TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Cytochrome c
UniProt ID CYC_HUMAN
Gene Name CYCS
Gene ID 54205
Synonyms
CYCS, CYC, HCS, THC4
Sequence
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Pathway Map MAP LINK
T.C. Number 1.A.132.1.1
KEGG ID hsa54205
Pfam PF00034; PF03150; PF13442; PF14495
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 32
Pair Name (S)-10-Hydroxycamptothecin, Crizotinib
Phytochemical (S)-10-Hydroxycamptothecin
Drug Crizotinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells
Combination Pair ID: 256
Pair Name Alpha-Hederin, Cisplatin
Phytochemical Alpha-Hederin
Drug Cisplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result α-Hederin enhances cisplatin-induced anti-tumour effects in GC both in vitro and in vivo by promoting the accumulation of ROS and decreasing MMP. Our data strongly suggested that α-Hederin is a promising candidate for intervention in gastric cancer.
Combination Pair ID: 76
Pair Name Apigenin, Doxorubicin
Phytochemical Apigenin
Drug Doxorubicin
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells
Combination Pair ID: 921
Pair Name Baicalin, Doxorubicin
Phytochemical Baicalin
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result This study demonstrate that the effect of baicalin on Dox treatment could enhance cytotoxicity toward breast cancer cells via the ROS/[Ca2+]i-mediated intrinsic apoptosis pathway-thus potentially lessening the required dosage of doxorubicin, and further exploring associated mechanisms in combined treatments for breast cancer clinical interventions in the future.
Combination Pair ID: 972
Pair Name Berbamine, Cisplatin
Phytochemical Berbamine
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result These findings indicate that Ber might be a promising adjuvant for enhancing the cancer cell killing effect of chemotherapy via the inhibition of autophagy. In this process, Nox2 might be a significant mediator of Ber-induced aberrant lysosomal acidification.
Combination Pair ID: 499
Pair Name Bisdemethoxycucurmin, Icotinib
Phytochemical Bisdemethoxycucurmin
Drug Icotinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.
Combination Pair ID: 1000
Pair Name Celastrol, Tamoxifen
Phytochemical Celastrol
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result CEL can promote apoptosis and enhance the TAM sensitivity in TNBC treatment through a mitochondria-mediated pathway.
Combination Pair ID: 14
Pair Name Cepharanthine, Epirubicin
Phytochemical Cepharanthine
Drug Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Cepharanthine sensitizes human triple negative breast cancer cells to chemotherapeutic agent epirubicin via inducing cofilin oxidation-mediated mitochondrial fission and apoptosis
Combination Pair ID: 584
Pair Name Dehydrobruceine B, Cisplatin
Phytochemical Dehydrobruceine B
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result These results generated a rationale for further investigation of DHB combined with CDDP as a potential therapeutic strategy in lung cancer.
Combination Pair ID: 590
Pair Name Delta-Tocotrienol, Cisplatin
Phytochemical Delta-Tocotrienol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis
Combination Pair ID: 331
Pair Name Eugenol, Cisplatin
Phytochemical Eugenol
Drug Cisplatin
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Eugenol showed antiproliferative and cytotoxic effects via apoptosis and also synergism with cisplatin and ionizing radiation in the human cervical cancer cell line.
Combination Pair ID: 488
Pair Name Gambogenic acid, Fluorouracil
Phytochemical Gambogenic acid
Drug Fluorouracil
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result These mechanisms may be due to the toxicity of targeted toxin to mitochondria via the mitochondrial pathway.
Combination Pair ID: 930
Pair Name Gamma-Tocotrienol, Docetaxel
Phytochemical Gamma-Tocotrienol
Drug Docetaxel
Disease Info [ICD-11: 2B66.Z] Oral cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result These findings suggest that the combination treatment with these agents may provide enhanced therapeutic response in oral cancer patients, while avoiding the toxicity associated with high-dose β-tubulin stabilization monotherapy.
Combination Pair ID: 507
Pair Name Glucosinalbate, Doxorubicin
Phytochemical Glucosinalbate
Drug Doxorubicin
Disease Info [ICD-11: 2C90] Ehrlich ascites carcinoma Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host.
Combination Pair ID: 5
Pair Name Homoharringtonine, Suberoylanilide hydroxamic acid (SAHA)
Phytochemical Homoharringtonine
Drug Suberoylanilide hydroxamic acid (SAHA)
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result The synergistic effect between HHT and SAHA was blocked partially using a specific anti‑TRAIL antibody. The combination therapy was also found to significantly inhibit the growth of leukemia xenografts in vivo with enhanced apoptosis. These results indicate that, by regulating the induction of TRAIL and activation of the TRAIL apoptotic pathway, it is possible to administer HHT at low concentrations in combination with SAHA as an effective therapeutic approach for the treatment of AML.
Combination Pair ID: 431
Pair Name Hypericin, Gemcitabine
Phytochemical Hypericin
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result We demonstrated that Gem combined HY-PDT could inhibit the proliferation of Capan-2 cells and induce cell apoptosis. HY-PDT combined with Gem had a great potential on pancreatic cancer treatment clinically.
Combination Pair ID: 83
Pair Name Isoliquiritigenin, Docosahexaenoic acid
Phytochemical Isoliquiritigenin
Drug Docosahexaenoic acid
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Excessive ROS-induced JNK activation and cytochrome c release from mitochondria played a key role in the synergistic anticancer activity of CRC cells by cotreating with DHA and ISL.
Combination Pair ID: 91
Pair Name Isorhamnetin, Chloroquine
Phytochemical Isorhamnetin
Drug Chloroquine
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Our study highlights the critical role of ROS-mediating CaMKII/Drp1 signaling in the regulation of mitochondrial fission and apoptosis induced by combination of CQ/IH. These findings also suggest that IH could potentially be further developed as a novel chemotherapeutic agent. Furthermore, a combination of IH with classic autophagy/mitophagy inhibitor could represent a novel therapeutic strategy for the treatment of TNBC.
Combination Pair ID: 311
Pair Name Juglone, Indomethacin
Phytochemical Juglone
Drug Indomethacin
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result A combination of both was shown to be more effective, suggesting that juglone may be considered for therapeutic intervention of colon cancer.
Combination Pair ID: 626
Pair Name Luteolin, Oxaliplatin
Phytochemical Luteolin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Luteolin can induce p53-mediated apoptosis regardless of oxaliplatin treatment and may eliminate oxaliplatin-resistant p53-null colorectal cells
Combination Pair ID: 627
Pair Name Luteolin, Oxaliplatin
Phytochemical Luteolin
Drug Oxaliplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Luteolin Suppresses the Proliferation of Gastric Cancer Cells and Acts in Synergy with Oxaliplatin through the Cyt c/caspase pathway
Combination Pair ID: 497
Pair Name Medicarpin, TNF-related apoptosis inducing ligand
Phytochemical Medicarpin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B33.1] Myeloid leukemia Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway
Combination Pair ID: 116
Pair Name Morin, Auranofin
Phytochemical Morin
Drug Auranofin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result This study provides evidence that morin can enhance the anticancer activity of AF in Hep3B human hepatocellular carcinoma cells, indicating that its combination could be an alternative treatment strategy for the hepatocellular carcinoma.
Combination Pair ID: 949
Pair Name Phenethyl isothiocyanate, Irinotecan
Phytochemical Phenethyl isothiocyanate
Drug Irinotecan
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result PEITC potentiates IRI anticancer activity by promoting cell apoptosis in the human colon HCT 116 cells. Thus, PEITC may be a potential enhancer for IRI in humans as an anticolon cancer drug in the future.
Combination Pair ID: 962
Pair Name Platycodin D, Venetoclax
Phytochemical Platycodin D
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Cytochrome c Expression
Result Platycodin D may be a potent therapeutic candidate for the treatment of AML
Combination Pair ID: 587
Pair Name Pristimerin, Sorafenib
Phytochemical Pristimerin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway
Combination Pair ID: 481
Pair Name Propyl gallate, Cisplatin
Phytochemical Propyl gallate
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Our data provide the potential application of PG in combination chemotherapy to enhance drug sensitivity in lung cancer by targeting HO-1.
Combination Pair ID: 978
Pair Name Quercetin, Oxaliplatin
Phytochemical Quercetin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result These findings suggest that the depletion of intracellular glutathione by quercetin and sulforaphane could strengthen the anti-cancer efficacy of oxaliplatin.
Combination Pair ID: 510
Pair Name RA-V, Doxorubicin
Phytochemical RA-V
Drug Doxorubicin
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result This work represents a versatile strategy for precise combination therapy against resistant tumor with spatiotemporal control, and provides a potential tool for Cyt c-related apoptotic studies.
Combination Pair ID: 573
Pair Name Sulforaphene, Carboplatin
Phytochemical Sulforaphene
Drug Carboplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result This study demonstrates that the duel character of this combination therapy may be an effective replacement for conventional therapy alone against NSCLC.
Combination Pair ID: 574
Pair Name Sulforaphene, Cisplatin
Phytochemical Sulforaphene
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian Cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result SFE synergistically inhibited proliferation and induced apoptosis of SKOV3 and SNU8 cells in combination with cisplatin by activating multiple apoptotic pathways. Therefore, we suggest sulforaphene as a chemo-enhancing adjuvant to improve the efficacy of cisplatin in ovarian cancer treatment.
Combination Pair ID: 576
Pair Name Sulforaphene, Photodynamic therapy
Phytochemical Sulforaphene
Drug Photodynamic therapy
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result This study could be useful in the improvement of therapies for human cervical and other types of cancers.
Combination Pair ID: 523
Pair Name Tannic acid, Cisplatin
Phytochemical Tannic acid
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result The results obtained from the present study suggest that the combination of TA and CDDP may exert synergistic anticancer effects and may be a novel adjuvant treatment for liver cancer.
Combination Pair ID: 473
Pair Name Tea polyphenol, Paclitaxel
Phytochemical Tea polyphenol
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Our results showed that the combination of green tea and PTX could be more potent than the individual drug to induce cytotoxicity and apoptosis in ovarian cancer cells.
Combination Pair ID: 16
Pair Name Tetrandrine, Sorafenib
Phytochemical Tetrandrine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result The antitumour activity of sorafenib plus tetrandrine may be attributed to the induction of the intrinsic apoptosis pathway through ROS/Akt signaling. This finding provides a novel approach that may broaden the clinical application of sorafenib.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 917
Pair Name 2,3,5,6-Tetramethylpyrazine, Cisplatin
Phytochemical 2,3,5,6-Tetramethylpyrazine
Drug Cisplatin
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result A series of ligustrazine-derived chalcones-modified platinum(IV) complexes were synthesized and evaluated for their anti-proliferative potency and generated an optimal platinum(IV) complex 16a. The above-described results indicated that 16a obtained different anti-cancer mechanisms of CDDP, which could initiate mitochondria-dependent apoptosis and xCT-GPX4 axial-mediated ferroptosis in PANC-1/CDDP cells.
Combination Pair ID: 15
Pair Name Cepharanthine, Cisplatin
Phytochemical Cepharanthine
Drug Cisplatin
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals
Combination Pair ID: 612
Pair Name Platycodin D, Histone deacetylase inhibitor
Phytochemical Platycodin D
Drug Histone deacetylase inhibitor
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Cytochrome c Expression
Result Platycodin D reverses histone deacetylase inhibitor resistance in hepatocellular carcinoma cells by repressing ERK1/2-mediated cofilin-1 phosphorylation
03. Reference
No. Title Href
1 Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells. J Enzyme Inhib Med Chem. 2023 Dec;38(1):1-11. doi: 10.1080/14756366.2022.2132487. Click
2 Combining α-Hederin with cisplatin increases the apoptosis of gastric cancer in vivo and in vitro via mitochondrial related apoptosis pathway. Biomed Pharmacother. 2019 Dec;120:109477. doi: 10.1016/j.biopha.2019.109477. Click
3 Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells. Exp Oncol. 2021 Jun;43(2):125-134. doi: 10.32471/exp-oncology.2312-8852.vol-43-no-2.16096. Click
4 Baicalin Enhances Chemosensitivity to Doxorubicin in Breast Cancer Cells via Upregulation of Oxidative Stress-Mediated Mitochondria-Dependent Apoptosis. Antioxidants (Basel). 2021;10(10):1506. Published 2021 Sep 23. doi:10.3390/antiox10101506 Click
5 Berbamine Hydrochloride inhibits lysosomal acidification by activating Nox2 to potentiate chemotherapy-induced apoptosis via the ROS-MAPK pathway in human lung carcinoma cells. Cell Biol Toxicol. 2023 Aug;39(4):1297-1317. doi: 10.1007/s10565-022-09756-8. Click
6 Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib. Click
7 Celastrol enhances tamoxifen sensitivity in the treatment of triple negative breast cancer via mitochondria mediated apoptosis pathway. Am J Transl Res. 2023 Apr 15;15(4):2703-2715. Click
8 Cepharanthine sensitizes human triple negative breast cancer cells to chemotherapeutic agent epirubicin via inducing cofilin oxidation-mediated mitochondrial fission and apoptosis. Acta Pharmacol Sin. 2022 Jan;43(1):177-193. doi: 10.1038/s41401-021-00715-3. Click
9 Dehydrobruceine B enhances the cisplatin-induced cytotoxicity through regulation of the mitochondrial apoptotic pathway in lung cancer A549 cells. Biomed Pharmacother. 2017 May;89:623-631. doi: 10.1016/j.biopha.2017.02.055. Click
10 δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis. Cell Prolif. 2021 Nov;54(11):e13111. doi: 10.1111/cpr.13111. Click
11 Eugenol Exerts Apoptotic Effect and Modulates the Sensitivity of HeLa Cells to Cisplatin and Radiation. Molecules. 2019 Nov 3;24(21):3979. doi: 10.3390/molecules24213979. Click
12 Synergistic effects of 5-fluorouracil and gambogenic acid on A549 cells: activation of cell death caused by apoptotic and necroptotic mechanisms via the ROS-mitochondria pathway. Biol Pharm Bull. 2014;37(8):1259-68. doi: 10.1248/bpb.b13-00972. Click
13 γ-tocotrienol enhances the chemosensitivity of human oral cancer cells to docetaxel through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 Click
14 Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. Click
15 Homoharringtonine and SAHA synergistically enhance apoptosis in human acute myeloid leukemia cells through upregulation of TRAIL and death receptors. Mol Med Rep. 2013 Jun;7(6):1838-44. doi: 10.3892/mmr.2013.1440. Click
16 Hypericin-mediated photodynamic therapy enhances gemcitabine induced Capan-2 cell apoptosis via inhibiting NADPH level. J Pharm Pharmacol. 2022 Apr 20;74(4):596-604. doi: 10.1093/jpp/rgab073. Click
17 Synergistic anticancer effect of docosahexaenoic acid and isoliquiritigenin on human colorectal cancer cells through ROS-mediated regulation of the JNK and cytochrome c release. Mol Biol Rep. 2021 Feb;48(2):1171-1180. doi: 10.1007/s11033-021-06159-6. Click
18 ROS-mediated activation and mitochondrial translocation of CaMKII contributes to Drp1-dependent mitochondrial fission and apoptosis in triple-negative breast cancer cells by isorhamnetin and chloroquine. J Exp Clin Cancer Res. 2019 May 28;38(1):225. doi: 10.1186/s13046-019-1201-4. Click
19 Indomethacin and juglone inhibit inflammatory molecules to induce apoptosis in colon cancer cells. J Biochem Mol Toxicol. 2020 Feb;34(2):e22433. doi: 10.1002/jbt.22433. Click
20 Luteolin Shifts Oxaliplatin-Induced Cell Cycle Arrest at G₀/G₁ to Apoptosis in HCT116 Human Colorectal Carcinoma Cells. Nutrients. 2019 Apr 2;11(4):770. doi: 10.3390/nu11040770. Click
21 Luteolin Suppresses the Proliferation of Gastric Cancer Cells and Acts in Synergy with Oxaliplatin. Biomed Res Int. 2020 Feb 21;2020:9396512. doi: 10.1155/2020/9396512. Click
22 Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. Click
23 Morin enhances auranofin anticancer activity by up-regulation of DR4 and DR5 and modulation of Bcl-2 through reactive oxygen species generation in Hep3B human hepatocellular carcinoma cells. Phytother Res. 2019 May;33(5):1384-1393. doi: 10.1002/ptr.6329. Click
24 Phenethyl isothiocyanate and irinotecan synergistically induce cell apoptosis in colon cancer HCT 116 cells in vitro. Environ Toxicol. 2024 Jan;39(1):457-469. doi: 10.1002/tox.23993. Click
25 Platycodin D induces apoptotic cell death through PI3K/AKT and MAPK/ERK pathways and synergizes with venetoclax in acute myeloid leukemia. Eur J Pharmacol. 2023 Oct 5;956:175957. doi: 10.1016/j.ejphar.2023.175957. Click
26 Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway. Phytomedicine. 2021 Jun;86:153563. doi: 10.1016/j.phymed.2021.153563. Click
27 Propyl gallate sensitizes human lung cancer cells to cisplatin-induced apoptosis by targeting heme oxygenase-1 for TRC8-mediated degradation. Eur J Pharmacol. 2016 Oct 5;788:321-327. doi: 10.1016/j.ejphar.2016.06.052. Click
28 Quercetin-Induced Glutathione Depletion Sensitizes Colorectal Cancer Cells to Oxaliplatin. Foods. 2023 Apr 21;12(8):1733. doi: 10.3390/foods12081733. Click
29 Sequential Delivery of Cyclopeptide RA-V and Doxorubicin for Combination Therapy on Resistant Tumor and In Situ Monitoring of Cytochrome c Release. Theranostics. 2017 Aug 23;7(15):3781-3793. doi: 10.7150/thno.20892. Click
30 Sulforaphene-Carboplatin Combination Synergistically Enhances Apoptosis by Disruption of Mitochondrial Membrane Potential and Cell Cycle Arrest in Human Non-Small Cell Lung Carcinoma. J Med Food. 2016 Sep;19(9):860-9. doi: 10.1089/jmf.2016.3675. Click
31 Sulforaphene Synergistically Sensitizes Cisplatin via Enhanced Mitochondrial Dysfunction and PI3K/PTEN Modulation in Ovarian Cancer Cells. Anticancer Res. 2015 Jul;35(7):3901-8. Click
32 Evaluation of synergistic effects of sulforaphene with photodynamic therapy in human cervical cancer cell line. Lasers Med Sci. 2016 Nov;31(8):1675-1682. doi: 10.1007/s10103-016-2037-1. Click
33 Tannic acid synergistically enhances the anticancer efficacy of cisplatin on liver cancer cells through mitochondria‑mediated apoptosis. Oncol Rep. 2019 Nov;42(5):2108-2116. doi: 10.3892/or.2019.7281. Click
34 Synergistic effects of green tea extract and paclitaxel in the induction of mitochondrial apoptosis in ovarian cancer cell lines. Gene. 2021 Jun 30;787:145638. doi: 10.1016/j.gene.2021.145638. Click
35 Synergistic antitumour activity of sorafenib in combination with tetrandrine is mediated by reactive oxygen species (ROS)/Akt signaling. Br J Cancer. 2013 Jul 23;109(2):342-50. doi: 10.1038/bjc.2013.334. Click
36 Ligustrazine-Derived Chalcones-Modified Platinum(IV) Complexes Intervene in Cisplatin Resistance in Pancreatic Cancer through Ferroptosis and Apoptosis. J Med Chem. 2023 Oct 12;66(19):13587-13606. doi: 10.1021/acs.jmedchem.3c00922. Click
37 Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals. Oncotarget. 2017 Nov 27;8(67):111144-111160. doi: 10.18632/oncotarget.22676. Click
38 Platycodin D reverses histone deacetylase inhibitor resistance in hepatocellular carcinoma cells by repressing ERK1/2-mediated cofilin-1 phosphorylation. Phytomedicine. 2021 Feb;82:153442. doi: 10.1016/j.phymed.2020.153442. Click
It has been 46902 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP