TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Transcription factor p65
UniProt ID TF65_HUMAN
Gene Name RELA
Gene ID 5970
Synonyms
RELA, AIF3BL3, CMCU, NFKB3, p65
Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
Pathway Map MAP LINK
T.C. Number 1.A.1.1.1; 1.A.1.10.3; 1.A.1.10.7; 1.A.1.10.8
KEGG ID hsa5970
TTD ID T83145
Pfam PF00554; PF16179
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 135
Pair Name Ononin, Paclitaxel
Phytochemical Name Ononin
Anticancer drug Name Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Our findings suggested that the therapeutic index of PTX-based chemotherapy could be improved by reducing toxicity with increasing antitumor capabilities when combined with ononin.
Combination Pair ID: 1004
Pair Name Artesunate, Fluorouracil
Phytochemical Name Artesunate
Anticancer drug Name Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result Our findings point to the crucial treatment effect of Arte on inflammation, intestinal cell senescence, and CRC cell proliferation and offer a new option for CRC treatment.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 21
Pair Name Evodiamine, Gemcitabine
Phytochemical Evodiamine
Drug Gemcitabine
Disease Info [ICD-11: 2B62.Z] Tongue cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result The results of this study showed that EVO may inhibit cancer cells by suppressing NF-κB activity, and in combination with GEM, it may increase the chemosensitivity of tongue squamous cancer cells, thereby improving the treatment response.
Combination Pair ID: 24
Pair Name Lycorine, Temozolomide
Phytochemical Lycorine
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result Our study suggested that lycorine exerts an anti-glioma effect by inducing ROS production and inhibiting NF-κB, which validated that lycorine may be a potential candidate for glioma treatment alone or in combination with TMZ.
Combination Pair ID: 975
Pair Name Quercetin, Anti-PD-1 antibody
Phytochemical Quercetin
Drug Anti-PD-1 antibody
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity.
Combination Pair ID: 74
Pair Name Baicalein, Cisplatin
Phytochemical Baicalein
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway
Combination Pair ID: 88
Pair Name Hyperoside, Paclitaxel
Phytochemical Hyperoside
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Hyperoside may elevate breast cancer cell sensitivity to paclitaxel by blocking TLR4 activation-mediated pro-inflammatory and pro-survival approaches, thereby endorsing its usefulness as a promising therapeutic combination to overcome chemosensitivity in breast cancer.
Combination Pair ID: 94
Pair Name Amentoflavone, Cisplatin
Phytochemical Amentoflavone
Drug Cisplatin
Disease Info [ICD-11: 2B66.0] Oral squamous cell carcinoma Investigative
Regulate Info Down-regulation Transcription factor p65 Activity
Result Inactivation of NF-κB and induction of apoptosis through intrinsic caspase-dependent and independent apoptotic pathways are associated with amentoflavone enhanced anti-OSCC efficacy of cisplatin.
Combination Pair ID: 657
Pair Name Norizalpinin, Cisplatin
Phytochemical Norizalpinin
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Our data indicated a novel therapeutic strategy to potentiate DDP-induced anti-tumor effect in lung cancer cells with DDP resistance by GG through inactivating p-STAT3/p65 and Bcl-2 pathways.
Combination Pair ID: 145
Pair Name Helichrysetin, Tumor necrosis factor-alpha
Phytochemical Helichrysetin
Drug Tumor necrosis factor-alpha
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result Helichrysetin and TNF‑α synergistically promoted apoptosis by inhibiting TAK1/IKK/NF‑κB and TAK1/EGFR signaling pathways in HeLa and T98G cells, indicating a potential therapeutic strategy for cancer.
Combination Pair ID: 185
Pair Name Astragaloside IV, Carboplatin
Phytochemical Astragaloside IV
Drug Carboplatin
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result Our results suggested that AgIV enhanced carboplatin sensitivity in prostate cancer cell lines by suppressing AKT/NF-κB signaling, thus suppressed epithelial-mesenchymal transition induced by carboplatin. Our findings provided a new mechanism for AgIV in overcoming drug resistance of platinum-based chemotherapy and suggested a potential combination therapy of AgIV and carboplatin in prostate cancer.
Combination Pair ID: 681
Pair Name Ursolic acid, Cisplatin
Phytochemical Ursolic acid
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result The combination of UA with DDP could more effectively inhibit SiHa cells proliferation and facilitate cell apoptosis through suppressing NF-κB p65.
Combination Pair ID: 226
Pair Name Curcumol, Cisplatin
Phytochemical Curcumol
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result The findings may offer new thoughts that curcumol in combination with cisplatin might be a useful strategy for GC management.
Combination Pair ID: 236
Pair Name Beta-Elemene, Fluorouracil
Phytochemical Beta-Elemene
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result The conclusion obtained, considering that the results suggest that the combination may be important specifically in the treatment of TNBC.
Combination Pair ID: 739
Pair Name Crocin, Sorafenib
Phytochemical Crocin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result CR potentiates the suppressive effects of SB on tumor growth and provides the opportunity to strengthen the therapeutic effects of SB in the treatment of HCC.
Combination Pair ID: 249
Pair Name Tubeimoside I, Temozolomide
Phytochemical Tubeimoside I
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result We first demonstrated that synergistic effects of TBMS1 and TMZ induced apoptosis in GBM cells through reducing MGMT expression and inhibiting the EGFR induced PI3K/Akt/mTOR/NF-κB signaling pathway. This study provides a rationale for combined application of TMZ and TBMS1 as a potential chemotherapeutic treatment for MGMT+ GBM patients.
Combination Pair ID: 746
Pair Name Thymoquinone, Bortezomib
Phytochemical Thymoquinone
Drug Bortezomib
Disease Info [ICD-11: 2A85.5] Mantle cell lymphoma Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-KappaB regulated gene products in multiple myeloma xenograft mouse model
Combination Pair ID: 763
Pair Name Honokiol, Oxaliplatin
Phytochemical Honokiol
Drug Oxaliplatin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result This combination allows a reduction in oxaliplatin dose, and thereby reduces its adverse effects. It may also enhance the chemotherapeutic effect of oxaliplatin for this disease.
Combination Pair ID: 782
Pair Name Eugenol, Cisplatin
Phytochemical Eugenol
Drug Cisplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result These results provide strong preclinical justification for combining cisplatin with eugenol as therapeutic approach for triple-negative breast cancers through targeting the resistant ALDH-positive cells and inhibiting the NF-κB pathway.
Combination Pair ID: 332
Pair Name Bergamottin, Simvastatin
Phytochemical Bergamottin
Drug Simvastatin
Disease Info [ICD-11: 2A20.1] Chronic myelogenous leukemia Investigative
Regulate Info Up-regulation Transcription factor p65 Expression
Result Discussion and conclusion Our results provide novel insight into the role of SV and BGM in potentially preventing and treating cancer through modulation of NF-κB signalling pathway and its regulated gene products.
Combination Pair ID: 359
Pair Name Polyphyllin I, Enzalutamide
Phytochemical Polyphyllin I
Drug Enzalutamide
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Our results indicate that PPI inhibits the growth of CRPC cells by inhibiting p65 protein and concomitantly reducing HOTAIR expression, thereby suppressing MUC1 gene expression. The novel regulatory interaction of p65 and HOTAIR converge in the inhibition of MUC1 expression and overall PPI response. The combination of PPI and enzalutamide exhibits synergy. This study reveals a novel mechanism underlying the synergistic inhibitory effect of PPI and enzalutamide on the growth of CRPC cells.
Combination Pair ID: 397
Pair Name Curcumin, Pyridoxine
Phytochemical Curcumin
Drug Pyridoxine
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result C + B is superior to either agent alone in preventing obesity-promoted colorectal carcinogenesis. Augmented suppression of procancerous signaling pathways may be the means by which this augmentation occurs.
Combination Pair ID: 399
Pair Name Curcumin, Paclitaxel
Phytochemical Curcumin
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Curcumin reduces paclitaxel resistance in ovarian carcinoma cells by upregulating SNIP1 and inhibiting NFκB activity
Combination Pair ID: 422
Pair Name Icaritin, TNF-related apoptosis inducing ligand
Phytochemical Icaritin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result These data suggest that icaritin sensitizes TRAIL-induced tumor cell apoptosis via suppression of NF-κB-dependent c-FLIP expression, providing in vitro evidence supporting the notion that icaritin is a potential sensitizer of TRAIL in anticancer therapy against human GBM.
Combination Pair ID: 435
Pair Name Garcinol, Paclitaxel
Phytochemical Garcinol
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model
Combination Pair ID: 870
Pair Name Shogaol, Gemcitabine
Phytochemical Shogaol
Drug Gemcitabine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result Our results suggest that 6-shogaol can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing of TLR4/NF-κB-mediated inflammatory pathways linked to tumorigenesis.
Combination Pair ID: 480
Pair Name Tectochrysin, Cetuximab
Phytochemical Tectochrysin
Drug Cetuximab
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Our results indicate that combined therapy with lower concentration of cetuximab and tectochrysin could significantly enhance the cancer cell growth inhibitory effect through the inhibition of EGFR signaling.
Combination Pair ID: 482
Pair Name Propyl gallate, Temozolomide
Phytochemical Propyl gallate
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result Propyl Gallate Exerts an Antimigration Effect on Temozolomide-Treated Malignant Glioma Cells through Inhibition of ROS and the NF- κ B Pathway
Combination Pair ID: 879
Pair Name Gambogic Acid, Cisplatin
Phytochemical Gambogic Acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Transcription factor p65 Expression
Result Gambogic acid sensitises lung cancer cells to CDDP in vitro and in vivo in NSCLC through inactivation of NF-κB and MAPK/HO-1 signalling pathways, providing a rationale for the combined use of CDDP and GA in lung cancer chemotherapy.
Combination Pair ID: 886
Pair Name Gambogic Acid, Doxorubicin
Phytochemical Gambogic Acid
Drug Doxorubicin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Transcription factor p65 Expression
Result These findings indicate that GA sensitizes lung cancer cells to ADM in vitro and in vivo, providing a rationale for the combined use of GA and ADM in lung cancer chemotherapy.
Combination Pair ID: 507
Pair Name Glucosinalbate, Doxorubicin
Phytochemical Glucosinalbate
Drug Doxorubicin
Disease Info [ICD-11: 2C90] Ehrlich ascites carcinoma Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host.
Combination Pair ID: 522
Pair Name Myriocin, Cisplatin
Phytochemical Myriocin
Drug Cisplatin
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result We suggest that myriocin is a novel potent anti-cancer agent that dually targets both VEGFR2 in ECs and IκBα in cancer cells, and exerts more pronounced anti-tumor effects than with either kinase being inhibited alone.
Combination Pair ID: 532
Pair Name Artepillin C, TNF-related apoptosis inducing ligand
Phytochemical Artepillin C
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Transcription factor p65 Activity
Result The data demonstrate the important role of Brazilian green propolis and its bioactive compounds in prostate cancer chemoprevention through the enhancement of TRAIL-mediated apoptosis.
Combination Pair ID: 545
Pair Name Sulforaphane, CB-5083
Phytochemical Sulforaphane
Drug CB-5083
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Transcription factor p65 Expression
Result The combination of Sulforaphane and CB-5083 may be a useful treatment strategy to combat CB-5083 resistance.
Combination Pair ID: 560
Pair Name Fucoxanthin, TNF-related apoptosis inducing ligand
Phytochemical Fucoxanthin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result We found that fucoxanthin- or TRAIL-induced apoptosis of human cervical cancer cells was obviously down-regulated. CONCLUSIONS Taken together, these findings suggest that fucoxanthin and TRAIL increased the apoptosis in human cervical cancer cells by targeting the PI3K/Akt/NF-κB signaling pathway.
Combination Pair ID: 578
Pair Name lambda-Carrageenan Oligosaccharides, Fluorouracil
Phytochemical lambda-Carrageenan Oligosaccharides
Drug Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result These findings suggested that λ-COS could be used as an immune-modulating agent for chemotherapy.
Combination Pair ID: 926
Pair Name Gamma-Tocotrienol, Capecitabine
Phytochemical Gamma-Tocotrienol
Drug Capecitabine
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Our results show that γ-tocotrienol can potentiate the effects of capecitabine through suppression of NF-κB-regulated markers of proliferation, invasion, angiogenesis, and metastasis.
Combination Pair ID: 930
Pair Name Gamma-Tocotrienol, Docetaxel
Phytochemical Gamma-Tocotrienol
Drug Docetaxel
Disease Info [ICD-11: 2B66.Z] Oral cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result These findings suggest that the combination treatment with these agents may provide enhanced therapeutic response in oral cancer patients, while avoiding the toxicity associated with high-dose β-tubulin stabilization monotherapy.
Combination Pair ID: 959
Pair Name Periplocin, Gemcitabine
Phytochemical Periplocin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells
Combination Pair ID: 614
Pair Name Voacamine, Paclitaxel
Phytochemical Voacamine
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Our data show the specific effect of VOA which only works on drugs known to be substrates of P-gp.
Combination Pair ID: 617
Pair Name Beta-Elemene, Bortezomib
Phytochemical Beta-Elemene
Drug Bortezomib
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Elemene sensitizes pancreatic cancer cells to bortezomib by enhancing proteasome inhibition via molecular patch mechanism
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 19
Pair Name Oxymatrine, Fluorouracil
Phytochemical Oxymatrine
Drug Fluorouracil
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Phosphorylation
Result Oxymatrine reverses 5-fluorouracil resistance by inhibition of colon cancer cell epithelial-mesenchymal transition and NF-kappa B signaling in vitro
Combination Pair ID: 121
Pair Name Troxerutin, Fluorouracil
Phytochemical Troxerutin
Drug Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result Our data indicated a novel therapeutic strategy to potentiate 5-FU-induced anti-tumor effect in gastric cancer cells with resistance to 5-FU by TXN through suppression of p-STAT3/NF-κB (p65 and p50) and Bcl-2.
Combination Pair ID: 552
Pair Name Sulforaphane, Temozolomide
Phytochemical Sulforaphane
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Transcription factor p65 Expression
Result The present study suggests that the clinical efficacy of TMZ-based chemotherapy in TMZ-resistant GBM may be improved by combination with SFN.
03. Reference
No. Title Href
1 Antitumor Effects of Ononin by Modulation of Apoptosis in Non-Small-Cell Lung Cancer through Inhibiting PI3K/Akt/mTOR Pathway. Oxid Med Cell Longev. 2022 Dec 27;2022:5122448. doi: 10.1155/2022/5122448. Click
2 Artesunate alleviates 5-fluorouracil-induced intestinal damage by suppressing cellular senescence and enhances its antitumor activity. Discov Oncol. 2023 Jul 27;14(1):139. doi: 10.1007/s12672-023-00747-7. Click
3 Evodiamine inactivates NF-κB and potentiates the antitumor effects of gemcitabine on tongue cancer both in vitro and in vivo. Onco Targets Ther. 2018;12:257-267. Published 2018 Dec 27. doi:10.2147/OTT.S181062 Click
4 Induction of apoptosis in glioma cells by lycorine via reactive oxygen species generation and regulation of NF-κB pathways. Naunyn Schmiedebergs Arch Pharmacol. 2023 Jun;396(6):1247-1255. doi: 10.1007/s00210-023-02384-x. Click
5 Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. Click
6 Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway. Biochem Biophys Res Commun. 2020 Oct 20;531(3):320-327. doi: 10.1016/j.bbrc.2020.07.045. Click
7 Administration with hyperoside sensitizes breast cancer cells to paclitaxel by blocking the TLR4 signaling. Mol Cell Probes. 2020 Oct;53:101602. doi: 10.1016/j.mcp.2020.101602. Click
8 Anticancer Efficacy and Mechanism of Amentoflavone for Sensitizing Oral Squamous Cell Carcinoma to Cisplatin. Anticancer Res. 2020 Dec;40(12):6723-6732. doi: 10.21873/anticanres.14695. Click
9 Galangin (GG) combined with cisplatin (DDP) to suppress human lung cancer by inhibition of STAT3-regulated NF-κB and Bcl-2/Bax signaling pathways. Biomed Pharmacother. 2018 Jan;97:213-224. doi: 10.1016/j.biopha.2017.10.059. Click
10 Helichrysetin and TNF‑α synergistically promote apoptosis by inhibiting overactivation of the NF‑κB and EGFR signaling pathways in HeLa and T98G cells. Int J Mol Med. 2021 Apr;47(4):49. doi: 10.3892/ijmm.2021.4882. Click
11 Astragaloside IV enhanced carboplatin sensitivity in prostate cancer by suppressing AKT/NF-κB signaling pathway. Biochem Cell Biol. 2021 Apr;99(2):214-222. doi: 10.1139/bcb-2020-0026. Click
12 Synergism of ursolic acid and cisplatin promotes apoptosis and enhances growth inhibition of cervical cancer cells via suppressing NF-κB p65. Oncotarget. 2017 Oct 30;8(57):97416-97427. doi: 10.18632/oncotarget.22133. Click
13 Curcumol enhances cisplatin sensitivity of gastric cancer: involvement of microRNA-7 and the nuclear factor-kappa B/snail family transcriptional repressor 1 axis. Bioengineered. 2022 May;13(5):11668-11683. doi: 10.1080/21655979.2022.2070975. Click
14 β-Elemene Enhances the Chemotherapeutic Effect of 5-Fluorouracil in Triple-Negative Breast Cancer via PI3K/AKT, RAF-MEK-ErK, and NF-κB Signaling Pathways. Onco Targets Ther. 2020 Jun 9;13:5207-5222. doi: 10.2147/OTT.S242820. Click
15 Combining Crocin and Sorafenib Improves Their Tumor-Inhibiting Effects in a Rat Model of Diethylnitrosamine-Induced Cirrhotic-Hepatocellular Carcinoma. Cancers (Basel). 2023 Aug 11;15(16):4063. doi: 10.3390/cancers15164063. Click
16 Tubeimoside-I sensitizes temozolomide-resistant glioblastoma cells to chemotherapy by reducing MGMT expression and suppressing EGFR induced PI3K/Akt/mTOR/NF-κB-mediated signaling pathway. Phytomedicine. 2022 May;99:154016. doi: 10.1016/j.phymed.2022.154016. Click
17 Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-κB regulated gene products in multiple myeloma xenograft mouse model. Oncotarget. 2014 Feb 15;5(3):634-48. doi: 10.18632/oncotarget.1596. Click
18 Honokiol augments the anti-cancer effects of oxaliplatin in colon cancer cells. Acta Biochim Biophys Sin (Shanghai). 2013 Sep;45(9):773-9. doi: 10.1093/abbs/gmt071. Click
19 Eugenol potentiates cisplatin anti-cancer activity through inhibition of ALDH-positive breast cancer stem cells and the NF-κB signaling pathway. Mol Carcinog. 2018 Mar;57(3):333-346. doi: 10.1002/mc.22758. Click
20 Simvastatin in combination with bergamottin potentiates TNF-induced apoptosis through modulation of NF-κB signalling pathway in human chronic myelogenous leukaemia. Pharm Biol. 2016 Oct;54(10):2050-60. doi: 10.3109/13880209.2016.1141221. Click
21 Crosstalk of NF-κB/P65 and LncRNA HOTAIR-Mediated Repression of MUC1 Expression Contribute to Synergistic Inhibition of Castration-Resistant Prostate Cancer by Polyphyllin 1-Enzalutamide Combination Treatment. Cell Physiol Biochem. 2018;47(2):759-773. doi: 10.1159/000490028. Click
22 Combined Supplementation with Vitamin B-6 and Curcumin is Superior to Either Agent Alone in Suppressing Obesity-Promoted Colorectal Tumorigenesis in Mice. J Nutr. 2021 Dec 3;151(12):3678-3688. doi: 10.1093/jn/nxab320. Click
23 Curcumin reduces paclitaxel resistance in ovarian carcinoma cells by upregulating SNIP1 and inhibiting NFκB activity. Biochem Pharmacol. 2023 Jun;212:115581. doi: 10.1016/j.bcp.2023.115581. Click
24 Icaritin Sensitizes Human Glioblastoma Cells to TRAIL-Induced Apoptosis. Cell Biochem Biophys. 2015 Jun;72(2):533-42. doi: 10.1007/s12013-014-0499-y. Click
25 Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. Click
26 Antitumor activity of gemcitabine can be potentiated in pancreatic cancer through modulation of TLR4/NF-κB signaling by 6-shogaol. AAPS J. 2014 Mar;16(2):246-57. doi: 10.1208/s12248-013-9558-3. Click
27 Synergistic inhibitory effect of cetuximab and tectochrysin on human colon cancer cell growth via inhibition of EGFR signal. Arch Pharm Res. 2016 May;39(5):721-9. doi: 10.1007/s12272-016-0735-7. Click
28 Propyl Gallate Exerts an Antimigration Effect on Temozolomide-Treated Malignant Glioma Cells through Inhibition of ROS and the NF-κB Pathway. J Immunol Res. 2017;2017:9489383. doi: 10.1155/2017/9489383. Click
29 Gambogic acid synergistically potentiates cisplatin-induced apoptosis in non-small-cell lung cancer through suppressing NF-κB and MAPK/HO-1 signalling. Br J Cancer. 2014 Jan 21;110(2):341-52. doi: 10.1038/bjc.2013.752. Click
30 Suppression of NF-κB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103. doi: 10.2174/1568009613666131113100634. Click
31 Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. Click
32 Dual anti-angiogenic and anti-metastatic activity of myriocin synergistically enhances the anti-tumor activity of cisplatin. Cell Oncol (Dordr). 2023 Feb;46(1):117-132. doi: 10.1007/s13402-022-00737-x. Click
33 Ethanolic extract of Brazilian green propolis sensitizes prostate cancer cells to TRAIL-induced apoptosis. Int J Oncol. 2011 Apr;38(4):941-53. doi: 10.3892/ijo.2011.930. Click
34 Sulforaphane is Synergistic with CB-5083 and Inhibits Colony Formation of CB-5083-Resistant HCT116 Cells. ChemMedChem. 2022 Jun 3;17(11):e202200030. doi: 10.1002/cmdc.202200030. Click
35 Fucoxanthin and Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand (TRAIL) Synergistically Promotes Apoptosis of Human Cervical Cancer Cells by Targeting PI3K/Akt/NF-κB Signaling Pathway. Med Sci Monit. 2018 Jan 1;24:11-18. doi: 10.12659/msm.905360. Click
36 The Antitumor Potential of λ-Carrageenan Oligosaccharides on Gastric Carcinoma by Immunomodulation. Nutrients. 2023 Apr 24;15(9):2044. doi: 10.3390/nu15092044. Click
37 First evidence that γ-tocotrienol inhibits the growth of human gastric cancer and chemosensitizes it to capecitabine in a xenograft mouse model through the modulation of NF-κB pathway. Clin Cancer Res. 2012 Apr 15;18(8):2220-9. doi: 10.1158/1078-0432.CCR-11-2470. Click
38 γ-tocotrienol enhances the chemosensitivity of human oral cancer cells to docetaxel through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 Click
39 Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells. Biomed Pharmacother. 2023 Jan;157:114039. doi: 10.1016/j.biopha.2022.114039. Click
40 A natural product, voacamine, sensitizes paclitaxel-resistant human ovarian cancer cells. Toxicol Appl Pharmacol. 2022 Jan 1;434:115816. doi: 10.1016/j.taap.2021.115816. Click
41 Elemene sensitizes pancreatic cancer cells to bortezomib by enhancing proteasome inhibition via molecular patch mechanism. Signal Transduct Target Ther. 2023 Feb 27;8(1):87. doi: 10.1038/s41392-023-01373-z. Click
42 Oxymatrine reverses 5-fluorouracil resistance by inhibition of colon cancer cell epithelial-mesenchymal transition and NF-κB signaling in vitro. Oncol Lett. 2020 Jan;19(1):519-526. doi: 10.3892/ol.2019.11090. Click
43 Troxerutin (TXN) potentiated 5-Fluorouracil (5-Fu) treatment of human gastric cancer through suppressing STAT3/NF-κB and Bcl-2 signaling pathways. Biomed Pharmacother. 2017 Aug;92:95-107. doi: 10.1016/j.biopha.2017.04.059. Click
44 Sulforaphane reverses chemo-resistance to temozolomide in glioblastoma cells by NF-κB-dependent pathway downregulating MGMT expression. Int J Oncol. 2016 Feb;48(2):559-68. doi: 10.3892/ijo.2015.3271. Click
It has been 680797 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP