Name | 72 kDa type IV collagenase | ||
UniProt ID | MMP2_HUMAN | ||
Gene Name | MMP2 | ||
Gene ID | 4313 | ||
Synonyms |
MMP2, CLG4, CLG4A, MMP-2, MMP-II, MONA, TBE-1
|
||
Sequence |
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC |
||
Pathway Map | MAP LINK | ||
T.C. Number | 1.C.79.1.1; 8.B.14.2.1; 8.B.14.2.2 | ||
KEGG ID | hsa4313 | ||
TTD ID | T68251 | ||
Pfam | PF00040; PF00045; PF00413; PF01471; PF10462; PF13582; PF13583; PF13688 |
Pair Name | Lupeol, Paclitaxel | |||
Phytochemical Name | Lupeol | |||
Anticancer drug Name | Paclitaxel | |||
Disease Info | [ICD-11: 2B66.0] | Oral squamous cell carcinoma | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Our findings elucidated mechanistic underpinning of hypoxia induced Laminin-5γ2 driven VM formation highlighting that Lupeol-Paclitaxel combination may serve as novel therapeutic intervention in perturbation of VM in human OSCC. |
Pair Name | Ononin, Paclitaxel | |||
Phytochemical Name | Ononin | |||
Anticancer drug Name | Paclitaxel | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Our findings suggested that the therapeutic index of PTX-based chemotherapy could be improved by reducing toxicity with increasing antitumor capabilities when combined with ononin. |
Pair Name | Polydatin, 2-Deoxy-d-glucose | |||
Phytochemical Name | Polydatin | |||
Anticancer drug Name | 2-Deoxy-d-glucose | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Our study demonstrates that PD synergised with 2-DG to enhance its anti-cancer efficacy by inhibiting the ROS/PI3K/AKT/HIF-1α/HK2 signalling axis, providing a potential anti-cancer strategy. |
Pair Name | Resveratrol, Cisplatin | |||
Phytochemical Name | Resveratrol | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest |
Pair Name | Alpha-Carotene, Paclitaxel | |||
Phytochemical | Alpha-Carotene | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | We demonstrate that AC effectively inhibits LLC metastasis and suppresses lung metastasis in combination with taxol in LLC-bearing mice, suggesting that AC could be used as an anti-metastatic agent or as an adjuvant for anti-cancer drugs. |
Pair Name | Alpha-Hederin, Cisplatin | |||
Phytochemical | Alpha-Hederin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | α-Hederin enhances cisplatin-induced anti-tumour effects in GC both in vitro and in vivo by promoting the accumulation of ROS and decreasing MMP. Our data strongly suggested that α-Hederin is a promising candidate for intervention in gastric cancer. |
Pair Name | Baicalein, Cisplatin | |||
Phytochemical | Baicalein | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Treatment with baicalein improved the sensitivity of ovarian cancer cells to cisplatin and inhibited cell proliferation, metastasis and tumor growth |
Pair Name | Berberine, Cisplatin | |||
Phytochemical | Berberine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway |
Pair Name | Beta-Ionone, Sorafenib | |||
Phytochemical | Beta-Ionone | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | SF enhanced the suppressing effect of BI (1-50 μM) on the viability of SK-Hep-1 cells, but not on murine hepatic BNL CL.2 cells, indicating the selective cytotoxicity of this combination on tumor cells. The combination of SF and BI could be a potential therapeutic strategy against human hepatoma cells. |
Pair Name | Biochanin A, Fluorouracil | |||
Phytochemical | Biochanin A | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | The synergistic antitumor effect of Bio-A/ 5-FU combination can be, at least partly, attributed to Bio-A-mediated suppression of ER-α/Akt axis and the augmentation of 5-FU-mediated proapoptotic effects. |
Pair Name | Bisdemethoxycucurmin, Icotinib | |||
Phytochemical | Bisdemethoxycucurmin | |||
Drug | Icotinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib. |
Pair Name | Cordycepin, Cisplatin | |||
Phytochemical | Cordycepin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | This study provides comprehensive evidence that cordycepin inhibits osteosarcoma cell growth and invasion and induces osteosarcoma cell apoptosis by activating AMPK and inhibiting the AKT/mTOR signaling pathway and enhances the sensitivity of osteosarcoma cells to cisplatin, suggesting that cordycepin is a promising treatment for osteosarcoma. |
Pair Name | Curcumenol, Cisplatin | |||
Phytochemical | Curcumenol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Curcumenol can enhance cisplatin to inhibit cancer cell proliferation, migration, and invasion and promote tumor cell apoptosis. The combination of drugs may promote the apoptosis of cervical cancer cells through the YWHAG pathway. |
Pair Name | Curcumin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Curcumin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Combined treatment with curcumin and carboplatin inhibited tumor cell growth, migration, and invasion compared with either drug alone. The synergistic antitumor activity of curcumin combined with carboplatin is mediated by multiple mechanisms involving suppression of NF-kappaB via inhibition of the Akt/IKKalpha pathway and enhanced ERK1/2 activity |
Pair Name | Emodin, Cisplatin | |||
Phytochemical | Emodin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | We found that emodin inhibited hepatocellular carcinoma (HCC) metastasis. Compared with either cisplatin or emodin alone, the combination of both showed a more significant synergistic effect. Emodin can enhance the sensitivity of HepG2 HCC cells to cisplatin by inhibiting epithelial-mesenchymal transition, and thus, play a role in preventing recurrence and metastasis in HCC. |
Pair Name | Epigallocatechin gallate, TNF-related apoptosis inducing ligand | |||
Phytochemical | Epigallocatechin gallate | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis |
Pair Name | Erianin, Afatinib | |||
Phytochemical | Erianin | |||
Drug | Afatinib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | EBTP/Afa targets VEGF and EGFR signaling pathways in liver cancer cells and tumor vasculature, thereby inhibiting the proliferation, motion and angiogenesis of liver cancer cells. Overall, this study provides a new combined strategy for the clinical treatment of hepatocellular carcinoma. |
Pair Name | Eugenol, Cisplatin | |||
Phytochemical | Eugenol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | These results provide strong preclinical justification for combining cisplatin with eugenol as therapeutic approach for triple-negative breast cancers through targeting the resistant ALDH-positive cells and inhibiting the NF-κB pathway. |
Pair Name | Fisetin, Sorafenib | |||
Phytochemical | Fisetin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Our findings demonstrate that fisetin potentiates the anti-invasive and anti-metastatic effects of sorafenib. Our data suggest that fisetin may be a worthy adjuvant chemotherapy for the management of melanoma. |
Pair Name | Garcinol, Paclitaxel | |||
Phytochemical | Garcinol | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Activity | |
Result | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model |
Pair Name | Ginsenoside Rg3, Endostar | |||
Phytochemical | Ginsenoside Rg3 | |||
Drug | Endostar | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Endostar combined with ginsenoside Rg3 has stronger inhibiting effect on breast cancer tumor growth in tumor-bearing mice than single drug, and it can inhibit angiogenesis and cell invasion, and enhance cell autophagy. |
Pair Name | Harmine, Temozolomide | |||
Phytochemical | Harmine | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Harmine Augments the Cytotoxic and Anti-invasive Potential of Temozolomide Against Glioblastoma Multiforme Cells |
Pair Name | Liquiritigenin, Cisplatin | |||
Phytochemical | Liquiritigenin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | The results suggested that LQ plays an intensive role on CDDP suppressing invasion and metastasis through regulating the PI3 K/AKT signal pathway and suppressing the protein expression of MMP-2/9. |
Pair Name | Lupeol, Fluorouracil | |||
Phytochemical | Lupeol | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | These data lay the foundation for the clinical validation of this combination therapy for TNBC patients. |
Pair Name | Lycopene, Enzalutamide | |||
Phytochemical | Lycopene | |||
Drug | Enzalutamide | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | These results suggest that the enhanced antitumor effects of enzalutamide by lycopene may be related to the reduction of AR protein levels through lycopene-mediated inhibition of AKT/EZH2 pathway, which may provide a new approach to improve the efficacy of enzalutamide in CRPC. |
Pair Name | Maslinic acid, Gemcitabine | |||
Phytochemical | Maslinic acid | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C94] | Bladder cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | The results suggest that MA potentiates the antitumor effects of GEM in human GBC cell lines by suppressing the activation of NF-κB and its dowstream gene products, which are involved in survival signaling. |
Pair Name | Methoxsalen, Temozolomide | |||
Phytochemical | Methoxsalen | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | We showed a marked antitumor effect of 4MU on GBM cells alone and in combination with chemotherapy and proved, for the first time, the effect of 4MU on TMZ-resistant models, demonstrating that 4MU would be a potential therapeutic alternative for improving GBM therapy even on TMZ-refractory patients. |
Pair Name | Patchouli alcohol, Cisplatin | |||
Phytochemical | Patchouli alcohol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | The effects of patchouli alcohol and combination with cisplatin on proliferation, apoptosis and migration in B16F10 melanoma cells |
Pair Name | Polydatin, Paclitaxel | |||
Phytochemical | Polydatin | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Polydatin may enhance the chemosensitivity of osteosarcoma cells to paclitaxel. |
Pair Name | Propyl gallate, Temozolomide | |||
Phytochemical | Propyl gallate | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Activity | |
Result | Propyl Gallate Exerts an Antimigration Effect on Temozolomide-Treated Malignant Glioma Cells through Inhibition of ROS and the NF- κ B Pathway |
Pair Name | Shikonin, Temozolomide | |||
Phytochemical | Shikonin | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | From our results we conclude that dual treatment with SHK and TMZ may constitute a powerful new tool for GBM treatment by reducing therapy resistance and tumor recurrence. |
Pair Name | Sulforaphane, Cisplatin | |||
Phytochemical | Sulforaphane | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | The results of the current study suggests that CIS when supplemented with SFN, inhibits metastasis and stemness potential of TNBC cells by down regulating SIRTs-mediated EMT cascade. Overall this study affirms that, this novel combination could be a promising strategy against SIRT-mediated TNBC metastasis and CIS-resistance. |
Pair Name | Toosendanin, Regorafenib | |||
Phytochemical | Toosendanin | |||
Drug | Regorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | TSN and RGF combination (TRC) synergistically inhibited the proliferation and migration of MHCC-97L cells. The upregulation of WWOX (WW-domain containing oxidoreductase) played a vital role in the HCC cell growth treated with TRC |
Pair Name | Tricetin, ERK inhibitor | |||
Phytochemical | Tricetin | |||
Drug | ERK inhibitor | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | SP-1 is an important target of tricetin for suppressing MMP-2-mediated cell motility in GBM cells, and a combination of tricetin and an ERK inhibitor may be a good strategy for preventing GBM invasion. |
Pair Name | Zerumbone, Cisplatin | |||
Phytochemical | Zerumbone | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | The current study indicates that the treatment of 4.62 μM of ZER combined with 1.93 μM of CIS in human liver cancer cells exerts synergistic effects on cell growth inhibition, apoptosis induction, angiogenesis, and invasion by modulating gene expression. |
Pair Name | Noscapine, Docetaxel | |||
Phytochemical | Noscapine | |||
Drug | Docetaxel | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Chemo-sensitizing effect of Nos followed by DTX regime provide a promising chemotherapeutic strategy and its significant role for the treatment of drug-resistant TNBC. |
Pair Name | Noscapine, Docetaxel | |||
Phytochemical | Noscapine | |||
Drug | Docetaxel | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | Chemo-sensitizing effect of Nos followed by DTX regime provide a promising chemotherapeutic strategy and its significant role for the treatment of drug-resistant TNBC. |
Pair Name | Shikonin, Gemcitabine | |||
Phytochemical | Shikonin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | These results indicate that shikonin reduced MCT4 expression and activation, resulting in inhibition of aerobic glycolysis in CAFs and overcoming CAF-induced gemcitabine resistance in PC. Shikonin is a promising chemosensitizing phytochemical agent when used in combination with gemcitabine for PC treatment. The results suggest that disrupting the metabolic coupling between cancer cells and stromal cells might provide an attractive strategy for improving gemcitabine efficacy. |
Pair Name | Sulforaphane, Temozolomide | |||
Phytochemical | Sulforaphane | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | 72 kDa type IV collagenase | Expression | |
Result | The present study suggests that the clinical efficacy of TMZ-based chemotherapy in TMZ-resistant GBM may be improved by combination with SFN. |
No. | Title | Href |
---|---|---|
1 | Lupeol and Paclitaxel cooperate in hindering hypoxia induced vasculogenic mimicry via suppression of HIF-1α-EphA2-Laminin-5γ2 network in human oral cancer. J Cell Commun Signal. 2023 Sep;17(3):591-608. doi: 10.1007/s12079-022-00693-z. | Click |
2 | Antitumor Effects of Ononin by Modulation of Apoptosis in Non-Small-Cell Lung Cancer through Inhibiting PI3K/Akt/mTOR Pathway. Oxid Med Cell Longev. 2022 Dec 27;2022:5122448. doi: 10.1155/2022/5122448. | Click |
3 | Targeting the ROS/PI3K/AKT/HIF-1α/HK2 axis of breast cancer cells: Combined administration of Polydatin and 2-Deoxy-d-glucose. J Cell Mol Med. 2019 May;23(5):3711-3723. doi: 10.1111/jcmm.14276. | Click |
4 | Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest. Front Pharmacol. 2023;13:1068863. Published 2023 Jan 4. doi:10.3389/fphar.2022.1068863. | Click |
5 | Alpha-carotene inhibits metastasis in Lewis lung carcinoma in vitro, and suppresses lung metastasis and tumor growth in combination with taxol in tumor xenografted C57BL/6 mice. J Nutr Biochem. 2015 Jun;26(6):607-15. doi: 10.1016/j.jnutbio.2014.12.012. | Click |
6 | Combining α-Hederin with cisplatin increases the apoptosis of gastric cancer in vivo and in vitro via mitochondrial related apoptosis pathway. Biomed Pharmacother. 2019 Dec;120:109477. doi: 10.1016/j.biopha.2019.109477. | Click |
7 | Baicalein improves the chemoresistance of ovarian cancer through regulation of CirSLC7A6. J Ovarian Res. 2023 Nov 8;16(1):212. doi: 10.1186/s13048-023-01285-0. | Click |
8 | Berberine and Cisplatin Exhibit Synergistic Anticancer Effects on Osteosarcoma MG-63 Cells by Inhibiting the MAPK Pathway. Molecules. 2021 Mar 17;26(6):1666. doi: 10.3390/molecules26061666. | Click |
9 | Synergistic effects of the combination of β-ionone and sorafenib on metastasis of human hepatoma SK-Hep-1 cells. Invest New Drugs. 2012;30(4):1449-1459. doi:10.1007/s10637-011-9727-0 | Click |
10 | The natural isoflavone Biochanin-A synergizes 5-fluorouracil anticancer activity in vitro and in vivo in Ehrlich solid-phase carcinoma model. Phytother Res. 2022 Mar;36(3):1310-1325. doi: 10.1002/ptr.7388. | Click |
11 | Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib. | Click |
12 | Cordycepin augments the chemosensitivity of osteosarcoma to cisplatin by activating AMPK and suppressing the AKT signaling pathway. Cancer Cell Int. 2021 Dec 25;21(1):706. doi: 10.1186/s12935-021-02411-y. | Click |
13 | Curcumenol Targeting YWHAG Inhibits the Pentose Phosphate Pathway and Enhances Antitumor Effects of Cisplatin. Evid Based Complement Alternat Med. 2022 Jun 26;2022:3988916. doi: 10.1155/2022/3988916. | Click |
14 | Curcumin sensitizes human lung cancer cells to apoptosis and metastasis synergistically combined with carboplatin. Exp Biol Med (Maywood). 2015 Nov;240(11):1416-25. doi: 10.1177/1535370215571881. | Click |
15 | Effect of emodin combined with cisplatin on the invasion and migration of HepG2 hepatoma cells. J Physiol Pharmacol. 2023 Aug;74(4). doi: 10.26402/jpp.2023.4.04. | Click |
16 | Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63. doi: 10.1038/sj.onc.1210840. | Click |
17 | Ethoxy-erianin phosphate and afatinib synergistically inhibit liver tumor growth and angiogenesis via regulating VEGF and EGFR signaling pathways. Toxicol Appl Pharmacol. 2022 Mar 1;438:115911. doi: 10.1016/j.taap.2022.115911. | Click |
18 | Eugenol potentiates cisplatin anti-cancer activity through inhibition of ALDH-positive breast cancer stem cells and the NF-κB signaling pathway. Mol Carcinog. 2018 Mar;57(3):333-346. doi: 10.1002/mc.22758. | Click |
19 | Fisetin, a dietary flavonoid, augments the anti-invasive and anti-metastatic potential of sorafenib in melanoma. Oncotarget. 2016 Jan 12;7(2):1227-41. doi: 10.18632/oncotarget.6237. | Click |
20 | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. | Click |
21 | Inhibiting effect of Endostar combined with ginsenoside Rg3 on breast cancer tumor growth in tumor-bearing mice. Asian Pac J Trop Med. 2016 Feb;9(2):180-3. doi: 10.1016/j.apjtm.2016.01.010. | Click |
22 | Harmine Augments the Cytotoxic and Anti-invasive Potential of Temozolomide Against Glioblastoma Multiforme Cells. Jundishapur J Nat Pharm Prod. 2021. doi:10.5812/jjnpp.115464. | Click |
23 | Liquiritigenin Potentiates the Inhibitory Effects of Cisplatin on Invasion and Metastasis Via Downregulation MMP-2/9 and PI3 K/AKT Signaling Pathway in B16F10 Melanoma Cells and Mice Model. Nutr Cancer. 2015;67(5):761-70. doi: 10.1080/01635581.2015.1037962. | Click |
24 | Lupeol synergizes with 5-fluorouracil to combat c-MET/EphA2 mediated chemoresistance in triple negative breast cancer. iScience. 2023 Nov 4;26(12):108395. doi: 10.1016/j.isci.2023.108395. | Click |
25 | Lycopene enhances the sensitivity of castration-resistant prostate cancer to enzalutamide through the AKT/EZH2/ androgen receptor signaling pathway. Biochem Biophys Res Commun. 2022 Jul 12;613:53-60. doi: 10.1016/j.bbrc.2022.04.126. | Click |
26 | Maslinic acid potentiates the antitumor activities of gemcitabine in vitro and in vivo by inhibiting NF-κB-mediated survival signaling pathways in human gallbladder cancer cells. Oncol Rep. 2015 Apr;33(4):1683-90. doi: 10.3892/or.2015.3755. | Click |
27 | 4-Methylumbelliferone enhances the effects of chemotherapy on both temozolomide-sensitive and resistant glioblastoma cells. Sci Rep. 2023 Jun 8;13(1):9356. doi: 10.1038/s41598-023-35045-3. | Click |
28 | The effects of patchouli alcohol and combination with cisplatin on proliferation, apoptosis and migration in B16F10 melanoma cells. J Cell Mol Med. 2023 May;27(10):1423-1435. doi: 10.1111/jcmm.17745. | Click |
29 | Polydatin enhances the chemosensitivity of osteosarcoma cells to paclitaxel. J Cell Biochem. 2019 Oct;120(10):17481-17490. doi: 10.1002/jcb.29012. | Click |
30 | Propyl Gallate Exerts an Antimigration Effect on Temozolomide-Treated Malignant Glioma Cells through Inhibition of ROS and the NF-κB Pathway. J Immunol Res. 2017;2017:9489383. doi: 10.1155/2017/9489383. | Click |
31 | Dual treatment with shikonin and temozolomide reduces glioblastoma tumor growth, migration and glial-to-mesenchymal transition. Cell Oncol (Dordr). 2017 Jun;40(3):247-261. doi: 10.1007/s13402-017-0320-1. | Click |
32 | Sulforaphane-cisplatin combination inhibits the stemness and metastatic potential of TNBCs via down regulation of sirtuins-mediated EMT signaling axis. Phytomedicine. 2021 Apr;84:153492. doi: 10.1016/j.phymed.2021.153492. | Click |
33 | Synergistic effect of toosendanin and regorafenib against cell proliferation and migration by regulating WWOX signaling pathway in hepatocellular carcinoma. Phytother Res. 2021 Aug;35(8):4567-4578. doi: 10.1002/ptr.7174. | Click |
34 | Tricetin suppresses the migration/invasion of human glioblastoma multiforme cells by inhibiting matrix metalloproteinase-2 through modulation of the expression and transcriptional activity of specificity protein 1. Expert Opin Ther Targets. 2015;19(10):1293-306. doi: 10.1517/14728222.2015.1075509. | Click |
35 | Zerumbone Sensitizes the Anti-Cancer Efficacy of Cisplatin in Hepatocellular Carcinoma Cells. Anticancer Agents Med Chem. 2022 Aug 4;22(16):2885-2895. doi: 10.2174/1871520622666220324090801. | Click |
36 | Reversal of drug-resistance by noscapine chemo-sensitization in docetaxel resistant triple negative breast cancer. Sci Rep. 2017 Nov 20;7(1):15824. doi: 10.1038/s41598-017-15531-1. | Click |
37 | Reversal of drug-resistance by noscapine chemo-sensitization in docetaxel resistant triple negative breast cancer. Sci Rep. 2017 Nov 20;7(1):15824. doi: 10.1038/s41598-017-15531-1. | Click |
38 | Shikonin reverses cancer-associated fibroblast-induced gemcitabine resistance in pancreatic cancer cells by suppressing monocarboxylate transporter 4-mediated reverse Warburg effect. Phytomedicine. 2024 Jan;123:155214. doi: 10.1016/j.phymed.2023.155214. | Click |
39 | Sulforaphane reverses chemo-resistance to temozolomide in glioblastoma cells by NF-κB-dependent pathway downregulating MGMT expression. Int J Oncol. 2016 Feb;48(2):559-68. doi: 10.3892/ijo.2015.3271. | Click |