TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Cadherin-1
UniProt ID CADH1_HUMAN
Gene Name CDH1
Gene ID 999
Synonyms
CDH1, Arc-1, BCDS1, CD324, CDHE, ECAD, LCAM, UVO
Sequence
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
Pathway Map MAP LINK
T.C. Number 8.A.204.1.1
KEGG ID hsa999
TTD ID T08919
Pfam PF00028; PF01049; PF08758; PF16184; PF17756; PF21314
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 714
Pair Name Crocin, Fluorouracil
Phytochemical Name Crocin
Anticancer drug Name Fluorouracil
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result We demonstrated an antitumor activity of crocin in CRC and its potential role in improvement of inflammation with mucosal ulcers and high-grade dysplastic crypts, supporting the desireability of further investigations on the therapeutic potential of this approach in CRC.
Combination Pair ID: 1025
Pair Name Lupeol, Paclitaxel
Phytochemical Name Lupeol
Anticancer drug Name Paclitaxel
Disease Info [ICD-11: 2B66.0] Oral squamous cell carcinoma Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Our findings elucidated mechanistic underpinning of hypoxia induced Laminin-5γ2 driven VM formation highlighting that Lupeol-Paclitaxel combination may serve as novel therapeutic intervention in perturbation of VM in human OSCC.
Combination Pair ID: 114
Pair Name Narirutin, Cisplatin
Phytochemical Name Narirutin
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Based on the significant anticancer effect and high biosafety, naringin has great potential as a functional food in the adjuvant treatment of lung cancer.
Combination Pair ID: 412
Pair Name Puerarin, Fluorouracil
Phytochemical Name Puerarin
Anticancer drug Name Fluorouracil
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Puerarin combined with 5‑FU exhibited synergistic effects at lower concentrations and promoted apoptosis, but did not increase the side effects of chemotherapy, which indicated that puerarin may be a safe and effective chemosensitive agent in the treatment of human esophageal cancer.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 1031
Pair Name Atractylenolide I, Cabozantinib
Phytochemical Atractylenolide I
Drug Cabozantinib
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Silencing Hsp27 inhibits EMT. ATL-1 can inhibit the malignant evolution of prostate cancer cells by inhibiting Hsp27/eIF4E. ATL-1 also enhanced chemosensitization of cabozantinib in prostate cancer.
Combination Pair ID: 588
Pair Name Beta-Caryophyllene, Cisplatin
Phytochemical Beta-Caryophyllene
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result These data indicate that BCP enhances CDDP chemotherapeutic function through regulating the cell cycle, the apoptosis and EMT signaling molecules.
Combination Pair ID: 585
Pair Name Beta-Elemene, Cetuximab
Phytochemical Beta-Elemene
Drug Cetuximab
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result natural product β-elemene is a new ferroptosis inducer and combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant CRC cells by inducing ferroptosis and inhibiting EMT, which will hopefully provide a prospective strategy for CRC patients with RAS mutations.
Combination Pair ID: 708
Pair Name Beta-Elemene, Gefitinib
Phytochemical Beta-Elemene
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result The findings may have potential implications for treating aggressive and resistant lung cancers.
Combination Pair ID: 348
Pair Name Beta-Sitosterol, Gemcitabine
Phytochemical Beta-Sitosterol
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result β-Sitosterol and Gemcitabine Exhibit Synergistic Anti-pancreatic Cancer Activity by Modulating Apoptosis and Inhibiting Epithelial-Mesenchymal Transition by Deactivating Akt/GSK-3β Signaling
Combination Pair ID: 499
Pair Name Bisdemethoxycucurmin, Icotinib
Phytochemical Bisdemethoxycucurmin
Drug Icotinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.
Combination Pair ID: 161
Pair Name Celastrol, Docetaxel
Phytochemical Celastrol
Drug Docetaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Our results showing anti-migratory/anti-invasive effects of celastrol and associated mechanisms provide new evidence for the development of celastrol as a potential anti-metastatic compound against highly aggressive breast cancer, and celastrol in combination with docetaxel might potentially be used as a novel regimen for the treatment of TNBC.
Combination Pair ID: 937
Pair Name Cordycepin, Temozolomide
Phytochemical Cordycepin
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Cordycepin combined with temozolomide may down-regulate MYC through "MicroRNA in cancer, Proteoglycans in cancer, Pathways in cancer and PI3K-AKT signaling pathway", which in turn regulate the expression of MCL1, CTNNB1, MMP9, PDCD4, thus regulating cell proliferation, migration and apoptosis in glioblastoma.
Combination Pair ID: 390
Pair Name Curcumin, Arsenic oxide (As2O3)
Phytochemical Curcumin
Drug Arsenic oxide (As2O3)
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result The antitumor effects of combination therapy with As2O3 and Curcumin have been displayed on prostate cancer cell lines (LNCaP and PC3), which probably originates from their potential to induce apoptosis and inhibit the growth of prostate cancer cells simultaneously.
Combination Pair ID: 823
Pair Name Curcumin, Doxorubicin
Phytochemical Curcumin
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Cadherin-1 Expression
Result Our findings provide a novel and simple approach to nhibit the growth and metastasis of hepatocellular carcinoma.
Combination Pair ID: 740
Pair Name Emodin, Cisplatin
Phytochemical Emodin
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result We found that emodin inhibited hepatocellular carcinoma (HCC) metastasis. Compared with either cisplatin or emodin alone, the combination of both showed a more significant synergistic effect. Emodin can enhance the sensitivity of HepG2 HCC cells to cisplatin by inhibiting epithelial-mesenchymal transition, and thus, play a role in preventing recurrence and metastasis in HCC.
Combination Pair ID: 632
Pair Name Fisetin, Sorafenib
Phytochemical Fisetin
Drug Sorafenib
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Our findings demonstrate that fisetin potentiates the anti-invasive and anti-metastatic effects of sorafenib. Our data suggest that fisetin may be a worthy adjuvant chemotherapy for the management of melanoma.
Combination Pair ID: 613
Pair Name Forskolin, Paclitaxel
Phytochemical Forskolin
Drug Paclitaxel
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Our findings encourage the design of future studies aimed at further exploring the Forskolin employment in NSCLC treatment.
Combination Pair ID: 927
Pair Name Gamma-Tocotrienol, SU11274
Phytochemical Gamma-Tocotrienol
Drug SU11274
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Suggest that combined γ-tocotrienol and Met inhibitor treatment may provide benefit in treatment of breast cancers characterized by aberrant Met activity.
Combination Pair ID: 435
Pair Name Garcinol, Paclitaxel
Phytochemical Garcinol
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model
Combination Pair ID: 687
Pair Name Ginsenoside compound K, Cisplatin
Phytochemical Ginsenoside compound K
Drug Cisplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Cadherin-1 Expression
Result Both CK and DDP can inhibit the proliferation, EMT, and induce the apoptosis in MCF-7 cells, which may be related to the PI3K/Akt pathway. In addition, the combination of CK with DDP can produce a better effect
Combination Pair ID: 861
Pair Name Glabridin, Paclitaxel
Phytochemical Glabridin
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Glabridin plays dual action to intensify anti-metastatic potential of paclitaxel via impeding CYP2C8 in liver and CYP2J2/EETs in tumor of an orthotopic mouse model of breast cancer
Combination Pair ID: 310
Pair Name Juglone, Sodium selenite
Phytochemical Juglone
Drug Sodium selenite
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result The juglone-NaSe has the potential to be a promising agent especially to inhibit invasion and metastasis in pancreatic cancer treatment. However, more in depth studies are needed to more clearly demonstrate the effects of juglone-selenium.
Combination Pair ID: 107
Pair Name Liquiritin, TNF-related apoptosis inducing ligand
Phytochemical Liquiritin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation
Combination Pair ID: 1027
Pair Name Lupeol, Fluorouracil
Phytochemical Lupeol
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result These data lay the foundation for the clinical validation of this combination therapy for TNBC patients.
Combination Pair ID: 409
Pair Name Luteolin, Paclitaxel
Phytochemical Luteolin
Drug Paclitaxel
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result The molecular mechanism of inhibiting cell migration and EMT processes may be related to the inhibition of SIRT1, and the mechanism of apoptosis induction is associated with the reactive oxygen species (ROS)/c-Jun N-terminal kinase (JNK) pathway-mediated activation of mitochondrial apoptotic pathway.
Combination Pair ID: 457
Pair Name Neferine, Vitamin D3
Phytochemical Neferine
Drug Vitamin D3
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result These data suggest that neferine enhances the anticancer capability of VD3 and reduces the dose dependency of VD3. The combination of vitamin D with neferine appears to be a potential therapeutic strategy for CRC.
Combination Pair ID: 253
Pair Name Patchouli alcohol, Cisplatin
Phytochemical Patchouli alcohol
Drug Cisplatin
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result The effects of patchouli alcohol and combination with cisplatin on proliferation, apoptosis and migration in B16F10 melanoma cells
Combination Pair ID: 948
Pair Name Phenethyl isothiocyanate, Dasatinib
Phytochemical Phenethyl isothiocyanate
Drug Dasatinib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result The inhibition of FAK/STAT3 signalling led to increased E-cadherin expression and reduced VEGF secretion, reducing HCC metastatic potential. Therefore, a combination of PEITC and dasatinib could be a potential therapeutic strategy for the treatment of HCC.
Combination Pair ID: 57
Pair Name Polyphyllin I, Cisplatin
Phytochemical Polyphyllin I
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result The results from the present study demonstrated that PPI and PPVII may function as chemosensitizers by enhancing apoptosis via the p53 pathway, reversing EMT and suppressing the CIP2A/AKT/mTOR signaling axis, and the combination with DDP may be a promising strategy for the development of new therapeutic agents.
Combination Pair ID: 924
Pair Name Pristimerin, Paclitaxel
Phytochemical Pristimerin
Drug Paclitaxel
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result This active-targeting NMs provides a versatile nano-herb strategy for improving tumor-targeting of Chinese herbal extracts, which may help in the promotion of enhancing chemosensitivity of NSCLC in clinical applications.
Combination Pair ID: 78
Pair Name Puerarin, Cisplatin
Phytochemical Puerarin
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Taking these results together, we can draw the conclusion that the PUE enhances the anti-tumor effect of DDP on the drug-resistant A549 cancer in vivo and in vitro through activation of the Wnt signaling pathway.
Combination Pair ID: 266
Pair Name Sclareolide, Gemcitabine
Phytochemical Sclareolide
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Sclareolide enhances gemcitabine‑induced cell death through mediating the NICD and Gli1 pathways in gemcitabine‑resistant human pancreatic cancer
Combination Pair ID: 461
Pair Name Shogaol, Gefitinib
Phytochemical Shogaol
Drug Gefitinib
Disease Info [ICD-11: 2C73] Ovarian Cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Our results suggest that 6-shogaol exerts a potential anti-cancer effect in ovarian cancer and combination treatment with 6-shogaol and gefitinib may provide a novel anti-tumor therapeutic strategy in gefitinib-resistant ovarian cancer.
Combination Pair ID: 37
Pair Name Sophocarpine, Oxaliplatin
Phytochemical Sophocarpine
Drug Oxaliplatin
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Sophocarpine can enhance the inhibiting effect of oxaliplatin on colon cancer liver metastasis-in vitro and in vivo
Combination Pair ID: 541
Pair Name Sulforaphane, Cisplatin
Phytochemical Sulforaphane
Drug Cisplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result The results of the current study suggests that CIS when supplemented with SFN, inhibits metastasis and stemness potential of TNBC cells by down regulating SIRTs-mediated EMT cascade. Overall this study affirms that, this novel combination could be a promising strategy against SIRT-mediated TNBC metastasis and CIS-resistance.
Combination Pair ID: 548
Pair Name Sulforaphane, Gefitinib
Phytochemical Sulforaphane
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result SFN overcame T790M-mediated gefitinib resistance in vitro through EMT. Thus, a combination of gefitinib and SFN may be a beneficial treatment strategy for lung cancer patients with acquired resistance due to T790M mutation.
Combination Pair ID: 620
Pair Name Tetrandrine, Cisplatin
Phytochemical Tetrandrine
Drug Cisplatin
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Cadherin-1 Expression
Result Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo
Combination Pair ID: 1024
Pair Name Toosendanin, Paclitaxel
Phytochemical Toosendanin
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result The results suggest that combination of TSN and PTX is superior to PTX alone, suggesting that it may be a promising alternative adjuvant chemotherapy strategy for patients with TNBC, especially those with metastatic TNBC.
Combination Pair ID: 1011
Pair Name Ursolic acid, Doxorubicin
Phytochemical Ursolic acid
Drug Doxorubicin
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result UA may be a novel anticancer strategy and could be considered for investigation as a complementary chemotherapy agent in the future.
Combination Pair ID: 901
Pair Name Vitamin C, Oxaliplatin
Phytochemical Vitamin C
Drug Oxaliplatin
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Treatment with the combination of oxaliplatin with vitamin C can inhibit CRC cell growth and decrease cancer cell migration and invasion, via oxidative stress and cadherins.
Combination Pair ID: 568
Pair Name Zerumbone, Cisplatin
Phytochemical Zerumbone
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result The current study indicates that the treatment of 4.62 μM of ZER combined with 1.93 μM of CIS in human liver cancer cells exerts synergistic effects on cell growth inhibition, apoptosis induction, angiogenesis, and invasion by modulating gene expression.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 386
Pair Name Curcumin, Gemcitabine
Phytochemical Curcumin
Drug Gemcitabine
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Cur reversed GEM resistance and inhibited the EMT process in A549/GEM cells. GEM, combined with Cur, is safe and more effective in the treatment of non-small cell lung cancer.
Combination Pair ID: 498
Pair Name Isocorydine, Gemcitabine
Phytochemical Isocorydine
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result The synergistic treatment effect of the combination treatment of ICD and gemcitabine in pancreatic cancer cells was confirmed in established xenograft models.
Combination Pair ID: 19
Pair Name Oxymatrine, Fluorouracil
Phytochemical Oxymatrine
Drug Fluorouracil
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result Oxymatrine reverses 5-fluorouracil resistance by inhibition of colon cancer cell epithelial-mesenchymal transition and NF-kappa B signaling in vitro
Combination Pair ID: 153
Pair Name Triptolide, Gefitinib
Phytochemical Triptolide
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cadherin-1 Expression
Result The present results indicated that the combination of TP and TKIs may be a promising therapeutic strategy to treat patients with NSCLCs harboring EGFR mutations.
03. Reference
No. Title Href
1 Crocin synergistically enhances the antiproliferative activity of 5-flurouracil through Wnt/PI3K pathway in a mouse model of colitis-associated colorectal cancer. J Cell Biochem. 2018 Dec;119(12):10250-10261. doi: 10.1002/jcb.27367. Click
2 Lupeol and Paclitaxel cooperate in hindering hypoxia induced vasculogenic mimicry via suppression of HIF-1α-EphA2-Laminin-5γ2 network in human oral cancer. J Cell Commun Signal. 2023 Sep;17(3):591-608. doi: 10.1007/s12079-022-00693-z. Click
3 Molecular mechanism of ion channel protein TMEM16A regulated by natural product of narirutin for lung cancer adjuvant treatment. Int J Biol Macromol. 2022 Dec 31;223(Pt A):1145-1157. doi: 10.1016/j.ijbiomac.2022.11.123. Click
4 Synergistic effects of puerarin combined with 5-fluorouracil on esophageal cancer. Mol Med Rep. 2014 Nov;10(5):2535-41. doi: 10.3892/mmr.2014.2539. Click
5 Atractylenolide I inhibits EMT and enhances the antitumor effect of cabozantinib in prostate cancer via targeting Hsp27. Front Oncol. 2023 Jan 6;12:1084884. doi: 10.3389/fonc.2022.1084884. Click
6 Beta-Caryophyllene Enhances the Anti-Tumor Activity of Cisplatin in Lung Cancer Cell Lines through Regulating Cell Cycle and Apoptosis Signaling Molecules. Molecules. 2022 Nov 30;27(23):8354. doi: 10.3390/molecules27238354. Click
7 Combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant colorectal cancer cells by inducing ferroptosis and inhibiting epithelial-mesenchymal transformation. Theranostics. 2020;10(11):5107-5119. Published 2020 Apr 6. doi:10.7150/thno.44705 Click
8 β-Elemene Synergizes With Gefitinib to Inhibit Stem-Like Phenotypes and Progression of Lung Cancer via Down-Regulating EZH2. Front Pharmacol. 2018 Nov 30;9:1413. doi: 10.3389/fphar.2018.01413. Click
9 β-Sitosterol and Gemcitabine Exhibit Synergistic Anti-Pancreatic Cancer Activity by Modulating Apoptosis and Inhibiting Epithelial-Mesenchymal Transition by Deactivating Akt/GSK-3β Signaling. Front Pharmacol. 2020 Nov 20;11:565535. doi: 10.3389/fphar.2020.565535. Click
10 Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib. Click
11 Celastrol inhibits the migration and invasion and enhances the anti-cancer effects of docetaxel in human triple-negative breast cancer cells. Med Oncol. 2022 Sep 7;39(12):189. doi: 10.1007/s12032-022-01792-y. Click
12 Cordycepin improves sensitivity to temozolomide in glioblastoma cells by down-regulating MYC. J Cancer Res Clin Oncol. 2023 Nov;149(17):16055-16067. doi: 10.1007/s00432-023-05347-0. Click
13 Human prostate cancer cell epithelial-to-mesenchymal transition as a novel target of arsenic trioxide and curcumin therapeutic approach. Tissue Cell. 2022 Jun;76:101805. doi: 10.1016/j.tice.2022.101805. Click
14 Morphologically transformable peptide nanocarriers coloaded with doxorubicin and curcumin inhibit the growth and metastasis of hepatocellular carcinoma. Mater Today Bio. 2023 Dec 12;24:100903. doi: 10.1016/j.mtbio.2023.100903. Click
15 Effect of emodin combined with cisplatin on the invasion and migration of HepG2 hepatoma cells. J Physiol Pharmacol. 2023 Aug;74(4). doi: 10.26402/jpp.2023.4.04. Click
16 Fisetin, a dietary flavonoid, augments the anti-invasive and anti-metastatic potential of sorafenib in melanoma. Oncotarget. 2016 Jan 12;7(2):1227-41. doi: 10.18632/oncotarget.6237. Click
17 Forskolin affects proliferation, migration and Paclitaxel-mediated cytotoxicity in non-small-cell lung cancer cell lines via adenylyl cyclase/cAMP axis. Eur J Cell Biol. 2023 Jun;102(2):151292. doi: 10.1016/j.ejcb.2023.151292. Click
18 Combined γ-tocotrienol and Met inhibitor treatment suppresses mammary cancer cell proliferation, epithelial-to-mesenchymal transition and migration. Cell Prolif. 2013 Oct;46(5):538-53. doi: 10.1111/cpr.12059. Click
19 Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. Click
20 Effects of ginsenoside compound K combined with cisplatin on the proliferation, apoptosis and epithelial mesenchymal transition in MCF-7 cells of human breast cancer. Pharm Biol. 2016;54(4):561-8. doi: 10.3109/13880209.2015.1101142. Click
21 Glabridin plays dual action to intensify anti-metastatic potential of paclitaxel via impeding CYP2C8 in liver and CYP2J2/EETs in tumor of an orthotopic mouse model of breast cancer. Chem Biol Interact. 2023 Sep 1;382:110605. doi: 10.1016/j.cbi.2023.110605. Click
22 The effects of Juglone-Selenium combination on invasion and metastasis in pancreatic cancer cell lines. Afr Health Sci. 2022 Jun;22(2):334-342. doi: 10.4314/ahs.v22i2.37. Click
23 Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation. Biomed Pharmacother. 2017 Sep;93:948-960. doi: 10.1016/j.biopha.2017.06.095. Click
24 Lupeol synergizes with 5-fluorouracil to combat c-MET/EphA2 mediated chemoresistance in triple negative breast cancer. iScience. 2023 Nov 4;26(12):108395. doi: 10.1016/j.isci.2023.108395. Click
25 Luteolin combined with low-dose paclitaxel synergistically inhibits epithelial-mesenchymal transition and induces cell apoptosis on esophageal carcinoma in vitro and in vivo. Phytother Res. 2021 Nov;35(11):6228-6240. doi: 10.1002/ptr.7267. Click
26 Combined effects of vitamin D and neferine on the progression and metastasis of colorectal cancer. J Cancer Res Clin Oncol. 2023 Aug;149(9):6203-6210. doi: 10.1007/s00432-022-04552-7. Click
27 The effects of patchouli alcohol and combination with cisplatin on proliferation, apoptosis and migration in B16F10 melanoma cells. J Cell Mol Med. 2023 May;27(10):1423-1435. doi: 10.1111/jcmm.17745. Click
28 Combination of Phenethyl Isothiocyanate and Dasatinib Inhibits Hepatocellular Carcinoma Metastatic Potential through FAK/STAT3/Cadherin Signalling and Reduction of VEGF Secretion. Pharmaceutics. 2023 Sep 27;15(10):2390. doi: 10.3390/pharmaceutics15102390. Click
29 Polyphyllin I and VII potentiate the chemosensitivity of A549/DDP cells to cisplatin by enhancing apoptosis, reversing EMT and suppressing the CIP2A/AKT/mTOR signaling axis. Oncol Lett. 2019 Nov;18(5):5428-5436. doi: 10.3892/ol.2019.10895. Click
30 Accurate delivery of pristimerin and paclitaxel by folic acid-linked nano-micelles for enhancing chemosensitivity in cancer therapy. Nano Converg. 2022 Nov 24;9(1):52. doi: 10.1186/s40580-022-00343-5. Click
31 Puerarin Enhances the Anti-Tumor Effect of Cisplatin on Drug-Resistant A549 Cancer in vivo and in vitro Through Activation of the Wnt Signaling Pathway. Cancer Manag Res. 2020 Jul 24;12:6279-6289. doi: 10.2147/CMAR.S253327. Click
32 Sclareolide enhances gemcitabine‑induced cell death through mediating the NICD and Gli1 pathways in gemcitabine‑resistant human pancreatic cancer. Mol Med Rep. 2017 Apr;15(4):1461-1470. doi: 10.3892/mmr.2017.6182. Click
33 6-Shogaol Overcomes Gefitinib Resistance via ER Stress in Ovarian Cancer Cells. Int J Mol Sci. 2023 Jan 30;24(3):2639. doi: 10.3390/ijms24032639. Click
34 Sophocarpine can enhance the inhibiting effect of oxaliplatin on colon cancer liver metastasis-in vitro and in vivo. Naunyn Schmiedebergs Arch Pharmacol. 2021 Jun;394(6):1263-1274. doi: 10.1007/s00210-020-02032-8. Click
35 Sulforaphane-cisplatin combination inhibits the stemness and metastatic potential of TNBCs via down regulation of sirtuins-mediated EMT signaling axis. Phytomedicine. 2021 Apr;84:153492. doi: 10.1016/j.phymed.2021.153492. Click
36 Sulforaphane overcomes T790M-mediated gefitinib resistance in vitro through epithelial-mesenchymal transition. J Physiol Pharmacol. 2021 Oct;72(5). doi: 10.26402/jpp.2021.5.09. Click
37 Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo. Cancer Lett. 2011 May 1;304(1):21-32. doi: 10.1016/j.canlet.2011.01.022. Click
38 Synergistic Anti-Tumor Effect of Toosendanin and Paclitaxel on Triple-Negative Breast Cancer via Regulating ADORA2A-EMT Related Signaling. Adv Biol (Weinh). 2023 Aug;7(8):e2300062. doi: 10.1002/adbi.202300062. Click
39 Inhibition of colorectal cancer tumorigenesis by ursolic acid and doxorubicin is mediated by targeting the Akt signaling pathway and activating the Hippo signaling pathway. Mol Med Rep. 2023 Jan;27(1):11. doi: 10.3892/mmr.2022.12898. Click
40 Vitamin C Improves the Inhibitory Effects of Oxaliplatin on HCT-116 Colorectal Cancer Growth and Progression Through Cellular Oxidant Function-associated Cadherin Molecules. Anticancer Res. 2023 Oct;43(10):4461-4472. doi: 10.21873/anticanres.16641. Click
41 Zerumbone Sensitizes the Anti-Cancer Efficacy of Cisplatin in Hepatocellular Carcinoma Cells. Anticancer Agents Med Chem. 2022 Aug 4;22(16):2885-2895. doi: 10.2174/1871520622666220324090801. Click
42 Curcumin enhances drug sensitivity of gemcitabine-resistant lung cancer cells and inhibits metastasis. Pharmazie. 2021 Nov 1;76(11):538-543. doi: 10.1691/ph.2021.0927. Click
43 Isocorydine decrease gemcitabine-resistance by inhibiting epithelial-mesenchymal transition via STAT3 in pancreatic cancer cells. Am J Transl Res. 2020 Jul 15;12(7):3702-3714. Click
44 Oxymatrine reverses 5-fluorouracil resistance by inhibition of colon cancer cell epithelial-mesenchymal transition and NF-κB signaling in vitro. Oncol Lett. 2020 Jan;19(1):519-526. doi: 10.3892/ol.2019.11090. Click
45 Triptolide inhibits epithelial‑mesenchymal transition and induces apoptosis in gefitinib‑resistant lung cancer cells. Oncol Rep. 2020 May;43(5):1569-1579. doi: 10.3892/or.2020.7542. Click
It has been 47039 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP