Name | E3 ubiquitin-protein ligase XIAP | ||
UniProt ID | XIAP_HUMAN | ||
Gene Name | XIAP | ||
Gene ID | 331 | ||
Synonyms |
XIAP, API3, BIRC4, IAP-3, ILP1, MIHA, XLP2, hIAP-3, hIAP3
|
||
Sequence |
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK CPMCYTVITFKQKIFMS |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa331 | ||
TTD ID | T16769 | ||
Pfam | PF00653; PF10217; PF13920; PF14447; PF21290 |
Pair Name | Morusin, TNF-related apoptosis inducing ligand | |||
Phytochemical Name | Morusin | |||
Anticancer drug Name | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | These results suggest that morusin enhances TRAIL sensitivity in human glioblastoma cells through regulating expression of DR5 and EGFR. Therefore, the combination treatment of TRAIL and morusin may be a new therapeutic strategy for malignant glioma patients. |
Pair Name | Withaferin A, Oxaliplatin | |||
Phytochemical Name | Withaferin A | |||
Anticancer drug Name | Oxaliplatin | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | These results support the notion that combination treatment with oxaliplatin and WA could facilitate development of an effective strategy for PC treatment. |
Pair Name | 20(s)-ginsenoside Rh2, TNF-related apoptosis inducing ligand | |||
Phytochemical | 20(s)-ginsenoside Rh2 | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Our study indicates that Rh2 may act as a sensitizer in combination with TRAIL to increase the efficacy of its anti-tumor activity. |
Pair Name | Amentoflavone, Sorafenib | |||
Phytochemical | Amentoflavone | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Amentoflavone may sensitize OS to sorafenib treatment by inducing intrinsic and extrinsic apoptosis and inhibiting ERK/NF-κB signaling transduction. |
Pair Name | Amentoflavone, Sorafenib | |||
Phytochemical | Amentoflavone | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Our results demonstrated that amentoflavone significantly enhanced sorafenib-inhibited tumor growth and expression of ERK/AKT phosphorylation and anti-apoptotic proteins compared to single-agent treatment. Additionally, amentoflavone also triggered sorafenib-induced apoptosis through extrinsic and intrinsic apoptotic pathways. |
Pair Name | Bakuchiol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Bakuchiol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | The collective results suggest that bakuchiol facilitates TRAIL-induced apoptosis in colon cancer cells through up-regulation of the TRAIL receptors; DR4 and DR5 via ROS/JNK pathway signals. |
Pair Name | Beta-Elemene, Cisplatin | |||
Phytochemical | Beta-Elemene | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Our data provide a rationale for developing a combination of beta-elemene and cisplatin as a regimen for the treatment of lung carcinoma and other cisplatin-resistant tumors. |
Pair Name | Britannin, Vincristine | |||
Phytochemical | Britannin | |||
Drug | Vincristine | |||
Disease Info | [ICD-11: 2B33.3] | Acute lymphoblastic leukemia | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Our results proposed a mechanism for the cytotoxic effect of Britannin, either as a single agent or in combination with Vincristine, in NALM-6 cells. |
Pair Name | Britannin, Vincristine | |||
Phytochemical | Britannin | |||
Drug | Vincristine | |||
Disease Info | [ICD-11: 2B33.3] | Acute lymphoblastic leukemia | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | The results of this study showed for the first time that Britannin, as a natural Sesquiterpene Lactone, has cytotoxic effects that could be considered as an anti-leukemic agent in the treatment of ALL. However, there is still a demand for further studies that examine the efficacy and the safety of this purified compound. |
Pair Name | Bufalin, Fluorouracil | |||
Phytochemical | Bufalin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Bufalin in combination with 5-FU may induce a higher level of apoptosis compared with monotherapy, and the combination mat be a potential therapeutic strategy for the treatment of colorectal cancer. |
Pair Name | Capsaicin, Arsenic trioxide | |||
Phytochemical | Capsaicin | |||
Drug | Arsenic trioxide | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Combination index (CI) values were < 1 in all matched combination groups. Additional evaluation of As2O3 combined with ACM as a potential therapeutic benefit for AML seems warranted. |
Pair Name | Casticin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Casticin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Casticin enhances TRAIL-induced apoptosis through the downregulation of cell survival proteins and the upregulation of DR5 receptors through actions on the ROS-ER stress-CHOP pathway. |
Pair Name | Damnacanthal, Doxorubicin | |||
Phytochemical | Damnacanthal | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Combinatorial Cytotoxic Effects of Damnacanthal and Doxorubicin against Human Breast Cancer MCF-7 Cells in Vitro |
Pair Name | Embelin, TRAIL | |||
Phytochemical | Embelin | |||
Drug | TRAIL | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Embelin primes IBC cells for TRAIL-mediated apoptosis by its direct action on the anti-caspase activity of XIAP and by shifting the cellular redox balance toward oxidative stress–mediated apoptosis |
Pair Name | Embelin, Venetoclax | |||
Phytochemical | Embelin | |||
Drug | Venetoclax | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | The inhibition of both apoptosis inhibitory players, BCL2 and XIAP, by venetoclax and embelin, respectively, potentiated their cytotoxic effects in AML cell lines. |
Pair Name | Emodin, Gemcitabine | |||
Phytochemical | Emodin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | This study suggests that emodin enhances the antitumor effect of gemcitabine in SW1990 pancreatic cancer in vitro and in vivo, which may be via the downregulation of NF-κB expression, thus inhibiting the expression of XIAP. |
Pair Name | Epigallocatechin gallate, TNF-related apoptosis inducing ligand | |||
Phytochemical | Epigallocatechin gallate | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis |
Pair Name | Epigallocatechin gallate, TNF-related apoptosis inducing ligand | |||
Phytochemical | Epigallocatechin gallate | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B6B] | Nasopharyngeal carcinoma | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | EGCG sensitizes NPC cells to TRAIL-mediated apoptosis via modulation of extrinsic and intrinsic apoptotic pathways and inhibition of NF-κB activation. |
Pair Name | Evodiamine, Doxorubicin | |||
Phytochemical | Evodiamine | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Our results indicated that EVO enhanced the apoptotic action of DOX by inhibiting the Ras/MEK/ERK cascade and the expression of IAPs without inhibiting the expression and activity of P-glycoprotein (P-gp). Taken together, our data indicate that EVO, a natural product, may be useful applied alone or in combination with DOX for the treatment of resistant breast cancer. |
Pair Name | Flavokawain A, Herceptin | |||
Phytochemical | Flavokawain A | |||
Drug | Herceptin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Our results suggest FKA as a promising and novel apoptosis inducer and G2 blocking agent that, in combination with Herceptin, enhances for the treatment of HER2-overexpressing breast cancer. |
Pair Name | Gambogic Acid, Cisplatin | |||
Phytochemical | Gambogic Acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Gambogic acid sensitises lung cancer cells to CDDP in vitro and in vivo in NSCLC through inactivation of NF-κB and MAPK/HO-1 signalling pathways, providing a rationale for the combined use of CDDP and GA in lung cancer chemotherapy. |
Pair Name | Gambogic Acid, Doxorubicin | |||
Phytochemical | Gambogic Acid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | These findings indicate that GA sensitizes lung cancer cells to ADM in vitro and in vivo, providing a rationale for the combined use of GA and ADM in lung cancer chemotherapy. |
Pair Name | Gambogic Acid, TNF-related apoptosis inducing ligand | |||
Phytochemical | Gambogic Acid | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | These findings may open a new window in the treatment of breast cancer using TRAIL in combination with GA. |
Pair Name | Gamma-Tocotrienol, Capecitabine | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Capecitabine | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Our results show that γ-tocotrienol can potentiate the effects of capecitabine through suppression of NF-κB-regulated markers of proliferation, invasion, angiogenesis, and metastasis. |
Pair Name | Gamma-Tocotrienol, Docetaxel | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Docetaxel | |||
Disease Info | [ICD-11: 2B66.Z] | Oral cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | These findings suggest that the combination treatment with these agents may provide enhanced therapeutic response in oral cancer patients, while avoiding the toxicity associated with high-dose β-tubulin stabilization monotherapy. |
Pair Name | Gossypol, Idarubicin | |||
Phytochemical | Gossypol | |||
Drug | Idarubicin | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | These findings suggest that combinatorial therapy with AT-101 and IDA selectively eliminates leukemia stem-like cells both in vitro and in vivo, representing a potent and alternative salvage therapy for the treatment of relapsed and refractory patients with AML. |
Pair Name | Mangiferin, Doxorubicin | |||
Phytochemical | Mangiferin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2A83] | Multiple myeloma | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Our findings suggest that the combination of mangiferin and an anticancer drug could be used as a new regime for the treatment of MM. |
Pair Name | Medicarpin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Medicarpin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B33.1] | Myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway |
Pair Name | Morin, Auranofin | |||
Phytochemical | Morin | |||
Drug | Auranofin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | This study provides evidence that morin can enhance the anticancer activity of AF in Hep3B human hepatocellular carcinoma cells, indicating that its combination could be an alternative treatment strategy for the hepatocellular carcinoma. |
Pair Name | Nimbolide, Docetaxel | |||
Phytochemical | Nimbolide | |||
Drug | Docetaxel | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | The combination of NL and DTX significantly reduced the DNA binding ability of NF-κB in both cell types. NL significantly enhanced the antitumor effect of DTX and reduced metastases in orthotopic models of prostate cancer. NL abolishes DTX-induced-NF-κB activation to counteract cell proliferation, tumor growth, and metastasis in the prostate cancer models. |
Pair Name | Noscapine, Cisplatin | |||
Phytochemical | Noscapine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Noscapine Increases the Sensitivity of Drug-Resistant Ovarian Cancer Cell Line SKOV3/DDP to Cisplatin by Regulating Cell Cycle and Activating Apoptotic Pathways |
Pair Name | Oridonin, Arsenic oxide (As2O3) | |||
Phytochemical | Oridonin | |||
Drug | Arsenic oxide (As2O3) | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | The combination treatment induced ROS-dependent decrease in mitochondrial membrane potential (MMP) decrease, and relocation of Bax and cytochrome C. Besides, oridonin dramatically increased the intracellular Ca2+ overload triggered by As2O3. Furthermore, the co-treatment of oridonin and As2O3 induced ROS-mediated down-regulation of Akt and XIAP, and inhibition of NF-κB activation. The two drug combination enhanced tumor suppression activity in murine HCC model compared with single agent treatment in vivo. |
Pair Name | Phenethyl isothiocyanate, Irinotecan | |||
Phytochemical | Phenethyl isothiocyanate | |||
Drug | Irinotecan | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | PEITC potentiates IRI anticancer activity by promoting cell apoptosis in the human colon HCT 116 cells. Thus, PEITC may be a potential enhancer for IRI in humans as an anticolon cancer drug in the future. |
Pair Name | Pterostilbene, TNF-related apoptosis inducing ligand | |||
Phytochemical | Pterostilbene | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Pterostilbene enhances TRAIL-induced apoptosis through the induction of death receptors and downregulation of cell survival proteins in TRAIL-resistance triple negative breast cancer cells |
Pair Name | Resveratrol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Resveratrol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C90.0] | Renal cell carcinoma | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Our data demonstrated that RES plus Ad5/35-TRAIL significantly inhibited RCC xenograft growth in nude mice. These results suggest the possibility of a new combination therapeutic leading to the improvement of RCC treatment. |
Pair Name | Rhein, Calphostin c | |||
Phytochemical | Rhein | |||
Drug | Calphostin c | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Data suggest that rottlerin affects mitochondrial function independent of PKC delta, thereby sensitizing cells to TRAIL, and that mitochondria constitute an important target in overcoming inherent resistance to TRAIL in colon carcinomas. |
Pair Name | Sanguinarium, Bortezomib | |||
Phytochemical | Sanguinarium | |||
Drug | Bortezomib | |||
Disease Info | [ICD-11: 2A83] | Multiple myeloma | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Our findings demonstrate that SNG induces mitochondrial and caspase-dependent apoptosis, generates oxidative stress, and suppresses MM cell lines proliferation. In addition, co-treatment of MM cell lines with sub-toxic doses of SNG and BTZ potentiated the cytotoxic activity. These results would suggest that SNG could be developed into therapeutic agent either alone or in combination with other anticancer drugs in MM. |
Pair Name | Shikonin, Gemcitabine | |||
Phytochemical | Shikonin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Our results suggest that shikonin can suppress the growth of human pancreatic tumors and potentiate the antitumor effects of gemcitabine through the suppression of NF-κB and NF-κB-regulated gene products. |
Pair Name | Shikonin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Shikonin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | The results indicated that shikonin sensitized resistant cancer cells to TRAIL-induced cytotoxicity via the modulation of the JNK, STAT3 and AKT pathways, the downregulation of antiapoptotic proteins and the upregulation of proapoptotic proteins. |
Pair Name | Shogaol, Gemcitabine | |||
Phytochemical | Shogaol | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10.0] | Pancreatic ductal adenocarcinoma | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Our results suggest that 6-shogaol can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing of TLR4/NF-κB-mediated inflammatory pathways linked to tumorigenesis. |
Pair Name | Silibinin, Trichostatin A | |||
Phytochemical | Silibinin | |||
Drug | Trichostatin A | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Combinations of TSA with silibinin synergistically augmented the cytotoxic effects of the single agent, which was associated with a dramatic increase in p21 (Cdkn1a) |
Pair Name | Tectorigenin, Paclitaxel | |||
Phytochemical | Tectorigenin | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | These data suggest that tectorigenin could sensitize paclitaxel-resistant human ovarian cancer cells through inactivation of the Akt/IKK/IκB/NFκB signaling pathway, and promise a new intervention to chemosensitize paclitaxel-induced cytotoxicity in ovarian cancer. |
Pair Name | Ursolic acid, Oxaliplatin | |||
Phytochemical | Ursolic acid | |||
Drug | Oxaliplatin | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | These observations suggested that a combination of UA and Oxa elicited synergistically anticancer effects in RKO cells and provided new evidence for potential application of UA and Oxa for CRC treatment. |
Pair Name | Amentoflavone, Sorafenib | |||
Phytochemical | Amentoflavone | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | Amentoflavone not only reversed sorafenib-induced anti-apoptotic protein levels but also enhanced sorafenib-induced pro-apoptotic protein expression in SK-Hep1R cells. In conclusion, amentoflavone may be used as a sorafenib sensitizer to enhance sorafenib-induced cytotoxicity and trigger sorafenib-induced apoptosis through extrinsic and intrinsic pathways in SK-Hep1R cells. |
Pair Name | Mitocurcumin, Cytarabine | |||
Phytochemical | Mitocurcumin | |||
Drug | Cytarabine | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Down-regulation | E3 ubiquitin-protein ligase XIAP | Expression | |
Result | The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis. |
No. | Title | Href |
---|---|---|
1 | Morusin Induces TRAIL Sensitization by Regulating EGFR and DR5 in Human Glioblastoma Cells. J Nat Prod. 2016 Feb 26;79(2):317-23. doi: 10.1021/acs.jnatprod.5b00919. | Click |
2 | Synergistic antitumor activity of withaferin A combined with oxaliplatin triggers reactive oxygen species-mediated inactivation of the PI3K/AKT pathway in human pancreatic cancer cells. Cancer Lett. 2015 Feb 1;357(1):219-230. doi: 10.1016/j.canlet.2014.11.026. | Click |
3 | 20(s)-ginsenoside Rh2 promotes TRAIL-induced apoptosis by upregulating DR5 in human hepatocellular carcinoma cells. Med Oncol. 2022 May 15;39(5):70. doi: 10.1007/s12032-022-01663-6. | Click |
4 | Reinforcement of Sorafenib Anti-osteosarcoma Effect by Amentoflavone Is Associated With the Induction of Apoptosis and Inactivation of ERK/NF-κB. In Vivo. 2022 May-Jun;36(3):1136-1143. doi: 10.21873/invivo.12812. | Click |
5 | Amentoflavone Enhances the Therapeutic Efficacy of Sorafenib by Inhibiting Anti-apoptotic Potential and Potentiating Apoptosis in Hepatocellular Carcinoma In Vivo. Anticancer Res. 2018 Apr;38(4):2119-2125. doi: 10.21873/anticanres.12452. | Click |
6 | Bakuchiol sensitizes cancer cells to TRAIL through ROS- and JNK-mediated upregulation of death receptors and downregulation of survival proteins. Biochem Biophys Res Commun. 2016 Apr 29;473(2):586-92. doi: 10.1016/j.bbrc.2016.03.127. | Click |
7 | beta-Elemene, a novel plant-derived antineoplastic agent, increases cisplatin chemosensitivity of lung tumor cells by triggering apoptosis. Oncol Rep. 2009 Jul;22(1):161-70. doi: 10.3892/or_00000420. | Click |
8 | Britannin, a sesquiterpene lactone induces ROS-dependent apoptosis in NALM-6, REH, and JURKAT cell lines and produces a synergistic effect with vincristine. Mol Biol Rep. 2021 Sep;48(9):6249-6258. doi: 10.1007/s11033-021-06572-x. | Click |
9 | Britannin a Sesquiterpene Lactone from Inula aucheriana Exerted an Anti-leukemic Effect in Acute Lymphoblastic Leukemia (ALL) Cells and Enhanced the Sensitivity of the Cells to Vincristine. Nutr Cancer. 2022;74(3):965-977. doi: 10.1080/01635581.2021.1931700. | Click |
10 | Bufalin and 5-fluorouracil synergistically induce apoptosis in colorectal cancer cells. Oncol Lett. 2018 May;15(5):8019-8026. doi: 10.3892/ol.2018.8332. | Click |
11 | Low-dose arsenic trioxide combined with aclacinomycin A synergistically enhances the cytotoxic effect on human acute myelogenous leukemia cell lines by induction of apoptosis. Leuk Lymphoma. 2015;56(11):3159-67. doi: 10.3109/10428194.2015.1011155. | Click |
12 | Casticin potentiates TRAIL-induced apoptosis of gastric cancer cells through endoplasmic reticulum stress. PLoS One. 2013;8(3):e58855. doi: 10.1371/journal.pone.0058855. | Click |
13 | Combinatorial Cytotoxic Effects of Damnacanthal and Doxorubicin against Human Breast Cancer MCF-7 Cells in Vitro. Molecules. 2016 Sep 14;21(9):1228. doi: 10.3390/molecules21091228. | Click |
14 | XIAP inhibition and generation of reactive oxygen species enhances TRAIL sensitivity in inflammatory breast cancer cells. Mol Cancer Ther. 2012;11(7):1518-1527. doi:10.1158/1535-7163.MCT-11-0787 | Click |
15 | Embelin potentiates venetoclax-induced apoptosis in acute myeloid leukemia cells. Toxicol In Vitro. 2021 Oct;76:105207. doi: 10.1016/j.tiv.2021.105207. | Click |
16 | Enhanced antitumor efficacy by the combination of emodin and gemcitabine against human pancreatic cancer cells via downregulation of the expression of XIAP in vitro and in vivo. Int J Oncol. 2011 Nov;39(5):1123-31. doi: 10.3892/ijo.2011.1115. | Click |
17 | Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63. doi: 10.1038/sj.onc.1210840. | Click |
18 | EGCG sensitizes human nasopharyngeal carcinoma cells to TRAIL-mediated apoptosis by activation NF-κB. Neoplasma. 2017;64(1):74-80. doi: 10.4149/neo_2017_109. | Click |
19 | Evodiamine synergizes with doxorubicin in the treatment of chemoresistant human breast cancer without inhibiting P-glycoprotein. PLoS One. 2014 May 15;9(5):e97512. doi: 10.1371/journal.pone.0097512. | Click |
20 | Induction of G2M Arrest by Flavokawain A, a Kava Chalcone, Increases the Responsiveness of HER2-Overexpressing Breast Cancer Cells to Herceptin. Molecules. 2017 Mar 14;22(3):462. doi: 10.3390/molecules22030462. | Click |
21 | Gambogic acid synergistically potentiates cisplatin-induced apoptosis in non-small-cell lung cancer through suppressing NF-κB and MAPK/HO-1 signalling. Br J Cancer. 2014 Jan 21;110(2):341-52. doi: 10.1038/bjc.2013.752. | Click |
22 | Suppression of NF-κB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103. doi: 10.2174/1568009613666131113100634. | Click |
23 | Gambogic acid sensitizes breast cancer cells to TRAIL-induced apoptosis by promoting the crosstalk of extrinsic and intrinsic apoptotic signalings. Food Chem Toxicol. 2018 Sep;119:334-341. doi: 10.1016/j.fct.2018.02.037. | Click |
24 | First evidence that γ-tocotrienol inhibits the growth of human gastric cancer and chemosensitizes it to capecitabine in a xenograft mouse model through the modulation of NF-κB pathway. Clin Cancer Res. 2012 Apr 15;18(8):2220-9. doi: 10.1158/1078-0432.CCR-11-2470. | Click |
25 | γ-tocotrienol enhances the chemosensitivity of human oral cancer cells to docetaxel through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 | Click |
26 | Synthetic lethality of combined AT-101 with idarubicin in acute myeloid leukemia via blockade of DNA repair and activation of intrinsic apoptotic pathway. Cancer Lett. 2019 Oct 1;461:31-43. doi: 10.1016/j.canlet.2019.07.003. | Click |
27 | Mangiferin enhances the sensitivity of human multiple myeloma cells to anticancer drugs through suppression of the nuclear factor κB pathway. Int J Oncol. 2016 Jun;48(6):2704-12. doi: 10.3892/ijo.2016.3470. | Click |
28 | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. | Click |
29 | Morin enhances auranofin anticancer activity by up-regulation of DR4 and DR5 and modulation of Bcl-2 through reactive oxygen species generation in Hep3B human hepatocellular carcinoma cells. Phytother Res. 2019 May;33(5):1384-1393. doi: 10.1002/ptr.6329. | Click |
30 | Nimbolide enhances the antitumor effect of docetaxel via abrogation of the NF-κB signaling pathway in prostate cancer preclinical models. Biochim Biophys Acta Mol Cell Res. 2022 Dec;1869(12):119344. doi: 10.1016/j.bbamcr.2022.119344. | Click |
31 | Noscapine Increases the Sensitivity of Drug-Resistant Ovarian Cancer Cell Line SKOV3/DDP to Cisplatin by Regulating Cell Cycle and Activating Apoptotic Pathways. Cell Biochem Biophys. 2015 May;72(1):203-13. doi: 10.1007/s12013-014-0438-y. | Click |
32 | Synergistic antitumor activity of oridonin and arsenic trioxide on hepatocellular carcinoma cells. Int J Oncol. 2012;40(1):139-147. doi:10.3892/ijo.2011.1210 | Click |
33 | Phenethyl isothiocyanate and irinotecan synergistically induce cell apoptosis in colon cancer HCT 116 cells in vitro. Environ Toxicol. 2024 Jan;39(1):457-469. doi: 10.1002/tox.23993. | Click |
34 | Pterostilbene Enhances TRAIL-Induced Apoptosis through the Induction of Death Receptors and Downregulation of Cell Survival Proteins in TRAIL-Resistance Triple Negative Breast Cancer Cells. J Agric Food Chem. 2017 Dec 27;65(51):11179-11191. doi: 10.1021/acs.jafc.7b02358. | Click |
35 | Mechanism and therapeutic prospect of resveratrol combined with TRAIL in the treatment of renal cell carcinoma. Cancer Gene Ther. 2020 Aug;27(7-8):619-623. doi: 10.1038/s41417-019-0150-6. | Click |
36 | Rottlerin sensitizes colon carcinoma cells to tumor necrosis factor-related apoptosis-inducing ligand-induced apoptosis via uncoupling of the mitochondria independent of protein kinase C. Cancer Res. 2003 Aug 15;63(16):5118-25. | Click |
37 | Sanguinarine Induces Apoptosis Pathway in Multiple Myeloma Cell Lines via Inhibition of the JaK2/STAT3 Signaling. Front Oncol. 2019 Apr 17;9:285. doi: 10.3389/fonc.2019.00285. | Click |
38 | Shikonin suppresses tumor growth and synergizes with gemcitabine in a pancreatic cancer xenograft model: Involvement of NF-κB signaling pathway. Biochem Pharmacol. 2014 Apr 1;88(3):322-33. doi: 10.1016/j.bcp.2014.01.041. | Click |
39 | Shikonin sensitizes A549 cells to TRAIL-induced apoptosis through the JNK, STAT3 and AKT pathways. BMC Cell Biol. 2018 Dec 29;19(1):29. doi: 10.1186/s12860-018-0179-7. | Click |
40 | Antitumor activity of gemcitabine can be potentiated in pancreatic cancer through modulation of TLR4/NF-κB signaling by 6-shogaol. AAPS J. 2014 Mar;16(2):246-57. doi: 10.1208/s12248-013-9558-3. | Click |
41 | Epigenetic modifications and p21-cyclin B1 nexus in anticancer effect of histone deacetylase inhibitors in combination with silibinin on non-small cell lung cancer cells. Epigenetics. 2012 Oct;7(10):1161-72. doi: 10.4161/epi.22070. | Click |
42 | Tectorigenin sensitizes paclitaxel-resistant human ovarian cancer cells through downregulation of the Akt and NFκB pathway. Carcinogenesis. 2012 Dec;33(12):2488-98. doi: 10.1093/carcin/bgs302. | Click |
43 | Ursolic acid potentiated oxaliplatin to induce apoptosis in colorectal cancer RKO cells. Pharmazie. 2020 Jun 1;75(6):246-249. doi: 10.1691/ph.2020.0417. | Click |
44 | Amentoflavone enhances sorafenib-induced apoptosis through extrinsic and intrinsic pathways in sorafenib-resistant hepatocellular carcinoma SK-Hep1 cells in vitro. Oncol Lett. 2017 Sep;14(3):3229-3234. doi: 10.3892/ol.2017.6540. | Click |
45 | Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004 | Click |