TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Myc proto-oncogene protein
UniProt ID MYC_HUMAN
Gene Name MYC
Gene ID 4609
Synonyms
MYC, MRTL, MYCC, bHLHe39, c-Myc
Sequence
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Pathway Map MAP LINK
T.C. Number 1.A.1.1.1; 1.A.1.11.10; 1.A.1.11.23; 1.A.1.13.5; 1.A.1.15.7
KEGG ID hsa4609
TTD ID T36121
Pfam PF00010; PF01056; PF02344; PF05438
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 1026
Pair Name Lupeol, Enzalutamide
Phytochemical Name Lupeol
Anticancer drug Name Enzalutamide
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Lupeol enhances the pharmacological efficacy of Enzalutamide and reduces the adverse effects. Thus, Lupeol could be a promising adjuvant for improving Enzalutamide-based treatment outcomes and warrant further research.
Combination Pair ID: 508
Pair Name Mahanine, Cisplatin
Phytochemical Name Mahanine
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Our results revealed that mahanine may be a prospective agent to reduce the concentration of cisplatin in adjunct for the treatment of cancer and thereby decreasing its toxicity.
Combination Pair ID: 453
Pair Name Mangiferin, Cisplatin
Phytochemical Name Mangiferin
Anticancer drug Name Cisplatin
Disease Info Nephrotoxicity Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result The study reveals a mechanistic basis of mangiferin action against cisplatin induced nephrotoxicity. Since Mangiferin shows synergistic anticancer activity with cisplatin, it can be considered as a promising drug candidate, to be used in combination with cisplatin.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 518
Pair Name All-trans retinoic acid, Salinomycin
Phytochemical All-trans-retinoic acid
Drug Salinomycin
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result S+RA induced differentiation by β-catenin-inhibition-mediated up-regulation of C/EBPs and PU.1 and suppression of c-Myc. S+RA triggered apoptosis through β-catenin-inhibition-regulated ΔΨm collapse and caspase-3/7 activation. Taken together, our findings may provide novel therapeutic strategies for AML patients by targeting the WNT/β-catenin pathway.
Combination Pair ID: 441
Pair Name alpha-Mangostin, TNF-related apoptosis inducing ligand
Phytochemical alpha-Mangostin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B66.0] Oral squamous cell carcinoma Investigative
Regulate Info Up-regulation Myc proto-oncogene protein Expression
Result Synergism between α-mangostin and TRAIL induces apoptosis in squamous cell carcinoma of the oral cavity through the mitochondrial pathway
Combination Pair ID: 77
Pair Name Apigenin, Gefitinib
Phytochemical Apigenin
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Apigenin Combined With Gefitinib Blocks Autophagy Flux and Induces Apoptotic Cell Death Through Inhibition of HIF-1α, c-Myc, p-EGFR, and Glucose Metabolism in EGFR L858R+T790M-Mutated H1975 Cells
Combination Pair ID: 30
Pair Name Berbamine, Sorafenib
Phytochemical Berbamine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Targeting Na+/K+-ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma
Combination Pair ID: 708
Pair Name Beta-Elemene, Gefitinib
Phytochemical Beta-Elemene
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Myc proto-oncogene protein Expression
Result The findings may have potential implications for treating aggressive and resistant lung cancers.
Combination Pair ID: 679
Pair Name Betulinic Acid, Sorafenib
Phytochemical Betulinic Acid
Drug Sorafenib
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result We showed that combined treatment with low concentrations of sorafenib and betulinic acid had the capacity to inhibit proliferation and abolish clonogenic activity in PDAC cell lines.
Combination Pair ID: 872
Pair Name Biochanin A, Temozolomide
Phytochemical Biochanin A
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Chanin A significantly enhanced the anticancer efficacy of temozolomide in GBM cells.
Combination Pair ID: 562
Pair Name Brassinolid, Doxorubicin
Phytochemical Brassinolid
Drug Doxorubicin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result These data indicate that EB, a natural product with widespread occurrence in plants, is pharmacologically active in both drug-sensitive and drug-resistant SCLC cells and acts through the Wnt signaling pathway.
Combination Pair ID: 937
Pair Name Cordycepin, Temozolomide
Phytochemical Cordycepin
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Cordycepin combined with temozolomide may down-regulate MYC through "MicroRNA in cancer, Proteoglycans in cancer, Pathways in cancer and PI3K-AKT signaling pathway", which in turn regulate the expression of MCL1, CTNNB1, MMP9, PDCD4, thus regulating cell proliferation, migration and apoptosis in glioblastoma.
Combination Pair ID: 39
Pair Name Fangchinoline, Everolimus
Phytochemical Fangchinoline
Drug Everolimus
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Myc proto-oncogene protein Expression
Result Firstly link CHOP to Notch 3/c-MYC axis-dependent apoptosis and provide the Notch 3/c-MYC/CHOP activation as a promising strategy for mTOR-targeted combination therapy in lung cancer treatment.
Combination Pair ID: 929
Pair Name Gamma-Tocotrienol, Capecitabine
Phytochemical Gamma-Tocotrienol
Drug Capecitabine
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Our findings suggest that γ-T3 inhibited the growth of human CRC and sensitised CRC to capecitabine by regulating proteins linked to tumourigenesis.
Combination Pair ID: 928
Pair Name Gamma-Tocotrienol, Gemcitabine
Phytochemical Gamma-Tocotrienol
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Our findings suggest that γ-T3 can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing NF-κB-mediated inflammatory pathways linked to tumorigenesis.
Combination Pair ID: 967
Pair Name Homoharringtonine, ACC010
Phytochemical Homoharringtonine
Drug ACC010
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result ACC010 and HHT cooperatively downregulated MYC and inhibited FLT3 activation. Further, when HHT was added, ACC010-resistant cells demonstrated a good synergy. We also extended our study to the mouse BaF3 cell line with FLT3-inhibitor-resistant FLT3-ITD/tyrosine kinase domain mutations and AML cells without FLT3-ITD. Collectively, our results suggested that the combination treatment of ACC010 and HHT might be a promising strategy for AML patients, especially those carrying FLT3-ITD.
Combination Pair ID: 631
Pair Name Kaempferol, Cisplatin
Phytochemical Kaempferol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Kaempferol enhances cisplatin's effect on ovarian cancer cells through promoting apoptosis caused by down regulation of cMyc
Combination Pair ID: 115
Pair Name Morusin, MAPK pathway inhibitors
Phytochemical Morusin
Drug MAPK pathway inhibitors
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Our results suggested that the combination of morusin and MAPK pathway inhibitors may be a more effective treatment strategy for BRAF-mutant melanoma than MAPK pathway inhibitors alone.
Combination Pair ID: 20
Pair Name Narciclasine, Tamoxifen
Phytochemical Narciclasine
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Our findings successfully highlight the STAT3 as the direct therapeutic target of Nar in ER-positive breast cancer cells, especially, Nar leaded STAT3 degradation as a promising strategy for the tamoxifen-resistant breast cancer treatment.
Combination Pair ID: 1009
Pair Name Oridonin, Venetoclax
Phytochemical Oridonin
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Oridonin and venetoclax synergistically promote AML cell apoptosis by inhibiting AKT signaling.
Combination Pair ID: 370
Pair Name Oxyresveratrol, Dacarbazine
Phytochemical Oxyresveratrol
Drug Dacarbazine
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Myc proto-oncogene protein Expression
Result This combination treatment may serve as a novel therapeutic strategy for treating malignant melanoma.
Combination Pair ID: 961
Pair Name Platycodin D, Cetuximab
Phytochemical Platycodin D
Drug Cetuximab
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Our findings provide a potential strategy to inhibit CRC metastasis during cetuximab therapy by addition of platycodin D.
Combination Pair ID: 78
Pair Name Puerarin, Cisplatin
Phytochemical Puerarin
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Taking these results together, we can draw the conclusion that the PUE enhances the anti-tumor effect of DDP on the drug-resistant A549 cancer in vivo and in vitro through activation of the Wnt signaling pathway.
Combination Pair ID: 668
Pair Name Quercetin, Doxorubicin
Phytochemical Quercetin
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Que could attenuate AC-induced cardiotoxicity by inhibiting ROS accumulation and activating ERK1/2 pathway in cardiomyocytes, but interestingly, Que could enhance the antitumor activity of AC by inhibiting ROS accumulation and ERK1/2 pathway in TNBC cells. In addition,in vivo studies further confirmed that Que could enhance the chemotherapeutic effect of AC against TNBC while it reduced the injury of cardiotoxicity induced by AC
Combination Pair ID: 210
Pair Name Rhizoma Paridis saponins, Sorafenib
Phytochemical Rhizoma Paridis saponins
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result All of that provided possibility to overcome the intolerance of sorafenib by drug compatibility through protection against mitochondria damage, inhibition of anaerobic glycolysis and suppression of lipid synthesis based on PI3K/Akt/mTOR pathway.
Combination Pair ID: 38
Pair Name Rutaecarpine, Fluorouracil
Phytochemical Rutaecarpine
Drug Fluorouracil
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Combined therapy with 5-FU and RUT exerted a superior curative effect in CRC than treatment with either single drug alone and has potential as a novel therapeutic modality for the treatment of CRC.
Combination Pair ID: 287
Pair Name Shikonin, Doxorubicin
Phytochemical Shikonin
Drug Doxorubicin
Disease Info [ICD-11: 2B33.5] Lymphoma Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result These data suggest that shikonin may be an encouraging chemotherapeutic agent in the clinical treatment of BL.
Combination Pair ID: 725
Pair Name Shikonin, Gemcitabine
Phytochemical Shikonin
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Our results suggest that shikonin can suppress the growth of human pancreatic tumors and potentiate the antitumor effects of gemcitabine through the suppression of NF-κB and NF-κB-regulated gene products.
Combination Pair ID: 691
Pair Name Toosendanin, Regorafenib
Phytochemical Toosendanin
Drug Regorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result TSN and RGF combination (TRC) synergistically inhibited the proliferation and migration of MHCC-97L cells. The upregulation of WWOX (WW-domain containing oxidoreductase) played a vital role in the HCC cell growth treated with TRC
Combination Pair ID: 1011
Pair Name Ursolic acid, Doxorubicin
Phytochemical Ursolic acid
Drug Doxorubicin
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result UA may be a novel anticancer strategy and could be considered for investigation as a complementary chemotherapy agent in the future.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 887
Pair Name Berberine, Lapatinib
Phytochemical Berberine
Drug Lapatinib
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Berberine reverses Lapatinib resistance of HER2-positive breast cancer cells by increasing the level of ROS
Combination Pair ID: 931
Pair Name Gamma-Tocotrienol, Simvastatin
Phytochemical Gamma-Tocotrienol
Drug Simvastatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol
Combination Pair ID: 770
Pair Name Mitocurcumin, Cytarabine
Phytochemical Mitocurcumin
Drug Cytarabine
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Down-regulation Myc proto-oncogene protein Expression
Result The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis.
Combination Pair ID: 539
Pair Name Vitamin C, Cisplatin
Phytochemical Vitamin C
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Myc proto-oncogene protein Expression
Result Our findings provide a rationale for combining cisplatin with ascorbate in therapeutic strategies against OS.
03. Reference
No. Title Href
1 Lupeol, an androgen receptor inhibitor, enhances the chemosensitivity of prostate cancer stem cells to antiandrogen enzalutamide-based therapy. Toxicol Appl Pharmacol. 2023 Nov 1;478:116699. doi: 10.1016/j.taap.2023.116699. Click
2 Improved chemosensitivity in cervical cancer to cisplatin: synergistic activity of mahanine through STAT3 inhibition. Cancer Lett. 2014 Aug 28;351(1):81-90. doi: 10.1016/j.canlet.2014.05.005. Click
3 Mangiferin Ameliorates Cisplatin Induced Acute Kidney Injury by Upregulating Nrf-2 via the Activation of PI3K and Exhibits Synergistic Anticancer Activity With Cisplatin. Front Pharmacol. 2018 Jun 18;9:638. doi: 10.3389/fphar.2018.00638. Click
4 Combined Application of Salinomycin and ATRA Induces Apoptosis and Differentiation of Acute Myeloid Leukemia Cells by Inhibiting WNT/β-Catenin Pathway. Anticancer Agents Med Chem. 2023;23(9):1074-1084. doi: 10.2174/1871520623666230110121629. Click
5 Synergism between α-mangostin and TRAIL induces apoptosis in squamous cell carcinoma of the oral cavity through the mitochondrial pathway. Oncol Rep. 2017 Dec;38(6):3439-3446. doi: 10.3892/or.2017.6030. Click
6 Apigenin Combined With Gefitinib Blocks Autophagy Flux and Induces Apoptotic Cell Death Through Inhibition of HIF-1α, c-Myc, p-EGFR, and Glucose Metabolism in EGFR L858R+T790M-Mutated H1975 Cells. Front Pharmacol. 2019 Mar 22;10:260. doi: 10.3389/fphar.2019.00260. Click
7 Targeting Na+ /K+ -ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma. Br J Pharmacol. 2021 Nov;178(21):4389-4407. doi: 10.1111/bph.15616. Click
8 β-Elemene Synergizes With Gefitinib to Inhibit Stem-Like Phenotypes and Progression of Lung Cancer via Down-Regulating EZH2. Front Pharmacol. 2018 Nov 30;9:1413. doi: 10.3389/fphar.2018.01413. Click
9 Sorafenib in Combination with Betulinic Acid Synergistically Induces Cell Cycle Arrest and Inhibits Clonogenic Activity in Pancreatic Ductal Adenocarcinoma Cells. Int J Mol Sci. 2018 Oct 19;19(10):3234. doi: 10.3390/ijms19103234. Click
10 Combination of Biochanin A and Temozolomide Impairs Tumor Growth by Modulating Cell Metabolism in Glioblastoma Multiforme. Anticancer Res. 2019 Jan;39(1):57-66. doi: 10.21873/anticanres.13079. Click
11 The effect of brassinolide, a plant steroid hormone, on drug resistant small-cell lung carcinoma cells. Biochem Biophys Res Commun. 2017 Nov 4;493(1):783-787. doi: 10.1016/j.bbrc.2017.08.094. Click
12 Cordycepin improves sensitivity to temozolomide in glioblastoma cells by down-regulating MYC. J Cancer Res Clin Oncol. 2023 Nov;149(17):16055-16067. doi: 10.1007/s00432-023-05347-0. Click
13 Activation of notch 3/c-MYC/CHOP axis regulates apoptosis and promotes sensitivity of lung cancer cells to mTOR inhibitor everolimus. Biochem Pharmacol. 2020 May;175:113921. doi: 10.1016/j.bcp.2020.113921. Click
14 γ-Tocotrienol suppresses growth and sensitises human colorectal tumours to capecitabine in a nude mouse xenograft model by down-regulating multiple molecules. Br J Cancer. 2016 Sep 27;115(7):814-24. doi: 10.1038/bjc.2016.257. Click
15 {Gamma}-tocotrienol inhibits pancreatic tumors and sensitizes them to gemcitabine treatment by modulating the inflammatory microenvironment. Cancer Res. 2010 Nov 1;70(21):8695-705. doi: 10.1158/0008-5472.CAN-10-2318. Epub 2010 Sep 23. Click
16 ACC010, a novel BRD4 inhibitor, synergized with homoharringtonine in acute myeloid leukemia with FLT3-ITD. Mol Oncol. 2023 Jul;17(7):1402-1418. doi: 10.1002/1878-0261.13368. Click
17 Kaempferol enhances cisplatin's effect on ovarian cancer cells through promoting apoptosis caused by down regulation of cMyc. Cancer Cell Int. 2010 May 11;10:16. doi: 10.1186/1475-2867-10-16. Click
18 Morusin enhances the antitumor activity of MAPK pathway inhibitors in BRAF-mutant melanoma by inhibiting the feedback activation of STAT3. Eur J Cancer. 2022 Apr;165:58-70. doi: 10.1016/j.ejca.2022.01.004. Click
19 Narciclasine targets STAT3 via distinct mechanisms in tamoxifen-resistant breast cancer cells. Mol Ther Oncolytics. 2022 Jan 3;24:340-354. doi: 10.1016/j.omto.2021.12.025. Click
20 Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195. Click
21 Synergistic inhibitory effects of the oxyresveratrol and dacarbazine combination against melanoma cells. Oncol Lett. 2021 Sep;22(3):667. doi: 10.3892/ol.2021.12928. Click
22 Platycodin D represses β-catenin to suppress metastasis of cetuximab-treated KRAS wild-type colorectal cancer cells. Clin Exp Metastasis. 2023 Aug;40(4):339-356. doi: 10.1007/s10585-023-10218-6. Click
23 Puerarin Enhances the Anti-Tumor Effect of Cisplatin on Drug-Resistant A549 Cancer in vivo and in vitro Through Activation of the Wnt Signaling Pathway. Cancer Manag Res. 2020 Jul 24;12:6279-6289. doi: 10.2147/CMAR.S253327. Click
24 Quercetin attenuates the cardiotoxicity of doxorubicin-cyclophosphamide regimen and potentiates its chemotherapeutic effect against triple-negative breast cancer. Phytother Res. 2022;36(1):551-561. doi:10.1002/ptr.7342 Click
25 Combinatorial treatment of Rhizoma Paridis saponins and sorafenib overcomes the intolerance of sorafenib. J Steroid Biochem Mol Biol. 2018 Oct;183:159-166. doi: 10.1016/j.jsbmb.2018.06.010. Click
26 5-Fluorouracil Combined with Rutaecarpine Synergistically Suppresses the Growth of Colon Cancer Cells by Inhibiting STAT3. Drug Des Devel Ther. 2023 Mar 30;17:993-1006. doi: 10.2147/DDDT.S402824. Click
27 Shikonin exerts antitumor activity in Burkitt's lymphoma by inhibiting C-MYC and PI3K/AKT/mTOR pathway and acts synergistically with doxorubicin. Sci Rep. 2018 Feb 20;8(1):3317. doi: 10.1038/s41598-018-21570-z. Click
28 Shikonin suppresses tumor growth and synergizes with gemcitabine in a pancreatic cancer xenograft model: Involvement of NF-κB signaling pathway. Biochem Pharmacol. 2014 Apr 1;88(3):322-33. doi: 10.1016/j.bcp.2014.01.041. Click
29 Synergistic effect of toosendanin and regorafenib against cell proliferation and migration by regulating WWOX signaling pathway in hepatocellular carcinoma. Phytother Res. 2021 Aug;35(8):4567-4578. doi: 10.1002/ptr.7174. Click
30 Inhibition of colorectal cancer tumorigenesis by ursolic acid and doxorubicin is mediated by targeting the Akt signaling pathway and activating the Hippo signaling pathway. Mol Med Rep. 2023 Jan;27(1):11. doi: 10.3892/mmr.2022.12898. Click
31 Berberine reverses Lapatinib resistance of HER2-positive breast cancer cells by increasing the level of ROS. Cancer Biol Ther. 2016;17(9):925-934. doi:10.1080/15384047.2016.1210728 Click
32 Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol. Cancer Lett. 2013 Jan 28;328(2):285-96. doi: 10.1016/j.canlet.2012.10.003. Click
33 Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004 Click
34 Ascorbate sensitizes human osteosarcoma cells to the cytostatic effects of cisplatin. Pharmacol Res Perspect. 2020 Aug;8(4):e00632. doi: 10.1002/prp2.632. Click
It has been 46954 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP