Name | Transcription factor p65 | ||
UniProt ID | TF65_HUMAN | ||
Gene Name | RELA | ||
Gene ID | 5970 | ||
Synonyms |
RELA, AIF3BL3, CMCU, NFKB3, p65
|
||
Sequence |
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM DFSALLSQISS |
||
Pathway Map | MAP LINK | ||
T.C. Number | 1.A.1.1.1; 1.A.1.10.3; 1.A.1.10.7; 1.A.1.10.8 | ||
KEGG ID | hsa5970 | ||
TTD ID | T83145 | ||
Pfam | PF00554; PF16179 |
Pair Name | Artesunate, Fluorouracil | |||
Phytochemical Name | Artesunate | |||
Anticancer drug Name | Fluorouracil | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | Our findings point to the crucial treatment effect of Arte on inflammation, intestinal cell senescence, and CRC cell proliferation and offer a new option for CRC treatment. |
Pair Name | Ononin, Paclitaxel | |||
Phytochemical Name | Ononin | |||
Anticancer drug Name | Paclitaxel | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Our findings suggested that the therapeutic index of PTX-based chemotherapy could be improved by reducing toxicity with increasing antitumor capabilities when combined with ononin. |
Pair Name | Amentoflavone, Cisplatin | |||
Phytochemical | Amentoflavone | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B66.0] | Oral squamous cell carcinoma | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Activity | |
Result | Inactivation of NF-κB and induction of apoptosis through intrinsic caspase-dependent and independent apoptotic pathways are associated with amentoflavone enhanced anti-OSCC efficacy of cisplatin. |
Pair Name | Artepillin C, TNF-related apoptosis inducing ligand | |||
Phytochemical | Artepillin C | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Up-regulation | Transcription factor p65 | Activity | |
Result | The data demonstrate the important role of Brazilian green propolis and its bioactive compounds in prostate cancer chemoprevention through the enhancement of TRAIL-mediated apoptosis. |
Pair Name | Astragaloside IV, Carboplatin | |||
Phytochemical | Astragaloside IV | |||
Drug | Carboplatin | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | Our results suggested that AgIV enhanced carboplatin sensitivity in prostate cancer cell lines by suppressing AKT/NF-κB signaling, thus suppressed epithelial-mesenchymal transition induced by carboplatin. Our findings provided a new mechanism for AgIV in overcoming drug resistance of platinum-based chemotherapy and suggested a potential combination therapy of AgIV and carboplatin in prostate cancer. |
Pair Name | Baicalein, Cisplatin | |||
Phytochemical | Baicalein | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway |
Pair Name | Bergamottin, Simvastatin | |||
Phytochemical | Bergamottin | |||
Drug | Simvastatin | |||
Disease Info | [ICD-11: 2A20.1] | Chronic myelogenous leukemia | Investigative | |
Regulate Info | Up-regulation | Transcription factor p65 | Expression | |
Result | Discussion and conclusion Our results provide novel insight into the role of SV and BGM in potentially preventing and treating cancer through modulation of NF-κB signalling pathway and its regulated gene products. |
Pair Name | Beta-Elemene, Bortezomib | |||
Phytochemical | Beta-Elemene | |||
Drug | Bortezomib | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Elemene sensitizes pancreatic cancer cells to bortezomib by enhancing proteasome inhibition via molecular patch mechanism |
Pair Name | Beta-Elemene, Fluorouracil | |||
Phytochemical | Beta-Elemene | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | The conclusion obtained, considering that the results suggest that the combination may be important specifically in the treatment of TNBC. |
Pair Name | Crocin, Sorafenib | |||
Phytochemical | Crocin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | CR potentiates the suppressive effects of SB on tumor growth and provides the opportunity to strengthen the therapeutic effects of SB in the treatment of HCC. |
Pair Name | Curcumin, Paclitaxel | |||
Phytochemical | Curcumin | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Curcumin reduces paclitaxel resistance in ovarian carcinoma cells by upregulating SNIP1 and inhibiting NFκB activity |
Pair Name | Curcumin, Pyridoxine | |||
Phytochemical | Curcumin | |||
Drug | Pyridoxine | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | C + B is superior to either agent alone in preventing obesity-promoted colorectal carcinogenesis. Augmented suppression of procancerous signaling pathways may be the means by which this augmentation occurs. |
Pair Name | Curcumol, Cisplatin | |||
Phytochemical | Curcumol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | The findings may offer new thoughts that curcumol in combination with cisplatin might be a useful strategy for GC management. |
Pair Name | Eugenol, Cisplatin | |||
Phytochemical | Eugenol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | These results provide strong preclinical justification for combining cisplatin with eugenol as therapeutic approach for triple-negative breast cancers through targeting the resistant ALDH-positive cells and inhibiting the NF-κB pathway. |
Pair Name | Evodiamine, Gemcitabine | |||
Phytochemical | Evodiamine | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2B62.Z] | Tongue cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | The results of this study showed that EVO may inhibit cancer cells by suppressing NF-κB activity, and in combination with GEM, it may increase the chemosensitivity of tongue squamous cancer cells, thereby improving the treatment response. |
Pair Name | Fucoxanthin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Fucoxanthin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | We found that fucoxanthin- or TRAIL-induced apoptosis of human cervical cancer cells was obviously down-regulated. CONCLUSIONS Taken together, these findings suggest that fucoxanthin and TRAIL increased the apoptosis in human cervical cancer cells by targeting the PI3K/Akt/NF-κB signaling pathway. |
Pair Name | Gambogic Acid, Cisplatin | |||
Phytochemical | Gambogic Acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Transcription factor p65 | Expression | |
Result | Gambogic acid sensitises lung cancer cells to CDDP in vitro and in vivo in NSCLC through inactivation of NF-κB and MAPK/HO-1 signalling pathways, providing a rationale for the combined use of CDDP and GA in lung cancer chemotherapy. |
Pair Name | Gambogic Acid, Doxorubicin | |||
Phytochemical | Gambogic Acid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Transcription factor p65 | Expression | |
Result | These findings indicate that GA sensitizes lung cancer cells to ADM in vitro and in vivo, providing a rationale for the combined use of GA and ADM in lung cancer chemotherapy. |
Pair Name | Gamma-Tocotrienol, Capecitabine | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Capecitabine | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Our results show that γ-tocotrienol can potentiate the effects of capecitabine through suppression of NF-κB-regulated markers of proliferation, invasion, angiogenesis, and metastasis. |
Pair Name | Gamma-Tocotrienol, Docetaxel | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Docetaxel | |||
Disease Info | [ICD-11: 2B66.Z] | Oral cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | These findings suggest that the combination treatment with these agents may provide enhanced therapeutic response in oral cancer patients, while avoiding the toxicity associated with high-dose β-tubulin stabilization monotherapy. |
Pair Name | Garcinol, Paclitaxel | |||
Phytochemical | Garcinol | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model |
Pair Name | Glucosinalbate, Doxorubicin | |||
Phytochemical | Glucosinalbate | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C90] | Ehrlich ascites carcinoma | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host. |
Pair Name | Helichrysetin, Tumor necrosis factor-alpha | |||
Phytochemical | Helichrysetin | |||
Drug | Tumor necrosis factor-alpha | |||
Disease Info | [ICD-11: 2F7Z] | Glioma | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | Helichrysetin and TNF‑α synergistically promoted apoptosis by inhibiting TAK1/IKK/NF‑κB and TAK1/EGFR signaling pathways in HeLa and T98G cells, indicating a potential therapeutic strategy for cancer. |
Pair Name | Honokiol, Oxaliplatin | |||
Phytochemical | Honokiol | |||
Drug | Oxaliplatin | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | This combination allows a reduction in oxaliplatin dose, and thereby reduces its adverse effects. It may also enhance the chemotherapeutic effect of oxaliplatin for this disease. |
Pair Name | Hyperoside, Paclitaxel | |||
Phytochemical | Hyperoside | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Hyperoside may elevate breast cancer cell sensitivity to paclitaxel by blocking TLR4 activation-mediated pro-inflammatory and pro-survival approaches, thereby endorsing its usefulness as a promising therapeutic combination to overcome chemosensitivity in breast cancer. |
Pair Name | Icaritin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Icaritin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | These data suggest that icaritin sensitizes TRAIL-induced tumor cell apoptosis via suppression of NF-κB-dependent c-FLIP expression, providing in vitro evidence supporting the notion that icaritin is a potential sensitizer of TRAIL in anticancer therapy against human GBM. |
Pair Name | lambda-Carrageenan Oligosaccharides, Fluorouracil | |||
Phytochemical | lambda-Carrageenan Oligosaccharides | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | These findings suggested that λ-COS could be used as an immune-modulating agent for chemotherapy. |
Pair Name | Lycorine, Temozolomide | |||
Phytochemical | Lycorine | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | Our study suggested that lycorine exerts an anti-glioma effect by inducing ROS production and inhibiting NF-κB, which validated that lycorine may be a potential candidate for glioma treatment alone or in combination with TMZ. |
Pair Name | Myriocin, Cisplatin | |||
Phytochemical | Myriocin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | We suggest that myriocin is a novel potent anti-cancer agent that dually targets both VEGFR2 in ECs and IκBα in cancer cells, and exerts more pronounced anti-tumor effects than with either kinase being inhibited alone. |
Pair Name | Norizalpinin, Cisplatin | |||
Phytochemical | Norizalpinin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Our data indicated a novel therapeutic strategy to potentiate DDP-induced anti-tumor effect in lung cancer cells with DDP resistance by GG through inactivating p-STAT3/p65 and Bcl-2 pathways. |
Pair Name | Periplocin, Gemcitabine | |||
Phytochemical | Periplocin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells |
Pair Name | Polyphyllin I, Enzalutamide | |||
Phytochemical | Polyphyllin I | |||
Drug | Enzalutamide | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Our results indicate that PPI inhibits the growth of CRPC cells by inhibiting p65 protein and concomitantly reducing HOTAIR expression, thereby suppressing MUC1 gene expression. The novel regulatory interaction of p65 and HOTAIR converge in the inhibition of MUC1 expression and overall PPI response. The combination of PPI and enzalutamide exhibits synergy. This study reveals a novel mechanism underlying the synergistic inhibitory effect of PPI and enzalutamide on the growth of CRPC cells. |
Pair Name | Propyl gallate, Temozolomide | |||
Phytochemical | Propyl gallate | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | Propyl Gallate Exerts an Antimigration Effect on Temozolomide-Treated Malignant Glioma Cells through Inhibition of ROS and the NF- κ B Pathway |
Pair Name | Quercetin, Anti-PD-1 antibody | |||
Phytochemical | Quercetin | |||
Drug | Anti-PD-1 antibody | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity. |
Pair Name | Shogaol, Gemcitabine | |||
Phytochemical | Shogaol | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10.0] | Pancreatic ductal adenocarcinoma | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | Our results suggest that 6-shogaol can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing of TLR4/NF-κB-mediated inflammatory pathways linked to tumorigenesis. |
Pair Name | Sulforaphane, CB-5083 | |||
Phytochemical | Sulforaphane | |||
Drug | CB-5083 | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Transcription factor p65 | Expression | |
Result | The combination of Sulforaphane and CB-5083 may be a useful treatment strategy to combat CB-5083 resistance. |
Pair Name | Tectochrysin, Cetuximab | |||
Phytochemical | Tectochrysin | |||
Drug | Cetuximab | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Our results indicate that combined therapy with lower concentration of cetuximab and tectochrysin could significantly enhance the cancer cell growth inhibitory effect through the inhibition of EGFR signaling. |
Pair Name | Thymoquinone, Bortezomib | |||
Phytochemical | Thymoquinone | |||
Drug | Bortezomib | |||
Disease Info | [ICD-11: 2A85.5] | Mantle cell lymphoma | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-KappaB regulated gene products in multiple myeloma xenograft mouse model |
Pair Name | Tubeimoside I, Temozolomide | |||
Phytochemical | Tubeimoside I | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | We first demonstrated that synergistic effects of TBMS1 and TMZ induced apoptosis in GBM cells through reducing MGMT expression and inhibiting the EGFR induced PI3K/Akt/mTOR/NF-κB signaling pathway. This study provides a rationale for combined application of TMZ and TBMS1 as a potential chemotherapeutic treatment for MGMT+ GBM patients. |
Pair Name | Ursolic acid, Cisplatin | |||
Phytochemical | Ursolic acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | The combination of UA with DDP could more effectively inhibit SiHa cells proliferation and facilitate cell apoptosis through suppressing NF-κB p65. |
Pair Name | Voacamine, Paclitaxel | |||
Phytochemical | Voacamine | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Our data show the specific effect of VOA which only works on drugs known to be substrates of P-gp. |
Pair Name | Oxymatrine, Fluorouracil | |||
Phytochemical | Oxymatrine | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Phosphorylation | |
Result | Oxymatrine reverses 5-fluorouracil resistance by inhibition of colon cancer cell epithelial-mesenchymal transition and NF-kappa B signaling in vitro |
Pair Name | Sulforaphane, Temozolomide | |||
Phytochemical | Sulforaphane | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | The present study suggests that the clinical efficacy of TMZ-based chemotherapy in TMZ-resistant GBM may be improved by combination with SFN. |
Pair Name | Troxerutin, Fluorouracil | |||
Phytochemical | Troxerutin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Transcription factor p65 | Expression | |
Result | Our data indicated a novel therapeutic strategy to potentiate 5-FU-induced anti-tumor effect in gastric cancer cells with resistance to 5-FU by TXN through suppression of p-STAT3/NF-κB (p65 and p50) and Bcl-2. |
No. | Title | Href |
---|---|---|
1 | Artesunate alleviates 5-fluorouracil-induced intestinal damage by suppressing cellular senescence and enhances its antitumor activity. Discov Oncol. 2023 Jul 27;14(1):139. doi: 10.1007/s12672-023-00747-7. | Click |
2 | Antitumor Effects of Ononin by Modulation of Apoptosis in Non-Small-Cell Lung Cancer through Inhibiting PI3K/Akt/mTOR Pathway. Oxid Med Cell Longev. 2022 Dec 27;2022:5122448. doi: 10.1155/2022/5122448. | Click |
3 | Anticancer Efficacy and Mechanism of Amentoflavone for Sensitizing Oral Squamous Cell Carcinoma to Cisplatin. Anticancer Res. 2020 Dec;40(12):6723-6732. doi: 10.21873/anticanres.14695. | Click |
4 | Ethanolic extract of Brazilian green propolis sensitizes prostate cancer cells to TRAIL-induced apoptosis. Int J Oncol. 2011 Apr;38(4):941-53. doi: 10.3892/ijo.2011.930. | Click |
5 | Astragaloside IV enhanced carboplatin sensitivity in prostate cancer by suppressing AKT/NF-κB signaling pathway. Biochem Cell Biol. 2021 Apr;99(2):214-222. doi: 10.1139/bcb-2020-0026. | Click |
6 | Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway. Biochem Biophys Res Commun. 2020 Oct 20;531(3):320-327. doi: 10.1016/j.bbrc.2020.07.045. | Click |
7 | Simvastatin in combination with bergamottin potentiates TNF-induced apoptosis through modulation of NF-κB signalling pathway in human chronic myelogenous leukaemia. Pharm Biol. 2016 Oct;54(10):2050-60. doi: 10.3109/13880209.2016.1141221. | Click |
8 | Elemene sensitizes pancreatic cancer cells to bortezomib by enhancing proteasome inhibition via molecular patch mechanism. Signal Transduct Target Ther. 2023 Feb 27;8(1):87. doi: 10.1038/s41392-023-01373-z. | Click |
9 | β-Elemene Enhances the Chemotherapeutic Effect of 5-Fluorouracil in Triple-Negative Breast Cancer via PI3K/AKT, RAF-MEK-ErK, and NF-κB Signaling Pathways. Onco Targets Ther. 2020 Jun 9;13:5207-5222. doi: 10.2147/OTT.S242820. | Click |
10 | Combining Crocin and Sorafenib Improves Their Tumor-Inhibiting Effects in a Rat Model of Diethylnitrosamine-Induced Cirrhotic-Hepatocellular Carcinoma. Cancers (Basel). 2023 Aug 11;15(16):4063. doi: 10.3390/cancers15164063. | Click |
11 | Curcumin reduces paclitaxel resistance in ovarian carcinoma cells by upregulating SNIP1 and inhibiting NFκB activity. Biochem Pharmacol. 2023 Jun;212:115581. doi: 10.1016/j.bcp.2023.115581. | Click |
12 | Combined Supplementation with Vitamin B-6 and Curcumin is Superior to Either Agent Alone in Suppressing Obesity-Promoted Colorectal Tumorigenesis in Mice. J Nutr. 2021 Dec 3;151(12):3678-3688. doi: 10.1093/jn/nxab320. | Click |
13 | Curcumol enhances cisplatin sensitivity of gastric cancer: involvement of microRNA-7 and the nuclear factor-kappa B/snail family transcriptional repressor 1 axis. Bioengineered. 2022 May;13(5):11668-11683. doi: 10.1080/21655979.2022.2070975. | Click |
14 | Eugenol potentiates cisplatin anti-cancer activity through inhibition of ALDH-positive breast cancer stem cells and the NF-κB signaling pathway. Mol Carcinog. 2018 Mar;57(3):333-346. doi: 10.1002/mc.22758. | Click |
15 | Evodiamine inactivates NF-κB and potentiates the antitumor effects of gemcitabine on tongue cancer both in vitro and in vivo. Onco Targets Ther. 2018;12:257-267. Published 2018 Dec 27. doi:10.2147/OTT.S181062 | Click |
16 | Fucoxanthin and Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand (TRAIL) Synergistically Promotes Apoptosis of Human Cervical Cancer Cells by Targeting PI3K/Akt/NF-κB Signaling Pathway. Med Sci Monit. 2018 Jan 1;24:11-18. doi: 10.12659/msm.905360. | Click |
17 | Gambogic acid synergistically potentiates cisplatin-induced apoptosis in non-small-cell lung cancer through suppressing NF-κB and MAPK/HO-1 signalling. Br J Cancer. 2014 Jan 21;110(2):341-52. doi: 10.1038/bjc.2013.752. | Click |
18 | Suppression of NF-κB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103. doi: 10.2174/1568009613666131113100634. | Click |
19 | First evidence that γ-tocotrienol inhibits the growth of human gastric cancer and chemosensitizes it to capecitabine in a xenograft mouse model through the modulation of NF-κB pathway. Clin Cancer Res. 2012 Apr 15;18(8):2220-9. doi: 10.1158/1078-0432.CCR-11-2470. | Click |
20 | γ-tocotrienol enhances the chemosensitivity of human oral cancer cells to docetaxel through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 | Click |
21 | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. | Click |
22 | Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. | Click |
23 | Helichrysetin and TNF‑α synergistically promote apoptosis by inhibiting overactivation of the NF‑κB and EGFR signaling pathways in HeLa and T98G cells. Int J Mol Med. 2021 Apr;47(4):49. doi: 10.3892/ijmm.2021.4882. | Click |
24 | Honokiol augments the anti-cancer effects of oxaliplatin in colon cancer cells. Acta Biochim Biophys Sin (Shanghai). 2013 Sep;45(9):773-9. doi: 10.1093/abbs/gmt071. | Click |
25 | Administration with hyperoside sensitizes breast cancer cells to paclitaxel by blocking the TLR4 signaling. Mol Cell Probes. 2020 Oct;53:101602. doi: 10.1016/j.mcp.2020.101602. | Click |
26 | Icaritin Sensitizes Human Glioblastoma Cells to TRAIL-Induced Apoptosis. Cell Biochem Biophys. 2015 Jun;72(2):533-42. doi: 10.1007/s12013-014-0499-y. | Click |
27 | The Antitumor Potential of λ-Carrageenan Oligosaccharides on Gastric Carcinoma by Immunomodulation. Nutrients. 2023 Apr 24;15(9):2044. doi: 10.3390/nu15092044. | Click |
28 | Induction of apoptosis in glioma cells by lycorine via reactive oxygen species generation and regulation of NF-κB pathways. Naunyn Schmiedebergs Arch Pharmacol. 2023 Jun;396(6):1247-1255. doi: 10.1007/s00210-023-02384-x. | Click |
29 | Dual anti-angiogenic and anti-metastatic activity of myriocin synergistically enhances the anti-tumor activity of cisplatin. Cell Oncol (Dordr). 2023 Feb;46(1):117-132. doi: 10.1007/s13402-022-00737-x. | Click |
30 | Galangin (GG) combined with cisplatin (DDP) to suppress human lung cancer by inhibition of STAT3-regulated NF-κB and Bcl-2/Bax signaling pathways. Biomed Pharmacother. 2018 Jan;97:213-224. doi: 10.1016/j.biopha.2017.10.059. | Click |
31 | Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells. Biomed Pharmacother. 2023 Jan;157:114039. doi: 10.1016/j.biopha.2022.114039. | Click |
32 | Crosstalk of NF-κB/P65 and LncRNA HOTAIR-Mediated Repression of MUC1 Expression Contribute to Synergistic Inhibition of Castration-Resistant Prostate Cancer by Polyphyllin 1-Enzalutamide Combination Treatment. Cell Physiol Biochem. 2018;47(2):759-773. doi: 10.1159/000490028. | Click |
33 | Propyl Gallate Exerts an Antimigration Effect on Temozolomide-Treated Malignant Glioma Cells through Inhibition of ROS and the NF-κB Pathway. J Immunol Res. 2017;2017:9489383. doi: 10.1155/2017/9489383. | Click |
34 | Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. | Click |
35 | Antitumor activity of gemcitabine can be potentiated in pancreatic cancer through modulation of TLR4/NF-κB signaling by 6-shogaol. AAPS J. 2014 Mar;16(2):246-57. doi: 10.1208/s12248-013-9558-3. | Click |
36 | Sulforaphane is Synergistic with CB-5083 and Inhibits Colony Formation of CB-5083-Resistant HCT116 Cells. ChemMedChem. 2022 Jun 3;17(11):e202200030. doi: 10.1002/cmdc.202200030. | Click |
37 | Synergistic inhibitory effect of cetuximab and tectochrysin on human colon cancer cell growth via inhibition of EGFR signal. Arch Pharm Res. 2016 May;39(5):721-9. doi: 10.1007/s12272-016-0735-7. | Click |
38 | Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-κB regulated gene products in multiple myeloma xenograft mouse model. Oncotarget. 2014 Feb 15;5(3):634-48. doi: 10.18632/oncotarget.1596. | Click |
39 | Tubeimoside-I sensitizes temozolomide-resistant glioblastoma cells to chemotherapy by reducing MGMT expression and suppressing EGFR induced PI3K/Akt/mTOR/NF-κB-mediated signaling pathway. Phytomedicine. 2022 May;99:154016. doi: 10.1016/j.phymed.2022.154016. | Click |
40 | Synergism of ursolic acid and cisplatin promotes apoptosis and enhances growth inhibition of cervical cancer cells via suppressing NF-κB p65. Oncotarget. 2017 Oct 30;8(57):97416-97427. doi: 10.18632/oncotarget.22133. | Click |
41 | A natural product, voacamine, sensitizes paclitaxel-resistant human ovarian cancer cells. Toxicol Appl Pharmacol. 2022 Jan 1;434:115816. doi: 10.1016/j.taap.2021.115816. | Click |
42 | Oxymatrine reverses 5-fluorouracil resistance by inhibition of colon cancer cell epithelial-mesenchymal transition and NF-κB signaling in vitro. Oncol Lett. 2020 Jan;19(1):519-526. doi: 10.3892/ol.2019.11090. | Click |
43 | Sulforaphane reverses chemo-resistance to temozolomide in glioblastoma cells by NF-κB-dependent pathway downregulating MGMT expression. Int J Oncol. 2016 Feb;48(2):559-68. doi: 10.3892/ijo.2015.3271. | Click |
44 | Troxerutin (TXN) potentiated 5-Fluorouracil (5-Fu) treatment of human gastric cancer through suppressing STAT3/NF-κB and Bcl-2 signaling pathways. Biomed Pharmacother. 2017 Aug;92:95-107. doi: 10.1016/j.biopha.2017.04.059. | Click |