TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Mitogen-activated protein kinase 14
UniProt ID MK14_HUMAN
Gene Name MAPK14
Gene ID 1432
Synonyms
MAPK14, CSBP, CSBP1, CSBP2, CSPB1, EXIP, Mxi2, PRKM14, PRKM15, RK, SAPK2A, p38, p38ALPHA
Sequence
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Pathway Map MAP LINK
T.C. Number 8.A.216.1.1
KEGG ID hsa1432
TTD ID T65864
Pfam PF00069; PF01636; PF03109; PF06293; PF07714; PF13450
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 1004
Pair Name Artesunate, Fluorouracil
Phytochemical Name Artesunate
Anticancer drug Name Fluorouracil
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Our findings point to the crucial treatment effect of Arte on inflammation, intestinal cell senescence, and CRC cell proliferation and offer a new option for CRC treatment.
Combination Pair ID: 505
Pair Name Magnoflorine, Doxorubicin
Phytochemical Name Magnoflorine
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Magnoflorine improves sensitivity to doxorubicin (DOX) of breast cancer cells via inducing apoptosis and autophagy through AKT/mTOR and p38 signaling pathways
Combination Pair ID: 443
Pair Name Paeonol, Epirubicin
Phytochemical Name Paeonol
Anticancer drug Name Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 14 Expression
Result These findings suggest that combination of Paeonol and Epirubicin is potentially applicable for breast cancer treatment.
Combination Pair ID: 373
Pair Name Resveratrol, Cisplatin
Phytochemical Name Resveratrol
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Expression
Result Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest
Combination Pair ID: 79
Pair Name Rutin, Oxaliplatin
Phytochemical Name Rutin
Anticancer drug Name Oxaliplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin
Combination Pair ID: 356
Pair Name Withaferin A, Oxaliplatin
Phytochemical Name Withaferin A
Anticancer drug Name Oxaliplatin
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result These results support the notion that combination treatment with oxaliplatin and WA could facilitate development of an effective strategy for PC treatment.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 32
Pair Name (S)-10-Hydroxycamptothecin, Crizotinib
Phytochemical (S)-10-Hydroxycamptothecin
Drug Crizotinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells
Combination Pair ID: 426
Pair Name Acteoside, Temozolomide
Phytochemical Acteoside
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result It was also determined that TMZ + acteoside induced apoptosis and autophagy through the mitogen‑activated protein kinase signaling pathway. These findings suggest that acteoside has beneficial effects on TMZ‑based glioblastoma therapy.
Combination Pair ID: 239
Pair Name Alantolactone, Oxaliplatin
Phytochemical Alantolactone
Drug Oxaliplatin
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result These results suggest that the combination treatment with ALT and oxaliplatin may become a potential therapeutic strategy for colon cancer.
Combination Pair ID: 674
Pair Name Artesunate, Cisplatin
Phytochemical Artesunate
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result ART exhibited significant anti-tumor effect on A549 cells and this efficiency could be enhanced by combination with CIS
Combination Pair ID: 987
Pair Name Baicalein, Cisplatin
Phytochemical Baicalein
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Treatment with baicalein improved the sensitivity of ovarian cancer cells to cisplatin and inhibited cell proliferation, metastasis and tumor growth
Combination Pair ID: 972
Pair Name Berbamine, Cisplatin
Phytochemical Berbamine
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result These findings indicate that Ber might be a promising adjuvant for enhancing the cancer cell killing effect of chemotherapy via the inhibition of autophagy. In this process, Nox2 might be a significant mediator of Ber-induced aberrant lysosomal acidification.
Combination Pair ID: 30
Pair Name Berbamine, Sorafenib
Phytochemical Berbamine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Targeting Na+/K+-ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma
Combination Pair ID: 602
Pair Name Berberine, Cisplatin
Phytochemical Berberine
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway
Combination Pair ID: 788
Pair Name Bufalin, TNF-related apoptosis inducing ligand
Phytochemical Bufalin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Expression
Result Bufalin enhanced TRAIL-induced apoptosis by up-regulating the expression of DR4 and DR5. Bufalin-induced down-regulation of Cbl-b contributed to the up-regulation of DR4 and DR5, which might be partially mediated by the activation of ERK, JNK and p38 MAPK.
Combination Pair ID: 495
Pair Name Chebulagic acid, Doxorubicin
Phytochemical Chebulagic acid
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 14 Activity
Result The present study shows the efficacy of CA to overcome MDR-1 mediated drug resistance in HepG2 cells through COX-2 dependant modulation of MDR-1.
Combination Pair ID: 231
Pair Name Costunolide, Doxorubicin
Phytochemical Costunolide
Drug Doxorubicin
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result We suggested that costunolide in combination with doxorubicin was a new potential chemotherapeutic strategy for treating prostate cancer.
Combination Pair ID: 590
Pair Name Delta-Tocotrienol, Cisplatin
Phytochemical Delta-Tocotrienol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis
Combination Pair ID: 166
Pair Name Dihydroartemisinin, Oxaliplatin
Phytochemical Dihydroartemisinin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Expression
Result We demonstrated an improved therapeutic strategy for CRC patients by combining DHA and oxaliplatin treatments.
Combination Pair ID: 47
Pair Name Dihydroberberine, Sunitinib
Phytochemical Dihydroberberine
Drug Sunitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result DCS induced the expression of cell cycle signal molecules that are known to be affected by JNK and p38. The change of cell cycle, in turn, led to down-regulation of JNK and p38, and further reduced IL-1 secretion. Collectively, these findings highlight potential molecular mechanisms of DCS chemotherapeutic activity and suggest that DCS is an efficacious strategy in NSCLC therapy.
Combination Pair ID: 129
Pair Name Licochalcone B, TNF-related apoptosis inducing ligand
Phytochemical Licochalcone B
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC.
Combination Pair ID: 347
Pair Name Matairesinol, Fluorouracil
Phytochemical Matairesinol
Drug Fluorouracil
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Matairesinol Induces Mitochondrial Dysfunction and Exerts Synergistic Anticancer Effects with 5-Fluorouracil in Pancreatic Cancer Cells
Combination Pair ID: 119
Pair Name Morin Hydrate, Cisplatin
Phytochemical Morin Hydrate
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Our findings indicate that CP-Mh in combination served as a prominent regulator of autophagy and significant inducer of apoptosis that maintains a homeostatic balance towards HepG2 cells and the subcutaneous tumor model.
Combination Pair ID: 361
Pair Name Oleandrin, Cisplatin
Phytochemical Oleandrin
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Activity
Result The combination of oleandrin with cisplatin exerts a synergistic antitumor effect in osteosarcoma, which relates to the activation of the p38 MAPK pathway.
Combination Pair ID: 181
Pair Name Oridonin, Fluorouracil
Phytochemical Oridonin
Drug Fluorouracil
Disease Info [ICD-11: 2C90.Z] Renal carcinoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Activity
Result Oridonin enhances the cytotoxicity of 5-FU in renal cancer cells partially through inducing necroptosis, providing evidence of using necroptosis inducers in combination with chemotherapeutic agents for cancer treatment.
Combination Pair ID: 419
Pair Name Piperlongumine, Oxaliplatin
Phytochemical Piperlongumine
Drug Oxaliplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Piperlongumine significantly enhanced oxaliplatin-induced growth inhibition of these cells and that TrxR1 activity is involved in their synergistic effect both in vitro and in vivo. These data suggest that PL and oxaliplatin combination treatment of gastric cancer may be more effective than oxaliplatin alone.
Combination Pair ID: 813
Pair Name Resveratrol, Cisplatin
Phytochemical Resveratrol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Resveratrol Enhances Cytotoxic Effects of Cisplatin by Inducing Cell Cycle Arrest and Apoptosis in Ovarian Adenocarcinoma SKOV-3 Cells through Activating the p38 MAPK and Suppressing AKT
Combination Pair ID: 374
Pair Name Resveratrol, Talazoparib
Phytochemical Resveratrol
Drug Talazoparib
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Expression
Result Resveratrol sensitizes breast cancer to PARP inhibitor, talazoparib through dual inhibition of AKT and autophagy flux
Combination Pair ID: 168
Pair Name Resveratrol, Temozolomide
Phytochemical Resveratrol
Drug Temozolomide
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 14 Activity
Result TMZ in combination with resveratrol remarkably increased reactive oxygen species (ROS) production, which serves as an upstream signal for AMP-activated protein kinase (AMPK) activation. Subsequently, activated AMPK inhibited mTOR signaling and downregulated antiapoptosis protein Bcl-2, which was contributed to the additive antiproliferation effects of combination treatment. In an orthotopic xenograft model of GBM, TMZ plus resveratrol treatment significantly reduced the volume of tumor, which was confirmed by decreased expression of Ki-67, a marker of proliferation index
Combination Pair ID: 99
Pair Name Silibinin, Sorafenib
Phytochemical Silibinin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result These results suggested that silibinin improved the efficacy of sorafenib in HCC therapy, indicating a clinical promising therapeutic strategy for HCC patients.
Combination Pair ID: 575
Pair Name Sulforaphene, Photodynamic therapy
Phytochemical Sulforaphene
Drug Photodynamic therapy
Disease Info [ICD-11: 2D10.Z] Thyroid cancer Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Our work designates sulforaphene as a unique natural enhancer of efficacy with PDT against anaplastic thyroid cancer.
Combination Pair ID: 758
Pair Name Thymoquinone, Temozolomide
Phytochemical Thymoquinone
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Our findings demonstrate that TQ can effectively cross the BBB and function alone or in combination with TMZ to treat glioblastoma.
Combination Pair ID: 436
Pair Name Vanillin, Fluorouracil
Phytochemical Vanillin
Drug Fluorouracil
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Vanillin is deemed to be a promising anticancer candidate by inhibiting NNMT and may attenuate NNMT‑induced resistance to 5‑Fu in human CRC therapy with few side effects.
Combination Pair ID: 538
Pair Name Vitamin C, Methotrexate
Phytochemical Vitamin C
Drug Methotrexate
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result Combined low-dose vitamin C and MTX had synergistic anti-proliferative/cytotoxic effects on TNBC cells. In addition, co-treatment increased H2O2 levels and activated both caspase-3 and p38 cell death pathways.
Combination Pair ID: 652
Pair Name Xanthohumol, Praziquantel
Phytochemical Xanthohumol
Drug Praziquantel
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Mitogen-activated protein kinase 14 Phosphorylation
Result XN administered in combination with PZ could efficiently prevent CCA development and hence provide potential chemopreventive benefits in Ov-induced cholangiocarcinogenesis
Combination Pair ID: 282
Pair Name Xanthorrhizol, Tamoxifen
Phytochemical Xanthorrhizol
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Expression
Result It can be concluded that while there is no significant herb-drug interaction between xanthorrhizol and tamoxifen in vitro, there is such an interaction in tumor-bearing mice, which provides important information that affects breast cancer treatment translational research.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 670
Pair Name Gambogic acid, Cisplatin
Phytochemical Gambogic acid
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Expression
Result Our results demonstrate that GA may be a new potent therapeutic agent useful for targeting human OS cells.
Combination Pair ID: 770
Pair Name Mitocurcumin, Cytarabine
Phytochemical Mitocurcumin
Drug Cytarabine
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Up-regulation Mitogen-activated protein kinase 14 Activity
Result The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis.
03. Reference
No. Title Href
1 Artesunate alleviates 5-fluorouracil-induced intestinal damage by suppressing cellular senescence and enhances its antitumor activity. Discov Oncol. 2023 Jul 27;14(1):139. doi: 10.1007/s12672-023-00747-7. Click
2 Magnoflorine improves sensitivity to doxorubicin (DOX) of breast cancer cells via inducing apoptosis and autophagy through AKT/mTOR and p38 signaling pathways. Biomed Pharmacother. 2020 Jan;121:109139. doi: 10.1016/j.biopha.2019.109139. Click
3 Enhanced antitumor activity and attenuated cardiotoxicity of Epirubicin combined with Paeonol against breast cancer. Tumour Biol. 2016 Sep;37(9):12301-12313. doi: 10.1007/s13277-016-5088-9. Click
4 Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest. Front Pharmacol. 2023;13:1068863. Published 2023 Jan 4. doi:10.3389/fphar.2022.1068863. Click
5 P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin. Biomed Res Int. 2019 Nov 6;2019:6407210. doi: 10.1155/2019/6407210. Click
6 Synergistic antitumor activity of withaferin A combined with oxaliplatin triggers reactive oxygen species-mediated inactivation of the PI3K/AKT pathway in human pancreatic cancer cells. Cancer Lett. 2015 Feb 1;357(1):219-230. doi: 10.1016/j.canlet.2014.11.026. Click
7 Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells. J Enzyme Inhib Med Chem. 2023 Dec;38(1):1-11. doi: 10.1080/14756366.2022.2132487. Click
8 Synergistic anticancer effect of acteoside and temozolomide-based glioblastoma chemotherapy. Int J Mol Med. 2019 Mar;43(3):1478-1486. doi: 10.3892/ijmm.2019.4061. Click
9 Enhancement of oxaliplatin-induced colon cancer cell apoptosis by alantolactone, a natural product inducer of ROS. Int J Biol Sci. 2019 Jun 4;15(8):1676-1684. doi: 10.7150/ijbs.35265. Click
10 Artesunate exhibits synergistic anti-cancer effects with cisplatin on lung cancer A549 cells by inhibiting MAPK pathway. Gene. 2021 Jan 15;766:145134. doi: 10.1016/j.gene.2020.145134. Click
11 Baicalein improves the chemoresistance of ovarian cancer through regulation of CirSLC7A6. J Ovarian Res. 2023 Nov 8;16(1):212. doi: 10.1186/s13048-023-01285-0. Click
12 Berbamine Hydrochloride inhibits lysosomal acidification by activating Nox2 to potentiate chemotherapy-induced apoptosis via the ROS-MAPK pathway in human lung carcinoma cells. Cell Biol Toxicol. 2023 Aug;39(4):1297-1317. doi: 10.1007/s10565-022-09756-8. Click
13 Targeting Na+ /K+ -ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma. Br J Pharmacol. 2021 Nov;178(21):4389-4407. doi: 10.1111/bph.15616. Click
14 Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway. Molecules. 2021 Mar 17;26(6):1666. doi: 10.3390/molecules26061666. Click
15 Down-regulation of Cbl-b by bufalin results in up-regulation of DR4/DR5 and sensitization of TRAIL-induced apoptosis in breast cancer cells. J Cancer Res Clin Oncol. 2012 Aug;138(8):1279-89. doi: 10.1007/s00432-012-1204-4. Click
16 Chebulagic acid synergizes the cytotoxicity of doxorubicin in human hepatocellular carcinoma through COX-2 dependant modulation of MDR-1. Med Chem. 2011 Sep;7(5):432-42. doi: 10.2174/157340611796799087. Click
17 Costunolide enhances doxorubicin-induced apoptosis in prostate cancer cells via activated mitogen-activated protein kinases and generation of reactive oxygen species. Oncotarget. 2017 Nov 21;8(64):107701-107715. doi: 10.18632/oncotarget.22592. Click
18 δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis. Cell Prolif. 2021 Nov;54(11):e13111. doi: 10.1111/cpr.13111. Click
19 Dihydroartemisinin enhances the anti-tumor activity of oxaliplatin in colorectal cancer cells by altering PRDX2-reactive oxygen species-mediated multiple signaling pathways. Phytomedicine. 2022 Apr;98:153932. doi: 10.1016/j.phymed.2022.153932. Click
20 Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178. Click
21 Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. Click
22 Matairesinol Induces Mitochondrial Dysfunction and Exerts Synergistic Anticancer Effects with 5-Fluorouracil in Pancreatic Cancer Cells. Mar Drugs. 2022 Jul 25;20(8):473. doi: 10.3390/md20080473. Click
23 Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253. Click
24 Oleandrin synergizes with cisplatin in human osteosarcoma cells by enhancing cell apoptosis through activation of the p38 MAPK signaling pathway. Cancer Chemother Pharmacol. 2018 Dec;82(6):1009-1020. doi: 10.1007/s00280-018-3692-7. Click
25 Oridonin enhances the cytotoxicity of 5-FU in renal carcinoma cells by inducting necroptotic death. Biomed Pharmacother. 2018 Oct;106:175-182. doi: 10.1016/j.biopha.2018.06.111. Click
26 Piperlongumine potentiates the antitumor efficacy of oxaliplatin through ROS induction in gastric cancer cells. Cell Oncol (Dordr). 2019;42(6):847-860. doi:10.1007/s13402-019-00471-x Click
27 Resveratrol Enhances Cytotoxic Effects of Cisplatin by Inducing Cell Cycle Arrest and Apoptosis in Ovarian Adenocarcinoma SKOV-3 Cells through Activating the p38 MAPK and Suppressing AKT. Pharmaceuticals (Basel). 2023 May 17;16(5):755. doi: 10.3390/ph16050755. Click
28 Resveratrol sensitizes breast cancer to PARP inhibitor, talazoparib through dual inhibition of AKT and autophagy flux. Biochem Pharmacol. 2022 May;199:115024. doi: 10.1016/j.bcp.2022.115024. Click
29 Resveratrol enhances the antitumor effects of temozolomide in glioblastoma via ROS-dependent AMPK-TSC-mTOR signaling pathway. CNS Neurosci Ther. 2012;18(7):536-546. doi:10.1111/j.1755-5949.2012.00319.x Click
30 Combined treatment with sorafenib and silibinin synergistically targets both HCC cells and cancer stem cells by enhanced inhibition of the phosphorylation of STAT3/ERK/AKT. Eur J Pharmacol. 2018 Aug 5;832:39-49. doi: 10.1016/j.ejphar.2018.05.027. Click
31 Sulforaphene Enhances The Efficacy of Photodynamic Therapy In Anaplastic Thyroid Cancer Through Ras/RAF/MEK/ERK Pathway Suppression. J Photochem Photobiol B. 2018 Feb;179:46-53. doi: 10.1016/j.jphotobiol.2017.12.013. Click
32 Thymoquinone induces apoptosis in temozolomide-resistant glioblastoma cells via the p38 mitogen-activated protein kinase signaling pathway. Environ Toxicol. 2023 Jan;38(1):90-100. doi: 10.1002/tox.23664. Click
33 Vanillin downregulates NNMT and attenuates NNMT‑related resistance to 5‑fluorouracil via ROS‑induced cell apoptosis in colorectal cancer cells. Oncol Rep. 2021 Jun;45(6):110. doi: 10.3892/or.2021.8061. Click
34 Combined treatment with vitamin C and methotrexate inhibits triple-negative breast cancer cell growth by increasing H2O2 accumulation and activating caspase-3 and p38 pathways. Oncol Rep. 2017 Apr;37(4):2177-2184. doi: 10.3892/or.2017.5439. Click
35 Antifibrotic effect of xanthohumol in combination with praziquantel is associated with altered redox status and reduced iron accumulation during liver fluke-associated cholangiocarcinogenesis. PeerJ. 2018 Jan 22;6:e4281. doi: 10.7717/peerj.4281. Click
36 In vitro and in vivo effects of xanthorrhizol on human breast cancer MCF-7 cells treated with tamoxifen. J Pharmacol Sci. 2014;125(4):375-85. doi: 10.1254/jphs.14024fp. Click
37 Hypoxia-induced resistance to cisplatin-mediated apoptosis in osteosarcoma cells is reversed by gambogic acid independently of HIF-1α. Mol Cell Biochem. 2016 Sep;420(1-2):1-8. doi: 10.1007/s11010-016-2759-1. Click
38 Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004 Click
It has been 46496 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP