Name | Myc proto-oncogene protein | ||
UniProt ID | MYC_HUMAN | ||
Gene Name | MYC | ||
Gene ID | 4609 | ||
Synonyms |
MYC, MRTL, MYCC, bHLHe39, c-Myc
|
||
Sequence |
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA |
||
Pathway Map | MAP LINK | ||
T.C. Number | 1.A.1.1.1; 1.A.1.11.10; 1.A.1.11.23; 1.A.1.13.5; 1.A.1.15.7 | ||
KEGG ID | hsa4609 | ||
TTD ID | T36121 | ||
Pfam | PF00010; PF01056; PF02344; PF05438 |
Pair Name | Lupeol, Enzalutamide | |||
Phytochemical Name | Lupeol | |||
Anticancer drug Name | Enzalutamide | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Lupeol enhances the pharmacological efficacy of Enzalutamide and reduces the adverse effects. Thus, Lupeol could be a promising adjuvant for improving Enzalutamide-based treatment outcomes and warrant further research. |
Pair Name | Mahanine, Cisplatin | |||
Phytochemical Name | Mahanine | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Our results revealed that mahanine may be a prospective agent to reduce the concentration of cisplatin in adjunct for the treatment of cancer and thereby decreasing its toxicity. |
Pair Name | Mangiferin, Cisplatin | |||
Phytochemical Name | Mangiferin | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | Nephrotoxicity | Investigative | ||
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | The study reveals a mechanistic basis of mangiferin action against cisplatin induced nephrotoxicity. Since Mangiferin shows synergistic anticancer activity with cisplatin, it can be considered as a promising drug candidate, to be used in combination with cisplatin. |
Pair Name | All-trans retinoic acid, Salinomycin | |||
Phytochemical | All-trans-retinoic acid | |||
Drug | Salinomycin | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | S+RA induced differentiation by β-catenin-inhibition-mediated up-regulation of C/EBPs and PU.1 and suppression of c-Myc. S+RA triggered apoptosis through β-catenin-inhibition-regulated ΔΨm collapse and caspase-3/7 activation. Taken together, our findings may provide novel therapeutic strategies for AML patients by targeting the WNT/β-catenin pathway. |
Pair Name | alpha-Mangostin, TNF-related apoptosis inducing ligand | |||
Phytochemical | alpha-Mangostin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B66.0] | Oral squamous cell carcinoma | Investigative | |
Regulate Info | Up-regulation | Myc proto-oncogene protein | Expression | |
Result | Synergism between α-mangostin and TRAIL induces apoptosis in squamous cell carcinoma of the oral cavity through the mitochondrial pathway |
Pair Name | Apigenin, Gefitinib | |||
Phytochemical | Apigenin | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Apigenin Combined With Gefitinib Blocks Autophagy Flux and Induces Apoptotic Cell Death Through Inhibition of HIF-1α, c-Myc, p-EGFR, and Glucose Metabolism in EGFR L858R+T790M-Mutated H1975 Cells |
Pair Name | Berbamine, Sorafenib | |||
Phytochemical | Berbamine | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Targeting Na+/K+-ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma |
Pair Name | Beta-Elemene, Gefitinib | |||
Phytochemical | Beta-Elemene | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Myc proto-oncogene protein | Expression | |
Result | The findings may have potential implications for treating aggressive and resistant lung cancers. |
Pair Name | Betulinic Acid, Sorafenib | |||
Phytochemical | Betulinic Acid | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | We showed that combined treatment with low concentrations of sorafenib and betulinic acid had the capacity to inhibit proliferation and abolish clonogenic activity in PDAC cell lines. |
Pair Name | Biochanin A, Temozolomide | |||
Phytochemical | Biochanin A | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Chanin A significantly enhanced the anticancer efficacy of temozolomide in GBM cells. |
Pair Name | Brassinolid, Doxorubicin | |||
Phytochemical | Brassinolid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | These data indicate that EB, a natural product with widespread occurrence in plants, is pharmacologically active in both drug-sensitive and drug-resistant SCLC cells and acts through the Wnt signaling pathway. |
Pair Name | Cordycepin, Temozolomide | |||
Phytochemical | Cordycepin | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Cordycepin combined with temozolomide may down-regulate MYC through "MicroRNA in cancer, Proteoglycans in cancer, Pathways in cancer and PI3K-AKT signaling pathway", which in turn regulate the expression of MCL1, CTNNB1, MMP9, PDCD4, thus regulating cell proliferation, migration and apoptosis in glioblastoma. |
Pair Name | Fangchinoline, Everolimus | |||
Phytochemical | Fangchinoline | |||
Drug | Everolimus | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Myc proto-oncogene protein | Expression | |
Result | Firstly link CHOP to Notch 3/c-MYC axis-dependent apoptosis and provide the Notch 3/c-MYC/CHOP activation as a promising strategy for mTOR-targeted combination therapy in lung cancer treatment. |
Pair Name | Gamma-Tocotrienol, Capecitabine | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Capecitabine | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Our findings suggest that γ-T3 inhibited the growth of human CRC and sensitised CRC to capecitabine by regulating proteins linked to tumourigenesis. |
Pair Name | Gamma-Tocotrienol, Gemcitabine | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Our findings suggest that γ-T3 can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing NF-κB-mediated inflammatory pathways linked to tumorigenesis. |
Pair Name | Homoharringtonine, ACC010 | |||
Phytochemical | Homoharringtonine | |||
Drug | ACC010 | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | ACC010 and HHT cooperatively downregulated MYC and inhibited FLT3 activation. Further, when HHT was added, ACC010-resistant cells demonstrated a good synergy. We also extended our study to the mouse BaF3 cell line with FLT3-inhibitor-resistant FLT3-ITD/tyrosine kinase domain mutations and AML cells without FLT3-ITD. Collectively, our results suggested that the combination treatment of ACC010 and HHT might be a promising strategy for AML patients, especially those carrying FLT3-ITD. |
Pair Name | Kaempferol, Cisplatin | |||
Phytochemical | Kaempferol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Kaempferol enhances cisplatin's effect on ovarian cancer cells through promoting apoptosis caused by down regulation of cMyc |
Pair Name | Morusin, MAPK pathway inhibitors | |||
Phytochemical | Morusin | |||
Drug | MAPK pathway inhibitors | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Our results suggested that the combination of morusin and MAPK pathway inhibitors may be a more effective treatment strategy for BRAF-mutant melanoma than MAPK pathway inhibitors alone. |
Pair Name | Narciclasine, Tamoxifen | |||
Phytochemical | Narciclasine | |||
Drug | Tamoxifen | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Our findings successfully highlight the STAT3 as the direct therapeutic target of Nar in ER-positive breast cancer cells, especially, Nar leaded STAT3 degradation as a promising strategy for the tamoxifen-resistant breast cancer treatment. |
Pair Name | Oridonin, Venetoclax | |||
Phytochemical | Oridonin | |||
Drug | Venetoclax | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Oridonin and venetoclax synergistically promote AML cell apoptosis by inhibiting AKT signaling. |
Pair Name | Oxyresveratrol, Dacarbazine | |||
Phytochemical | Oxyresveratrol | |||
Drug | Dacarbazine | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Up-regulation | Myc proto-oncogene protein | Expression | |
Result | This combination treatment may serve as a novel therapeutic strategy for treating malignant melanoma. |
Pair Name | Platycodin D, Cetuximab | |||
Phytochemical | Platycodin D | |||
Drug | Cetuximab | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Our findings provide a potential strategy to inhibit CRC metastasis during cetuximab therapy by addition of platycodin D. |
Pair Name | Puerarin, Cisplatin | |||
Phytochemical | Puerarin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Taking these results together, we can draw the conclusion that the PUE enhances the anti-tumor effect of DDP on the drug-resistant A549 cancer in vivo and in vitro through activation of the Wnt signaling pathway. |
Pair Name | Quercetin, Doxorubicin | |||
Phytochemical | Quercetin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Que could attenuate AC-induced cardiotoxicity by inhibiting ROS accumulation and activating ERK1/2 pathway in cardiomyocytes, but interestingly, Que could enhance the antitumor activity of AC by inhibiting ROS accumulation and ERK1/2 pathway in TNBC cells. In addition,in vivo studies further confirmed that Que could enhance the chemotherapeutic effect of AC against TNBC while it reduced the injury of cardiotoxicity induced by AC |
Pair Name | Rhizoma Paridis saponins, Sorafenib | |||
Phytochemical | Rhizoma Paridis saponins | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | All of that provided possibility to overcome the intolerance of sorafenib by drug compatibility through protection against mitochondria damage, inhibition of anaerobic glycolysis and suppression of lipid synthesis based on PI3K/Akt/mTOR pathway. |
Pair Name | Rutaecarpine, Fluorouracil | |||
Phytochemical | Rutaecarpine | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Combined therapy with 5-FU and RUT exerted a superior curative effect in CRC than treatment with either single drug alone and has potential as a novel therapeutic modality for the treatment of CRC. |
Pair Name | Shikonin, Doxorubicin | |||
Phytochemical | Shikonin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2B33.5] | Lymphoma | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | These data suggest that shikonin may be an encouraging chemotherapeutic agent in the clinical treatment of BL. |
Pair Name | Shikonin, Gemcitabine | |||
Phytochemical | Shikonin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Our results suggest that shikonin can suppress the growth of human pancreatic tumors and potentiate the antitumor effects of gemcitabine through the suppression of NF-κB and NF-κB-regulated gene products. |
Pair Name | Toosendanin, Regorafenib | |||
Phytochemical | Toosendanin | |||
Drug | Regorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | TSN and RGF combination (TRC) synergistically inhibited the proliferation and migration of MHCC-97L cells. The upregulation of WWOX (WW-domain containing oxidoreductase) played a vital role in the HCC cell growth treated with TRC |
Pair Name | Ursolic acid, Doxorubicin | |||
Phytochemical | Ursolic acid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | UA may be a novel anticancer strategy and could be considered for investigation as a complementary chemotherapy agent in the future. |
Pair Name | Berberine, Lapatinib | |||
Phytochemical | Berberine | |||
Drug | Lapatinib | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Berberine reverses Lapatinib resistance of HER2-positive breast cancer cells by increasing the level of ROS |
Pair Name | Gamma-Tocotrienol, Simvastatin | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Simvastatin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol |
Pair Name | Mitocurcumin, Cytarabine | |||
Phytochemical | Mitocurcumin | |||
Drug | Cytarabine | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Down-regulation | Myc proto-oncogene protein | Expression | |
Result | The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis. |
Pair Name | Vitamin C, Cisplatin | |||
Phytochemical | Vitamin C | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Up-regulation | Myc proto-oncogene protein | Expression | |
Result | Our findings provide a rationale for combining cisplatin with ascorbate in therapeutic strategies against OS. |
No. | Title | Href |
---|---|---|
1 | Lupeol, an androgen receptor inhibitor, enhances the chemosensitivity of prostate cancer stem cells to antiandrogen enzalutamide-based therapy. Toxicol Appl Pharmacol. 2023 Nov 1;478:116699. doi: 10.1016/j.taap.2023.116699. | Click |
2 | Improved chemosensitivity in cervical cancer to cisplatin: synergistic activity of mahanine through STAT3 inhibition. Cancer Lett. 2014 Aug 28;351(1):81-90. doi: 10.1016/j.canlet.2014.05.005. | Click |
3 | Mangiferin Ameliorates Cisplatin Induced Acute Kidney Injury by Upregulating Nrf-2 via the Activation of PI3K and Exhibits Synergistic Anticancer Activity With Cisplatin. Front Pharmacol. 2018 Jun 18;9:638. doi: 10.3389/fphar.2018.00638. | Click |
4 | Combined Application of Salinomycin and ATRA Induces Apoptosis and Differentiation of Acute Myeloid Leukemia Cells by Inhibiting WNT/β-Catenin Pathway. Anticancer Agents Med Chem. 2023;23(9):1074-1084. doi: 10.2174/1871520623666230110121629. | Click |
5 | Synergism between α-mangostin and TRAIL induces apoptosis in squamous cell carcinoma of the oral cavity through the mitochondrial pathway. Oncol Rep. 2017 Dec;38(6):3439-3446. doi: 10.3892/or.2017.6030. | Click |
6 | Apigenin Combined With Gefitinib Blocks Autophagy Flux and Induces Apoptotic Cell Death Through Inhibition of HIF-1α, c-Myc, p-EGFR, and Glucose Metabolism in EGFR L858R+T790M-Mutated H1975 Cells. Front Pharmacol. 2019 Mar 22;10:260. doi: 10.3389/fphar.2019.00260. | Click |
7 | Targeting Na+ /K+ -ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma. Br J Pharmacol. 2021 Nov;178(21):4389-4407. doi: 10.1111/bph.15616. | Click |
8 | β-Elemene Synergizes With Gefitinib to Inhibit Stem-Like Phenotypes and Progression of Lung Cancer via Down-Regulating EZH2. Front Pharmacol. 2018 Nov 30;9:1413. doi: 10.3389/fphar.2018.01413. | Click |
9 | Sorafenib in Combination with Betulinic Acid Synergistically Induces Cell Cycle Arrest and Inhibits Clonogenic Activity in Pancreatic Ductal Adenocarcinoma Cells. Int J Mol Sci. 2018 Oct 19;19(10):3234. doi: 10.3390/ijms19103234. | Click |
10 | Combination of Biochanin A and Temozolomide Impairs Tumor Growth by Modulating Cell Metabolism in Glioblastoma Multiforme. Anticancer Res. 2019 Jan;39(1):57-66. doi: 10.21873/anticanres.13079. | Click |
11 | The effect of brassinolide, a plant steroid hormone, on drug resistant small-cell lung carcinoma cells. Biochem Biophys Res Commun. 2017 Nov 4;493(1):783-787. doi: 10.1016/j.bbrc.2017.08.094. | Click |
12 | Cordycepin improves sensitivity to temozolomide in glioblastoma cells by down-regulating MYC. J Cancer Res Clin Oncol. 2023 Nov;149(17):16055-16067. doi: 10.1007/s00432-023-05347-0. | Click |
13 | Activation of notch 3/c-MYC/CHOP axis regulates apoptosis and promotes sensitivity of lung cancer cells to mTOR inhibitor everolimus. Biochem Pharmacol. 2020 May;175:113921. doi: 10.1016/j.bcp.2020.113921. | Click |
14 | γ-Tocotrienol suppresses growth and sensitises human colorectal tumours to capecitabine in a nude mouse xenograft model by down-regulating multiple molecules. Br J Cancer. 2016 Sep 27;115(7):814-24. doi: 10.1038/bjc.2016.257. | Click |
15 | {Gamma}-tocotrienol inhibits pancreatic tumors and sensitizes them to gemcitabine treatment by modulating the inflammatory microenvironment. Cancer Res. 2010 Nov 1;70(21):8695-705. doi: 10.1158/0008-5472.CAN-10-2318. Epub 2010 Sep 23. | Click |
16 | ACC010, a novel BRD4 inhibitor, synergized with homoharringtonine in acute myeloid leukemia with FLT3-ITD. Mol Oncol. 2023 Jul;17(7):1402-1418. doi: 10.1002/1878-0261.13368. | Click |
17 | Kaempferol enhances cisplatin's effect on ovarian cancer cells through promoting apoptosis caused by down regulation of cMyc. Cancer Cell Int. 2010 May 11;10:16. doi: 10.1186/1475-2867-10-16. | Click |
18 | Morusin enhances the antitumor activity of MAPK pathway inhibitors in BRAF-mutant melanoma by inhibiting the feedback activation of STAT3. Eur J Cancer. 2022 Apr;165:58-70. doi: 10.1016/j.ejca.2022.01.004. | Click |
19 | Narciclasine targets STAT3 via distinct mechanisms in tamoxifen-resistant breast cancer cells. Mol Ther Oncolytics. 2022 Jan 3;24:340-354. doi: 10.1016/j.omto.2021.12.025. | Click |
20 | Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195. | Click |
21 | Synergistic inhibitory effects of the oxyresveratrol and dacarbazine combination against melanoma cells. Oncol Lett. 2021 Sep;22(3):667. doi: 10.3892/ol.2021.12928. | Click |
22 | Platycodin D represses β-catenin to suppress metastasis of cetuximab-treated KRAS wild-type colorectal cancer cells. Clin Exp Metastasis. 2023 Aug;40(4):339-356. doi: 10.1007/s10585-023-10218-6. | Click |
23 | Puerarin Enhances the Anti-Tumor Effect of Cisplatin on Drug-Resistant A549 Cancer in vivo and in vitro Through Activation of the Wnt Signaling Pathway. Cancer Manag Res. 2020 Jul 24;12:6279-6289. doi: 10.2147/CMAR.S253327. | Click |
24 | Quercetin attenuates the cardiotoxicity of doxorubicin-cyclophosphamide regimen and potentiates its chemotherapeutic effect against triple-negative breast cancer. Phytother Res. 2022;36(1):551-561. doi:10.1002/ptr.7342 | Click |
25 | Combinatorial treatment of Rhizoma Paridis saponins and sorafenib overcomes the intolerance of sorafenib. J Steroid Biochem Mol Biol. 2018 Oct;183:159-166. doi: 10.1016/j.jsbmb.2018.06.010. | Click |
26 | 5-Fluorouracil Combined with Rutaecarpine Synergistically Suppresses the Growth of Colon Cancer Cells by Inhibiting STAT3. Drug Des Devel Ther. 2023 Mar 30;17:993-1006. doi: 10.2147/DDDT.S402824. | Click |
27 | Shikonin exerts antitumor activity in Burkitt's lymphoma by inhibiting C-MYC and PI3K/AKT/mTOR pathway and acts synergistically with doxorubicin. Sci Rep. 2018 Feb 20;8(1):3317. doi: 10.1038/s41598-018-21570-z. | Click |
28 | Shikonin suppresses tumor growth and synergizes with gemcitabine in a pancreatic cancer xenograft model: Involvement of NF-κB signaling pathway. Biochem Pharmacol. 2014 Apr 1;88(3):322-33. doi: 10.1016/j.bcp.2014.01.041. | Click |
29 | Synergistic effect of toosendanin and regorafenib against cell proliferation and migration by regulating WWOX signaling pathway in hepatocellular carcinoma. Phytother Res. 2021 Aug;35(8):4567-4578. doi: 10.1002/ptr.7174. | Click |
30 | Inhibition of colorectal cancer tumorigenesis by ursolic acid and doxorubicin is mediated by targeting the Akt signaling pathway and activating the Hippo signaling pathway. Mol Med Rep. 2023 Jan;27(1):11. doi: 10.3892/mmr.2022.12898. | Click |
31 | Berberine reverses Lapatinib resistance of HER2-positive breast cancer cells by increasing the level of ROS. Cancer Biol Ther. 2016;17(9):925-934. doi:10.1080/15384047.2016.1210728 | Click |
32 | Eliminating drug resistant breast cancer stem-like cells with combination of simvastatin and gamma-tocotrienol. Cancer Lett. 2013 Jan 28;328(2):285-96. doi: 10.1016/j.canlet.2012.10.003. | Click |
33 | Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004 | Click |
34 | Ascorbate sensitizes human osteosarcoma cells to the cytostatic effects of cisplatin. Pharmacol Res Perspect. 2020 Aug;8(4):e00632. doi: 10.1002/prp2.632. | Click |