Name | Cytochrome c | ||
UniProt ID | CYC_HUMAN | ||
Gene Name | CYCS | ||
Gene ID | 54205 | ||
Synonyms |
CYCS, CYC, HCS, THC4
|
||
Sequence |
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE |
||
Pathway Map | MAP LINK | ||
T.C. Number | 1.A.132.1.1 | ||
KEGG ID | hsa54205 | ||
Pfam | PF00034; PF03150; PF13442; PF14495 |
Pair Name | (S)-10-Hydroxycamptothecin, Crizotinib | |||
Phytochemical | (S)-10-Hydroxycamptothecin | |||
Drug | Crizotinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells |
Pair Name | Alpha-Hederin, Cisplatin | |||
Phytochemical | Alpha-Hederin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | α-Hederin enhances cisplatin-induced anti-tumour effects in GC both in vitro and in vivo by promoting the accumulation of ROS and decreasing MMP. Our data strongly suggested that α-Hederin is a promising candidate for intervention in gastric cancer. |
Pair Name | Apigenin, Doxorubicin | |||
Phytochemical | Apigenin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells |
Pair Name | Baicalin, Doxorubicin | |||
Phytochemical | Baicalin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | This study demonstrate that the effect of baicalin on Dox treatment could enhance cytotoxicity toward breast cancer cells via the ROS/[Ca2+]i-mediated intrinsic apoptosis pathway-thus potentially lessening the required dosage of doxorubicin, and further exploring associated mechanisms in combined treatments for breast cancer clinical interventions in the future. |
Pair Name | Berbamine, Cisplatin | |||
Phytochemical | Berbamine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | These findings indicate that Ber might be a promising adjuvant for enhancing the cancer cell killing effect of chemotherapy via the inhibition of autophagy. In this process, Nox2 might be a significant mediator of Ber-induced aberrant lysosomal acidification. |
Pair Name | Bisdemethoxycucurmin, Icotinib | |||
Phytochemical | Bisdemethoxycucurmin | |||
Drug | Icotinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib. |
Pair Name | Celastrol, Tamoxifen | |||
Phytochemical | Celastrol | |||
Drug | Tamoxifen | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | CEL can promote apoptosis and enhance the TAM sensitivity in TNBC treatment through a mitochondria-mediated pathway. |
Pair Name | Cepharanthine, Epirubicin | |||
Phytochemical | Cepharanthine | |||
Drug | Epirubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Cepharanthine sensitizes human triple negative breast cancer cells to chemotherapeutic agent epirubicin via inducing cofilin oxidation-mediated mitochondrial fission and apoptosis |
Pair Name | Dehydrobruceine B, Cisplatin | |||
Phytochemical | Dehydrobruceine B | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | These results generated a rationale for further investigation of DHB combined with CDDP as a potential therapeutic strategy in lung cancer. |
Pair Name | Delta-Tocotrienol, Cisplatin | |||
Phytochemical | Delta-Tocotrienol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis |
Pair Name | Eugenol, Cisplatin | |||
Phytochemical | Eugenol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Eugenol showed antiproliferative and cytotoxic effects via apoptosis and also synergism with cisplatin and ionizing radiation in the human cervical cancer cell line. |
Pair Name | Gambogenic acid, Fluorouracil | |||
Phytochemical | Gambogenic acid | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | These mechanisms may be due to the toxicity of targeted toxin to mitochondria via the mitochondrial pathway. |
Pair Name | Gamma-Tocotrienol, Docetaxel | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Docetaxel | |||
Disease Info | [ICD-11: 2B66.Z] | Oral cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | These findings suggest that the combination treatment with these agents may provide enhanced therapeutic response in oral cancer patients, while avoiding the toxicity associated with high-dose β-tubulin stabilization monotherapy. |
Pair Name | Glucosinalbate, Doxorubicin | |||
Phytochemical | Glucosinalbate | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C90] | Ehrlich ascites carcinoma | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host. |
Pair Name | Homoharringtonine, Suberoylanilide hydroxamic acid (SAHA) | |||
Phytochemical | Homoharringtonine | |||
Drug | Suberoylanilide hydroxamic acid (SAHA) | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | The synergistic effect between HHT and SAHA was blocked partially using a specific anti‑TRAIL antibody. The combination therapy was also found to significantly inhibit the growth of leukemia xenografts in vivo with enhanced apoptosis. These results indicate that, by regulating the induction of TRAIL and activation of the TRAIL apoptotic pathway, it is possible to administer HHT at low concentrations in combination with SAHA as an effective therapeutic approach for the treatment of AML. |
Pair Name | Hypericin, Gemcitabine | |||
Phytochemical | Hypericin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | We demonstrated that Gem combined HY-PDT could inhibit the proliferation of Capan-2 cells and induce cell apoptosis. HY-PDT combined with Gem had a great potential on pancreatic cancer treatment clinically. |
Pair Name | Isoliquiritigenin, Docosahexaenoic acid | |||
Phytochemical | Isoliquiritigenin | |||
Drug | Docosahexaenoic acid | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Excessive ROS-induced JNK activation and cytochrome c release from mitochondria played a key role in the synergistic anticancer activity of CRC cells by cotreating with DHA and ISL. |
Pair Name | Isorhamnetin, Chloroquine | |||
Phytochemical | Isorhamnetin | |||
Drug | Chloroquine | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Our study highlights the critical role of ROS-mediating CaMKII/Drp1 signaling in the regulation of mitochondrial fission and apoptosis induced by combination of CQ/IH. These findings also suggest that IH could potentially be further developed as a novel chemotherapeutic agent. Furthermore, a combination of IH with classic autophagy/mitophagy inhibitor could represent a novel therapeutic strategy for the treatment of TNBC. |
Pair Name | Juglone, Indomethacin | |||
Phytochemical | Juglone | |||
Drug | Indomethacin | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | A combination of both was shown to be more effective, suggesting that juglone may be considered for therapeutic intervention of colon cancer. |
Pair Name | Luteolin, Oxaliplatin | |||
Phytochemical | Luteolin | |||
Drug | Oxaliplatin | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Luteolin can induce p53-mediated apoptosis regardless of oxaliplatin treatment and may eliminate oxaliplatin-resistant p53-null colorectal cells |
Pair Name | Luteolin, Oxaliplatin | |||
Phytochemical | Luteolin | |||
Drug | Oxaliplatin | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Luteolin Suppresses the Proliferation of Gastric Cancer Cells and Acts in Synergy with Oxaliplatin through the Cyt c/caspase pathway |
Pair Name | Medicarpin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Medicarpin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B33.1] | Myeloid leukemia | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway |
Pair Name | Morin, Auranofin | |||
Phytochemical | Morin | |||
Drug | Auranofin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | This study provides evidence that morin can enhance the anticancer activity of AF in Hep3B human hepatocellular carcinoma cells, indicating that its combination could be an alternative treatment strategy for the hepatocellular carcinoma. |
Pair Name | Phenethyl isothiocyanate, Irinotecan | |||
Phytochemical | Phenethyl isothiocyanate | |||
Drug | Irinotecan | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | PEITC potentiates IRI anticancer activity by promoting cell apoptosis in the human colon HCT 116 cells. Thus, PEITC may be a potential enhancer for IRI in humans as an anticolon cancer drug in the future. |
Pair Name | Platycodin D, Venetoclax | |||
Phytochemical | Platycodin D | |||
Drug | Venetoclax | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Cytochrome c | Expression | |
Result | Platycodin D may be a potent therapeutic candidate for the treatment of AML |
Pair Name | Pristimerin, Sorafenib | |||
Phytochemical | Pristimerin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway |
Pair Name | Propyl gallate, Cisplatin | |||
Phytochemical | Propyl gallate | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Our data provide the potential application of PG in combination chemotherapy to enhance drug sensitivity in lung cancer by targeting HO-1. |
Pair Name | Quercetin, Oxaliplatin | |||
Phytochemical | Quercetin | |||
Drug | Oxaliplatin | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | These findings suggest that the depletion of intracellular glutathione by quercetin and sulforaphane could strengthen the anti-cancer efficacy of oxaliplatin. |
Pair Name | RA-V, Doxorubicin | |||
Phytochemical | RA-V | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | This work represents a versatile strategy for precise combination therapy against resistant tumor with spatiotemporal control, and provides a potential tool for Cyt c-related apoptotic studies. |
Pair Name | Sulforaphene, Carboplatin | |||
Phytochemical | Sulforaphene | |||
Drug | Carboplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | This study demonstrates that the duel character of this combination therapy may be an effective replacement for conventional therapy alone against NSCLC. |
Pair Name | Sulforaphene, Cisplatin | |||
Phytochemical | Sulforaphene | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian Cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | SFE synergistically inhibited proliferation and induced apoptosis of SKOV3 and SNU8 cells in combination with cisplatin by activating multiple apoptotic pathways. Therefore, we suggest sulforaphene as a chemo-enhancing adjuvant to improve the efficacy of cisplatin in ovarian cancer treatment. |
Pair Name | Sulforaphene, Photodynamic therapy | |||
Phytochemical | Sulforaphene | |||
Drug | Photodynamic therapy | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | This study could be useful in the improvement of therapies for human cervical and other types of cancers. |
Pair Name | Tannic acid, Cisplatin | |||
Phytochemical | Tannic acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | The results obtained from the present study suggest that the combination of TA and CDDP may exert synergistic anticancer effects and may be a novel adjuvant treatment for liver cancer. |
Pair Name | Tea polyphenol, Paclitaxel | |||
Phytochemical | Tea polyphenol | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Our results showed that the combination of green tea and PTX could be more potent than the individual drug to induce cytotoxicity and apoptosis in ovarian cancer cells. |
Pair Name | Tetrandrine, Sorafenib | |||
Phytochemical | Tetrandrine | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | The antitumour activity of sorafenib plus tetrandrine may be attributed to the induction of the intrinsic apoptosis pathway through ROS/Akt signaling. This finding provides a novel approach that may broaden the clinical application of sorafenib. |
Pair Name | 2,3,5,6-Tetramethylpyrazine, Cisplatin | |||
Phytochemical | 2,3,5,6-Tetramethylpyrazine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | A series of ligustrazine-derived chalcones-modified platinum(IV) complexes were synthesized and evaluated for their anti-proliferative potency and generated an optimal platinum(IV) complex 16a. The above-described results indicated that 16a obtained different anti-cancer mechanisms of CDDP, which could initiate mitochondria-dependent apoptosis and xCT-GPX4 axial-mediated ferroptosis in PANC-1/CDDP cells. |
Pair Name | Cepharanthine, Cisplatin | |||
Phytochemical | Cepharanthine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B70] | Esophageal cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals |
Pair Name | Platycodin D, Histone deacetylase inhibitor | |||
Phytochemical | Platycodin D | |||
Drug | Histone deacetylase inhibitor | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Cytochrome c | Expression | |
Result | Platycodin D reverses histone deacetylase inhibitor resistance in hepatocellular carcinoma cells by repressing ERK1/2-mediated cofilin-1 phosphorylation |
No. | Title | Href |
---|---|---|
1 | Development of 10-Hydroxycamptothecin-crizotinib conjugate based on the synergistic effect on lung cancer cells. J Enzyme Inhib Med Chem. 2023 Dec;38(1):1-11. doi: 10.1080/14756366.2022.2132487. | Click |
2 | Combining α-Hederin with cisplatin increases the apoptosis of gastric cancer in vivo and in vitro via mitochondrial related apoptosis pathway. Biomed Pharmacother. 2019 Dec;120:109477. doi: 10.1016/j.biopha.2019.109477. | Click |
3 | Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells. Exp Oncol. 2021 Jun;43(2):125-134. doi: 10.32471/exp-oncology.2312-8852.vol-43-no-2.16096. | Click |
4 | Baicalin Enhances Chemosensitivity to Doxorubicin in Breast Cancer Cells via Upregulation of Oxidative Stress-Mediated Mitochondria-Dependent Apoptosis. Antioxidants (Basel). 2021;10(10):1506. Published 2021 Sep 23. doi:10.3390/antiox10101506 | Click |
5 | Berbamine Hydrochloride inhibits lysosomal acidification by activating Nox2 to potentiate chemotherapy-induced apoptosis via the ROS-MAPK pathway in human lung carcinoma cells. Cell Biol Toxicol. 2023 Aug;39(4):1297-1317. doi: 10.1007/s10565-022-09756-8. | Click |
6 | Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib. | Click |
7 | Celastrol enhances tamoxifen sensitivity in the treatment of triple negative breast cancer via mitochondria mediated apoptosis pathway. Am J Transl Res. 2023 Apr 15;15(4):2703-2715. | Click |
8 | Cepharanthine sensitizes human triple negative breast cancer cells to chemotherapeutic agent epirubicin via inducing cofilin oxidation-mediated mitochondrial fission and apoptosis. Acta Pharmacol Sin. 2022 Jan;43(1):177-193. doi: 10.1038/s41401-021-00715-3. | Click |
9 | Dehydrobruceine B enhances the cisplatin-induced cytotoxicity through regulation of the mitochondrial apoptotic pathway in lung cancer A549 cells. Biomed Pharmacother. 2017 May;89:623-631. doi: 10.1016/j.biopha.2017.02.055. | Click |
10 | δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis. Cell Prolif. 2021 Nov;54(11):e13111. doi: 10.1111/cpr.13111. | Click |
11 | Eugenol Exerts Apoptotic Effect and Modulates the Sensitivity of HeLa Cells to Cisplatin and Radiation. Molecules. 2019 Nov 3;24(21):3979. doi: 10.3390/molecules24213979. | Click |
12 | Synergistic effects of 5-fluorouracil and gambogenic acid on A549 cells: activation of cell death caused by apoptotic and necroptotic mechanisms via the ROS-mitochondria pathway. Biol Pharm Bull. 2014;37(8):1259-68. doi: 10.1248/bpb.b13-00972. | Click |
13 | γ-tocotrienol enhances the chemosensitivity of human oral cancer cells to docetaxel through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 | Click |
14 | Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. | Click |
15 | Homoharringtonine and SAHA synergistically enhance apoptosis in human acute myeloid leukemia cells through upregulation of TRAIL and death receptors. Mol Med Rep. 2013 Jun;7(6):1838-44. doi: 10.3892/mmr.2013.1440. | Click |
16 | Hypericin-mediated photodynamic therapy enhances gemcitabine induced Capan-2 cell apoptosis via inhibiting NADPH level. J Pharm Pharmacol. 2022 Apr 20;74(4):596-604. doi: 10.1093/jpp/rgab073. | Click |
17 | Synergistic anticancer effect of docosahexaenoic acid and isoliquiritigenin on human colorectal cancer cells through ROS-mediated regulation of the JNK and cytochrome c release. Mol Biol Rep. 2021 Feb;48(2):1171-1180. doi: 10.1007/s11033-021-06159-6. | Click |
18 | ROS-mediated activation and mitochondrial translocation of CaMKII contributes to Drp1-dependent mitochondrial fission and apoptosis in triple-negative breast cancer cells by isorhamnetin and chloroquine. J Exp Clin Cancer Res. 2019 May 28;38(1):225. doi: 10.1186/s13046-019-1201-4. | Click |
19 | Indomethacin and juglone inhibit inflammatory molecules to induce apoptosis in colon cancer cells. J Biochem Mol Toxicol. 2020 Feb;34(2):e22433. doi: 10.1002/jbt.22433. | Click |
20 | Luteolin Shifts Oxaliplatin-Induced Cell Cycle Arrest at G₀/G₁ to Apoptosis in HCT116 Human Colorectal Carcinoma Cells. Nutrients. 2019 Apr 2;11(4):770. doi: 10.3390/nu11040770. | Click |
21 | Luteolin Suppresses the Proliferation of Gastric Cancer Cells and Acts in Synergy with Oxaliplatin. Biomed Res Int. 2020 Feb 21;2020:9396512. doi: 10.1155/2020/9396512. | Click |
22 | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. | Click |
23 | Morin enhances auranofin anticancer activity by up-regulation of DR4 and DR5 and modulation of Bcl-2 through reactive oxygen species generation in Hep3B human hepatocellular carcinoma cells. Phytother Res. 2019 May;33(5):1384-1393. doi: 10.1002/ptr.6329. | Click |
24 | Phenethyl isothiocyanate and irinotecan synergistically induce cell apoptosis in colon cancer HCT 116 cells in vitro. Environ Toxicol. 2024 Jan;39(1):457-469. doi: 10.1002/tox.23993. | Click |
25 | Platycodin D induces apoptotic cell death through PI3K/AKT and MAPK/ERK pathways and synergizes with venetoclax in acute myeloid leukemia. Eur J Pharmacol. 2023 Oct 5;956:175957. doi: 10.1016/j.ejphar.2023.175957. | Click |
26 | Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway. Phytomedicine. 2021 Jun;86:153563. doi: 10.1016/j.phymed.2021.153563. | Click |
27 | Propyl gallate sensitizes human lung cancer cells to cisplatin-induced apoptosis by targeting heme oxygenase-1 for TRC8-mediated degradation. Eur J Pharmacol. 2016 Oct 5;788:321-327. doi: 10.1016/j.ejphar.2016.06.052. | Click |
28 | Quercetin-Induced Glutathione Depletion Sensitizes Colorectal Cancer Cells to Oxaliplatin. Foods. 2023 Apr 21;12(8):1733. doi: 10.3390/foods12081733. | Click |
29 | Sequential Delivery of Cyclopeptide RA-V and Doxorubicin for Combination Therapy on Resistant Tumor and In Situ Monitoring of Cytochrome c Release. Theranostics. 2017 Aug 23;7(15):3781-3793. doi: 10.7150/thno.20892. | Click |
30 | Sulforaphene-Carboplatin Combination Synergistically Enhances Apoptosis by Disruption of Mitochondrial Membrane Potential and Cell Cycle Arrest in Human Non-Small Cell Lung Carcinoma. J Med Food. 2016 Sep;19(9):860-9. doi: 10.1089/jmf.2016.3675. | Click |
31 | Sulforaphene Synergistically Sensitizes Cisplatin via Enhanced Mitochondrial Dysfunction and PI3K/PTEN Modulation in Ovarian Cancer Cells. Anticancer Res. 2015 Jul;35(7):3901-8. | Click |
32 | Evaluation of synergistic effects of sulforaphene with photodynamic therapy in human cervical cancer cell line. Lasers Med Sci. 2016 Nov;31(8):1675-1682. doi: 10.1007/s10103-016-2037-1. | Click |
33 | Tannic acid synergistically enhances the anticancer efficacy of cisplatin on liver cancer cells through mitochondria‑mediated apoptosis. Oncol Rep. 2019 Nov;42(5):2108-2116. doi: 10.3892/or.2019.7281. | Click |
34 | Synergistic effects of green tea extract and paclitaxel in the induction of mitochondrial apoptosis in ovarian cancer cell lines. Gene. 2021 Jun 30;787:145638. doi: 10.1016/j.gene.2021.145638. | Click |
35 | Synergistic antitumour activity of sorafenib in combination with tetrandrine is mediated by reactive oxygen species (ROS)/Akt signaling. Br J Cancer. 2013 Jul 23;109(2):342-50. doi: 10.1038/bjc.2013.334. | Click |
36 | Ligustrazine-Derived Chalcones-Modified Platinum(IV) Complexes Intervene in Cisplatin Resistance in Pancreatic Cancer through Ferroptosis and Apoptosis. J Med Chem. 2023 Oct 12;66(19):13587-13606. doi: 10.1021/acs.jmedchem.3c00922. | Click |
37 | Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals. Oncotarget. 2017 Nov 27;8(67):111144-111160. doi: 10.18632/oncotarget.22676. | Click |
38 | Platycodin D reverses histone deacetylase inhibitor resistance in hepatocellular carcinoma cells by repressing ERK1/2-mediated cofilin-1 phosphorylation. Phytomedicine. 2021 Feb;82:153442. doi: 10.1016/j.phymed.2020.153442. | Click |