
MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQD
LAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCD SGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH KESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKV LPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRK LGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED HLLSSGKFMYLEGNADSAMS |
||
Pathway Map | MAP LINK | ||
T.C. Number | 2.A.3.10.8; 3.A.1.205.1; 3.A.1.205.24; 3.A.1.205.32 | ||
KEGG ID | hsa8795 | ||
TTD ID | T70067 | ||
Pfam | PF00020; PF00531; PF10099 |
Pair Name | Morusin, TNF-related apoptosis inducing ligand | |||
Phytochemical Name | Morusin | |||
Anticancer drug Name | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | These results suggest that morusin enhances TRAIL sensitivity in human glioblastoma cells through regulating expression of DR5 and EGFR. Therefore, the combination treatment of TRAIL and morusin may be a new therapeutic strategy for malignant glioma patients. |
Pair Name | 20(s)-ginsenoside Rh2, TNF-related apoptosis inducing ligand | |||
Phytochemical | 20(s)-ginsenoside Rh2 | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Our study indicates that Rh2 may act as a sensitizer in combination with TRAIL to increase the efficacy of its anti-tumor activity. |
Pair Name | Apigenin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Apigenin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A90] | Anaplastic large cell lymphoma | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Apigenin breaks TRAIL resistance in HTLV-1-associated ATL by transcriptional down-regulation of c-FLIP, a key inhibitor of death receptor signaling, and by up-regulation of TRAIL receptor 2 (TRAIL-R2) |
Pair Name | Apigenin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Apigenin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Apigenin enhances TRAIL-induced antitumor activity in NSCLC cells by APG via inhibition of the NF-kappaB, AKT and ERK prosurvival regulators |
Pair Name | Apigenin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Apigenin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Sub-toxic dose of apigenin sensitizes HepG2 cells to TRAIL through ERK-dependent up-regulation of TRAIL receptor DR5 |
Pair Name | Bakuchiol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Bakuchiol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | The collective results suggest that bakuchiol facilitates TRAIL-induced apoptosis in colon cancer cells through up-regulation of the TRAIL receptors; DR4 and DR5 via ROS/JNK pathway signals. |
Pair Name | Beta-Elemene, TNF-related apoptosis inducing ligand | |||
Phytochemical | Beta-Elemene | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Our results suggest that β-elemene increases the sensitivity of gastric cancer cells to TRAIL partially by promoting the formation of DISC in lipid rafts. |
Pair Name | Bufalin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Bufalin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Bufalin enhanced TRAIL-induced apoptosis by up-regulating the expression of DR4 and DR5. Bufalin-induced down-regulation of Cbl-b contributed to the up-regulation of DR4 and DR5, which might be partially mediated by the activation of ERK, JNK and p38 MAPK. |
Pair Name | Butein, TNF-related apoptosis inducing ligand | |||
Phytochemical | Butein | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Our data suggests that combined treatment with butein and TRAIL may provide a safe and effective strategy for treating cancer. |
Pair Name | Cantharidin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Cantharidin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | The results of the present study revealed that cantharidin effectively sensitized cells to TRAIL‑mediated apoptosis and its effects are likely to be mediated by autophagy, the downregulation of c‑FLIP and the upregulation of DR‑5. |
Pair Name | Capsaicin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Capsaicin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | A combined regimen using capsaicin and TRAIL may provide a safe and effective strategy for treating malignant gliomas. |
Pair Name | Casticin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Casticin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Casticin enhances TRAIL-induced apoptosis through the downregulation of cell survival proteins and the upregulation of DR5 receptors through actions on the ROS-ER stress-CHOP pathway. |
Pair Name | Chrysin, Cisplatin | |||
Phytochemical | Chrysin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Our results suggest that combination of chrysin and cisplatin is a promising strategy for chemotherapy of human cancers that are resistant to cisplatin. |
Pair Name | Curcumin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Curcumin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C17] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | The present study demonstrates the potential of using curcumin in combination with TRAIL to yield better TRAIL therapy outcomes in TRAIL-resistant CCA. |
Pair Name | Decursin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Decursin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | ROS generation by decursin selectively activated the PERK/ATF4 axis of the endoplasmic reticulum stress signalling pathway, leading to enhanced TRAIL sensitivity in TRAIL-resistant NSCLC cell lines, partly via up-regulation of DR5. |
Pair Name | Epigallocatechin gallate, TNF-related apoptosis inducing ligand | |||
Phytochemical | Epigallocatechin gallate | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Activation of autophagic flux by epigallocatechin gallate mitigates TRAIL-induced tumor cell apoptosis via down-regulation of death receptors |
Pair Name | Fisetin, Sorafenib | |||
Phytochemical | Fisetin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | The combination of fisetin and sorafenib exerted better synergistic effects in vitro and in vivo than either agent used alone against human cervical cancer, and this synergism was based on apoptotic potential through a mitochondrial- and DR5-dependent caspase-8/caspase-3 signaling pathway |
Pair Name | Gomisin N, TNF-related apoptosis inducing ligand | |||
Phytochemical | Gomisin N | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Our results indicated that gomisin N was able to potentiate TRAIL-induced apoptosis through ROS-mediated up-regulation of DR4 and DR5. |
Pair Name | Homoharringtonine, Suberoylanilide hydroxamic acid (SAHA) | |||
Phytochemical | Homoharringtonine | |||
Drug | Suberoylanilide hydroxamic acid (SAHA) | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | The synergistic effect between HHT and SAHA was blocked partially using a specific anti‑TRAIL antibody. The combination therapy was also found to significantly inhibit the growth of leukemia xenografts in vivo with enhanced apoptosis. These results indicate that, by regulating the induction of TRAIL and activation of the TRAIL apoptotic pathway, it is possible to administer HHT at low concentrations in combination with SAHA as an effective therapeutic approach for the treatment of AML. |
Pair Name | Irigenin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Irigenin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Our present study gave new insights into the effects of Iri on potentiating TRAIL-sensitivity, and suggested that Iri could be a potential candidate for sensitizer of TRAIL-resistant cancer cell treatment. |
Pair Name | Isoliquiritigenin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Isoliquiritigenin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Isoliquiritigenin has the potential to overcome resistance to TRAIL in cancer cells and its chemopreventive effects may depend on TRAIL function |
Pair Name | Isoquercitrin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Isoquercitrin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | We found that isoquercitrin enhances the mRNA expression of TRAIL-Rs, but the percentage of apoptosis was meager, possibly due to the influence of other anti-apoptotic proteins. |
Pair Name | Kaempferol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Kaempferol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A20.1] | Chronic myelogenous leukemia | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | It is reasonable to conclude that sensitization of chronic leukemia cells to TRAIL by kaempferol in vitro should be considered as a way of focusing clinical attention on leukemia therapy. |
Pair Name | Kaempferol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Kaempferol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | The co-treatment induced no apoptosis in normal human peripheral blood mononuclear cells and little apoptosis in normal human hepatocytes. These results suggest that kaempferol is useful for TRAIL-based treatments for cancer. |
Pair Name | Licochalcone B, TNF-related apoptosis inducing ligand | |||
Phytochemical | Licochalcone B | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC. |
Pair Name | Liquiritin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Liquiritin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation |
Pair Name | Luteolin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Luteolin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | TRAIL combined with luteolin could be as an effective chemotherapeutic strategy for NSCLC. |
Pair Name | Medicarpin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Medicarpin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B33.1] | Myeloid leukemia | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway |
Pair Name | Morin, Auranofin | |||
Phytochemical | Morin | |||
Drug | Auranofin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | This study provides evidence that morin can enhance the anticancer activity of AF in Hep3B human hepatocellular carcinoma cells, indicating that its combination could be an alternative treatment strategy for the hepatocellular carcinoma. |
Pair Name | Naringenin, AMG-951 | |||
Phytochemical | Naringenin | |||
Drug | AMG-951 | |||
Disease Info | [ICD-11: 2F7Z] | Glioma | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | The present study provides a novel therapeutic strategy for glioma by potentiating APO2L-induced apoptosis via the combination with NG in glioma tumor cells. |
Pair Name | Neobavaisoflavone, TNF-related apoptosis inducing ligand | |||
Phytochemical | Neobavaisoflavone | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2F7Z] | Glioma | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Taken together, our results suggest that NBIF reduces the resistance of cancer cells to TRAIL and that the combination of NBIF and TRAIL may be a new therapeutic strategy for treating TRAIL-resistant glioma cells. |
Pair Name | Nimbolide, Tumor necrosis factor-alpha | |||
Phytochemical | Nimbolide | |||
Drug | Tumor necrosis factor-alpha | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Our findings overall indicate that nimbolide may enhance TNF-α-mediated cellular proliferation inhibition through increasing cell apoptosis of HT-29 cells by up-reglation of DR5 expression via the JNK pathway. |
Pair Name | Oleuropein, Cisplatin | |||
Phytochemical | Oleuropein | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | These data revealed that oleuropein regulated the expression of the above-mentioned miRNAs in ovarian cancer cells, which potentially resulted in apoptosis induction, cell proliferation inhibition, and cisplatin resistance decline in ovarian cancer cells. To confirm the results of this study, it is suggested that similar experiments be performed in animal models of ovarian cancer. |
Pair Name | Periplocin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Periplocin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway |
Pair Name | Periplocin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Periplocin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B70.1] | Esophageal squamous cell carcinoma | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Our data suggest that CPP and TRAIL could be further explored as potential therapeutic approach for esophageal cancer. |
Pair Name | Plumbagin, rsTRAIL | |||
Phytochemical | Plumbagin | |||
Drug | rsTRAIL | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Our results suggest that both plumbagin and rsTRAIL could be used as a single agent or synergistical agents to induce apoptosis of leukemic Kasumi‑1 cells in vitro and in vivo. |
Pair Name | Pterostilbene, TNF-related apoptosis inducing ligand | |||
Phytochemical | Pterostilbene | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Pterostilbene enhances TRAIL-induced apoptosis through the induction of death receptors and downregulation of cell survival proteins in TRAIL-resistance triple negative breast cancer cells |
Pair Name | Shogaol, Gefitinib | |||
Phytochemical | Shogaol | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C73] | Ovarian Cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Our results suggest that 6-shogaol exerts a potential anti-cancer effect in ovarian cancer and combination treatment with 6-shogaol and gefitinib may provide a novel anti-tumor therapeutic strategy in gefitinib-resistant ovarian cancer. |
Pair Name | Tanshinone IIA, TNF-related apoptosis inducing ligand | |||
Phytochemical | Tanshinone IIA | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | T-IIA increases TRAIL-induced apoptosis by downregulating STAT3 and upregulating DR4 and DR5, indicating T-IIA therapy as a novel treatment strategy for TRAIL-resistant GBM. |
Pair Name | Thymoquinone, TNF-related apoptosis inducing ligand | |||
Phytochemical | Thymoquinone | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | The synergistic influence between TQ which induced the DR5 and TRAIL, facilitating the connection between TRAIL and its receptors on the cancerous cell membrane. Hence, the proposed combination therapy induced the ROS-mediated apoptotic stimulus. |
Pair Name | Zerumbone, Celecoxib | |||
Phytochemical | Zerumbone | |||
Drug | Celecoxib | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | Our results provide novel insights into the role of ATF3 as an essential transcription factor for p53-independent DR5 induction upon both ZER and CCB treatment, and this may be a useful biomarker for TRAIL-based anticancer therapy. |
Pair Name | Shogaol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Shogaol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Tumor necrosis factor receptor superfamily member 10B | Expression | |
Result | This study gives rise to the possibility of applying shogaol as an antitumor agent that can be used for the purpose of combination treatment with TRAIL in TRAIL-resistant colon tumor therapy. |
No. | Title | Href |
---|---|---|
1 | Morusin Induces TRAIL Sensitization by Regulating EGFR and DR5 in Human Glioblastoma Cells. J Nat Prod. 2016 Feb 26;79(2):317-23. doi: 10.1021/acs.jnatprod.5b00919. | Click |
2 | 20(s)-ginsenoside Rh2 promotes TRAIL-induced apoptosis by upregulating DR5 in human hepatocellular carcinoma cells. Med Oncol. 2022 May 15;39(5):70. doi: 10.1007/s12032-022-01663-6. | Click |
3 | Wogonin and related natural flavones overcome tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) protein resistance of tumors by down-regulation of c-FLIP protein and up-regulation of TRAIL receptor 2 expression. J Biol Chem. 2012 Jan 2;287(1):641-649. doi: 10.1074/jbc.M111.286526. | Click |
4 | Apigenin potentiates TRAIL therapy of non-small cell lung cancer via upregulating DR4/DR5 expression in a p53-dependent manner. Sci Rep. 2016 Oct 18;6:35468. doi: 10.1038/srep35468. | Click |
5 | Sub-toxic dose of apigenin sensitizes HepG2 cells to TRAIL through ERK-dependent up-regulation of TRAIL receptor DR5. Mol Cells. 2013 Jan;35(1):32-40. doi: 10.1007/s10059-013-2175-2. | Click |
6 | Bakuchiol sensitizes cancer cells to TRAIL through ROS- and JNK-mediated upregulation of death receptors and downregulation of survival proteins. Biochem Biophys Res Commun. 2016 Apr 29;473(2):586-92. doi: 10.1016/j.bbrc.2016.03.127. | Click |
7 | β-elemene increases the sensitivity of gastric cancer cells to TRAIL by promoting the formation of DISC in lipid rafts. Cell Biol Int. 2018 Sep;42(10):1377-1385. doi: 10.1002/cbin.11023. | Click |
8 | Down-regulation of Cbl-b by bufalin results in up-regulation of DR4/DR5 and sensitization of TRAIL-induced apoptosis in breast cancer cells. J Cancer Res Clin Oncol. 2012 Aug;138(8):1279-89. doi: 10.1007/s00432-012-1204-4. | Click |
9 | Butein sensitizes human leukemia cells to apoptosis induced by tumor necrosis factor-related apoptosis inducing ligand (TRAIL). Arch Pharm Res. 2008 Sep;31(9):1179-86. doi: 10.1007/s12272-001-1286-2. | Click |
10 | Downregulation of c‑FLIP and upregulation of DR‑5 by cantharidin sensitizes TRAIL‑mediated apoptosis in prostate cancer cells via autophagy flux. Int J Mol Med. 2020 Jul;46(1):280-288. doi: 10.3892/ijmm.2020.4566. | Click |
11 | Capsaicin sensitizes malignant glioma cells to TRAIL-mediated apoptosis via DR5 upregulation and survivin downregulation. Carcinogenesis. 2010 Mar;31(3):367-75. doi: 10.1093/carcin/bgp298. | Click |
12 | Casticin potentiates TRAIL-induced apoptosis of gastric cancer cells through endoplasmic reticulum stress. PLoS One. 2013;8(3):e58855. doi: 10.1371/journal.pone.0058855. | Click |
13 | Combination of chrysin and cisplatin promotes the apoptosis of Hep G2 cells by up-regulating p53. Chem Biol Interact. 2015 May 5;232:12-20. doi: 10.1016/j.cbi.2015.03.003. | Click |
14 | Potentiation of TRAIL-Induced Apoptosis in TRAIL-Resistant Cholangiocarcinoma Cells by Curcumin through the Induction of DR5 Membrane Localization and Disruption of the Anti-Apoptotic Complex DR5/DDX3/GSK3β. Asian Pac J Cancer Prev. 2023 Feb 1;24(2):425-434. doi: 10.31557/APJCP.2023.24.2.425. | Click |
15 | Decursin enhances TRAIL-induced apoptosis through oxidative stress mediated- endoplasmic reticulum stress signalling in non-small cell lung cancers. Br J Pharmacol. 2016 Mar;173(6):1033-44. doi: 10.1111/bph.13408. | Click |
16 | Activation of autophagic flux by epigallocatechin gallate mitigates TRAIL-induced tumor cell apoptosis via down-regulation of death receptors. Oncotarget. 2016 Oct 4;7(40):65660-65668. doi: 10.18632/oncotarget.11597. | Click |
17 | Synergistic effect of fisetin combined with sorafenib in human cervical cancer HeLa cells through activation of death receptor-5 mediated caspase-8/caspase-3 and the mitochondria-dependent apoptotic pathway. Tumour Biol. 2016 May;37(5):6987-96. doi: 10.1007/s13277-015-4526-4. | Click |
18 | Gomisin N enhances TRAIL-induced apoptosis via reactive oxygen species-mediated up-regulation of death receptors 4 and 5. Int J Oncol. 2012 Apr;40(4):1058-65. doi: 10.3892/ijo.2011.1299. | Click |
19 | Homoharringtonine and SAHA synergistically enhance apoptosis in human acute myeloid leukemia cells through upregulation of TRAIL and death receptors. Mol Med Rep. 2013 Jun;7(6):1838-44. doi: 10.3892/mmr.2013.1440. | Click |
20 | Irigenin sensitizes TRAIL-induced apoptosis via enhancing pro-apoptotic molecules in gastric cancer cells. Biochem Biophys Res Commun. 2018 Feb 12;496(3):998-1005. doi: 10.1016/j.bbrc.2018.01.003. | Click |
21 | Combination of isoliquiritigenin and tumor necrosis factor-related apoptosis-inducing ligand induces apoptosis in colon cancer HT29 cells. Environ Health Prev Med. 2008 Sep;13(5):281-7. doi: 10.1007/s12199-008-0041-1. | Click |
22 | Effects of A.marina-Derived Isoquercitrin on TNF-Related Apoptosis-Inducing Ligand Receptor (TRAIL-R) Expression and Apoptosis Induction in Cervical Cancer Cells. Appl Biochem Biotechnol. 2017 Jun;182(2):697-707. doi: 10.1007/s12010-016-2355-6. | Click |
23 | Kaempferol sensitizes tumor necrosis factor-related apoptosis-inducing ligand-resistance chronic myelogenous leukemia cells to apoptosis. Mol Biol Rep. 2022 Jan;49(1):19-29. doi: 10.1007/s11033-021-06778-z. | Click |
24 | Kaempferol sensitizes colon cancer cells to TRAIL-induced apoptosis. Biochem Biophys Res Commun. 2008 Oct 10;375(1):129-33. doi: 10.1016/j.bbrc.2008.07.131. | Click |
25 | Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. | Click |
26 | Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation. Biomed Pharmacother. 2017 Sep;93:948-960. doi: 10.1016/j.biopha.2017.06.095. | Click |
27 | Luteolin enhances TRAIL sensitivity in non-small cell lung cancer cells through increasing DR5 expression and Drp1-mediated mitochondrial fission. Arch Biochem Biophys. 2020 Oct 15;692:108539. doi: 10.1016/j.abb.2020.108539. | Click |
28 | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. | Click |
29 | Morin enhances auranofin anticancer activity by up-regulation of DR4 and DR5 and modulation of Bcl-2 through reactive oxygen species generation in Hep3B human hepatocellular carcinoma cells. Phytother Res. 2019 May;33(5):1384-1393. doi: 10.1002/ptr.6329. | Click |
30 | Glioma progression is suppressed by Naringenin and APO2L combination therapy via the activation of apoptosis in vitro and in vivo. Invest New Drugs. 2020 Dec;38(6):1743-1754. doi: 10.1007/s10637-020-00979-2. | Click |
31 | Neobavaisoflavone sensitizes apoptosis via the inhibition of metastasis in TRAIL-resistant human glioma U373MG cells. Life Sci. 2014 Jan 30;95(2):101-7. doi: 10.1016/j.lfs.2013.10.035. | Click |
32 | Combination of Nimbolide and TNF-α-Increases Human Colon Adenocarcinoma Cell Death through JNK-mediated DR5 Up- regulation. Asian Pac J Cancer Prev. 2016;17(5):2637-41. | Click |
33 | Oleuropein reduces cisplatin resistance in ovarian cancer by targeting apoptotic pathway regulators. Life Sci. 2021 Aug 1;278:119525. doi: 10.1016/j.lfs.2021.119525. | Click |
34 | Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway. Mol Carcinog. 2019 Jun;58(6):1033-1045. doi: 10.1002/mc.22991. | Click |
35 | Combination of the natural compound Periplocin and TRAIL induce esophageal squamous cell carcinoma apoptosis in vitro and in vivo: Implication in anticancer therapy. J Exp Clin Cancer Res. 2019 Dec 21;38(1):501. doi: 10.1186/s13046-019-1498-z. | Click |
36 | Plumbagin enhances TRAIL-induced apoptosis of human leukemic Kasumi‑1 cells through upregulation of TRAIL death receptor expression, activation of caspase-8 and inhibition of cFLIP. Oncol Rep. 2017;37(6):3423-3432. doi:10.3892/or.2017.5627 | Click |
37 | Pterostilbene Enhances TRAIL-Induced Apoptosis through the Induction of Death Receptors and Downregulation of Cell Survival Proteins in TRAIL-Resistance Triple Negative Breast Cancer Cells. J Agric Food Chem. 2017 Dec 27;65(51):11179-11191. doi: 10.1021/acs.jafc.7b02358. | Click |
38 | 6-Shogaol Overcomes Gefitinib Resistance via ER Stress in Ovarian Cancer Cells. Int J Mol Sci. 2023 Jan 30;24(3):2639. doi: 10.3390/ijms24032639. | Click |
39 | Tanshinone IIA sensitizes TRAIL-induced apoptosis in glioblastoma through inducing the expression of death receptors (and suppressing STAT3 activation). Brain Res. 2021 Sep 1;1766:147515. doi: 10.1016/j.brainres.2021.147515. | Click |
40 | Thymoquinone Crosstalks with DR5 to Sensitize TRAIL Resistance and Stimulate ROS-Mediated Cancer Apoptosis. Asian Pac J Cancer Prev. 2021 Sep 1;22(9):2855-2865. doi: 10.31557/APJCP.2021.22.9.2855. | Click |
41 | Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib. J Biol Chem. 2014 Aug 1;289(31):21544-61. doi: 10.1074/jbc.M114.558890. | Click |
42 | Shogaol overcomes TRAIL resistance in colon cancer cells via inhibiting of survivin. Tumour Biol. 2015 Nov;36(11):8819-29. doi: 10.1007/s13277-015-3629-2. | Click |