TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Induced myeloid leukemia cell differentiation protein Mcl-1
UniProt ID MCL1_HUMAN
Gene Name MCL1
Gene ID 4170
Synonyms
MCL1, BCL2L3, EAT, MCL1-ES, MCL1L, MCL1S, Mcl-1, TM, bcl2-L-3, mcl1/EAT
Sequence
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Pathway Map MAP LINK
KEGG ID hsa4170
TTD ID T14912
Pfam PF00452; PF15286
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 16
Pair Name Tetrandrine, Sorafenib
Phytochemical Tetrandrine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result The antitumour activity of sorafenib plus tetrandrine may be attributed to the induction of the intrinsic apoptosis pathway through ROS/Akt signaling. This finding provides a novel approach that may broaden the clinical application of sorafenib.
Combination Pair ID: 30
Pair Name Berbamine, Sorafenib
Phytochemical Berbamine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Targeting Na+/K+-ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma
Combination Pair ID: 634
Pair Name Fisetin, Sorafenib
Phytochemical Fisetin
Drug Sorafenib
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Fisetin potentiates sorafenib-induced apoptosis and abrogates tumor growth in athymic nude mice implanted with BRAF-mutated melanoma cells.
Combination Pair ID: 991
Pair Name Nobiletin, Vorinostat
Phytochemical Nobiletin
Drug Vorinostat
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result The combination of nobiletin with vorinostat increased histone H3K9 and H3K27 acetylation levels in SCLC mouse tumor tissue and enhanced the expression of the BH3-only proteins BIM and BID. We conclude that nobiletin is a novel natural BH3 mimetic that can cooperate with vorinostat to induce apoptosis and autophagy in SCLC.
Combination Pair ID: 649
Pair Name Amentoflavone, Sorafenib
Phytochemical Amentoflavone
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Our results demonstrated that amentoflavone significantly enhanced sorafenib-inhibited tumor growth and expression of ERK/AKT phosphorylation and anti-apoptotic proteins compared to single-agent treatment. Additionally, amentoflavone also triggered sorafenib-induced apoptosis through extrinsic and intrinsic apoptotic pathways.
Combination Pair ID: 99
Pair Name Silibinin, Sorafenib
Phytochemical Silibinin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result These results suggested that silibinin improved the efficacy of sorafenib in HCC therapy, indicating a clinical promising therapeutic strategy for HCC patients.
Combination Pair ID: 653
Pair Name Silibinin, Trichostatin A
Phytochemical Silibinin
Drug Trichostatin A
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Combinations of TSA with silibinin synergistically augmented the cytotoxic effects of the single agent, which was associated with a dramatic increase in p21 (Cdkn1a)
Combination Pair ID: 133
Pair Name Kurarinone, TNF-related apoptosis inducing ligand
Phytochemical Kurarinone
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Kurarinone Synergizes TRAIL-Induced Apoptosis in Gastric Cancer Cells
Combination Pair ID: 1006
Pair Name Artesunate, Sorafenib
Phytochemical Artesunate
Drug Sorafenib
Disease Info [ICD-11: XH50P3] Non‑hodgkin lymphoma Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Artesunate synergistically promotes sorafenib‑induced apoptosis and ferroptosis in non‑Hodgkin lymphoma cells through inhibition of the STAT3 pathway
Combination Pair ID: 1009
Pair Name Oridonin, Venetoclax
Phytochemical Oridonin
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Oridonin and venetoclax synergistically promote AML cell apoptosis by inhibiting AKT signaling.
Combination Pair ID: 189
Pair Name Ursolic acid, Sorafenib
Phytochemical Ursolic acid
Drug Sorafenib
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result These results suggest that the synergistic antitumor effects of sorafenib combined with ursolic acid may involve the induction of Mcl-1-related apoptosis and SLC7A11-dependent ferroptosis. Our findings may offer a novel effective therapeutic strategy for tumor treatment.
Combination Pair ID: 1012
Pair Name Ursolic acid, Sorafenib
Phytochemical Ursolic acid
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result The carrier-free US NPs provide new strategies for HCC treatment and new ideas for the development of novel nano-drug delivery systems containing UA and Sora.
Combination Pair ID: 247
Pair Name Oleuropein, Cisplatin
Phytochemical Oleuropein
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result These data revealed that oleuropein regulated the expression of the above-mentioned miRNAs in ovarian cancer cells, which potentially resulted in apoptosis induction, cell proliferation inhibition, and cisplatin resistance decline in ovarian cancer cells. To confirm the results of this study, it is suggested that similar experiments be performed in animal models of ovarian cancer.
Combination Pair ID: 250
Pair Name Ginsenoside Rg5, Paclitaxel
Phytochemical Ginsenoside Rg5
Drug Paclitaxel
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel
Combination Pair ID: 724
Pair Name Shikonin, TNF-related apoptosis inducing ligand
Phytochemical Shikonin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result The results indicated that shikonin sensitized resistant cancer cells to TRAIL-induced cytotoxicity via the modulation of the JNK, STAT3 and AKT pathways, the downregulation of antiapoptotic proteins and the upregulation of proapoptotic proteins.
Combination Pair ID: 317
Pair Name Honokiol, Osimertinib
Phytochemical Honokiol
Drug Osimertinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Our findings warrant further study of HNK and its derivatives in overcoming Osim resistance in the clinic.
Combination Pair ID: 352
Pair Name Bufalin, Fluorouracil
Phytochemical Bufalin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Bufalin in combination with 5-FU may induce a higher level of apoptosis compared with monotherapy, and the combination mat be a potential therapeutic strategy for the treatment of colorectal cancer.
Combination Pair ID: 360
Pair Name OSW-1, Carboplatin
Phytochemical OSW-1
Drug Carboplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Our data revealed the mode of action and molecular mechanism underlying the effect of OSW-1 against TNBC, and provided a useful guidance for improving the sensitivity of TNBC cells to conventional chemotherapeutic drugs, which warrants further investigation.
Combination Pair ID: 378
Pair Name Resveratrol, Rapamycin
Phytochemical Resveratrol
Drug Rapamycin
Disease Info [ICD-11: 2D10.1] Papillary thyroid cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result The present study suggests that the combination of rapamycin and resveratrol may be a promising strategy for the treatment of papillary thyroid cancer.
Combination Pair ID: 399
Pair Name Curcumin, Paclitaxel
Phytochemical Curcumin
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Curcumin reduces paclitaxel resistance in ovarian carcinoma cells by upregulating SNIP1 and inhibiting NFκB activity
Combination Pair ID: 403
Pair Name Curcumin, Binimetinib
Phytochemical Curcumin
Drug Binimetinib
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Our data demonstrates that curcumin exerts significant synergistic anticancer effects on MM cells by inducing ROS and necroptosis when combined with binimetinib. Therefore, a strategy of adding curcumin to conventional anticancer agents holds promise for treating MM.
Combination Pair ID: 442
Pair Name alpha-Mangostin, Sorafenib
Phytochemical alpha-Mangostin
Drug Sorafenib
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result These data demonstrate an unanticipated synergy between α-Mangostin and sorafenib, with mechanistic actions that convert a known safe natural product to a candidate combinatorial therapeutic agent.
Combination Pair ID: 874
Pair Name Gossypol, Imatinib
Phytochemical Gossypol
Drug Imatinib
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result These results suggest that (-)gossypol induced apoptosis in K562 cells through a mitochondria pathway and that the combination of imatinib and (-)gossypol might be an effective treatment for CML.
Combination Pair ID: 469
Pair Name Gossypol, lenalidomide
Phytochemical Gossypol
Drug lenalidomide
Disease Info [ICD-11: 2A82] Chronic lymphocytic leukemia Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Downregulation of BCL2 by AT-101 enhances the antileukaemic effect of lenalidomide both by an immune dependant and independent manner.
Combination Pair ID: 470
Pair Name Gossypol, Idarubicin
Phytochemical Gossypol
Drug Idarubicin
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result These findings suggest that combinatorial therapy with AT-101 and IDA selectively eliminates leukemia stem-like cells both in vitro and in vivo, representing a potent and alternative salvage therapy for the treatment of relapsed and refractory patients with AML.
Combination Pair ID: 491
Pair Name Wogonin, Cisplatin
Phytochemical Wogonin
Drug Cisplatin
Disease Info Head and neck cancer
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Wogonin induced selective cell death by targeting the antioxidant defense mechanisms enhanced in the resistant HNC cells and activating cell death pathways involving PUMA and PARP. Hence, wogonin significantly sensitized resistant HNC cells to cisplatin both in vitro and in vivo. Wogonin is a promising anticancer candidate that induces ROS accumulation and selective cytotoxicity in HNC cells and can help to overcome cisplatin-resistance in this cancer.
Combination Pair ID: 937
Pair Name Cordycepin, Temozolomide
Phytochemical Cordycepin
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Cordycepin combined with temozolomide may down-regulate MYC through "MicroRNA in cancer, Proteoglycans in cancer, Pathways in cancer and PI3K-AKT signaling pathway", which in turn regulate the expression of MCL1, CTNNB1, MMP9, PDCD4, thus regulating cell proliferation, migration and apoptosis in glioblastoma.
Combination Pair ID: 605
Pair Name Phenethyl isothiocyanate, Gefitinib
Phytochemical Phenethyl isothiocyanate
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result We explored the prospect of PEITC in improving the efficacy of targeted drug therapy and demonstrated the synergistic effects and underlined mechanisms of PEITC combined with Gefitinib in NSCLC cells treatment. This study provided useful information for developing novel therapy strategies by combination treatment of PEITC with targeted drugs.
Combination Pair ID: 611
Pair Name Periplocin, TNF-related apoptosis inducing ligand
Phytochemical Periplocin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway
Combination Pair ID: 962
Pair Name Platycodin D, Venetoclax
Phytochemical Platycodin D
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Platycodin D may be a potent therapeutic candidate for the treatment of AML
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 34
Pair Name Vinpocetine, Sorafenib
Phytochemical Vinpocetine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Vinpocetine may be a potential candidate for sorafenib sensitization and HCC treatment, and our results may help to elucidate more effective therapeutic options for HCC patients with sorafenib resistance.
Combination Pair ID: 650
Pair Name Amentoflavone, Sorafenib
Phytochemical Amentoflavone
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Amentoflavone not only reversed sorafenib-induced anti-apoptotic protein levels but also enhanced sorafenib-induced pro-apoptotic protein expression in SK-Hep1R cells. In conclusion, amentoflavone may be used as a sorafenib sensitizer to enhance sorafenib-induced cytotoxicity and trigger sorafenib-induced apoptosis through extrinsic and intrinsic pathways in SK-Hep1R cells.
Combination Pair ID: 172
Pair Name Artesunate, Venetoclax
Phytochemical Artesunate
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result We provide a new triple combination for AML treatment by targeting the Noxa/Mcl-1/Bim axis to reverse Mcl-1/p-Chk1 resistance of cytarabine therapy.
Combination Pair ID: 316
Pair Name Honokiol, Paclitaxel
Phytochemical Honokiol
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction
Combination Pair ID: 770
Pair Name Mitocurcumin, Cytarabine
Phytochemical Mitocurcumin
Drug Cytarabine
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis.
Combination Pair ID: 341
Pair Name Pentosalen, Cisplatin
Phytochemical Pentosalen
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result We found that the addition of imperatorin significantly reversed the resistance to cisplatin in cisplatin-resistant HCC cells, which was Mcl-1 dependent. In summary, our study revealed that combination with imperatorin could enhance the antitumor activity of cisplatin via targeting Mcl-1 and reverse the resistance to cisplatin in HCC.
Combination Pair ID: 794
Pair Name Bufalin, Osimertinib
Phytochemical Bufalin
Drug Osimertinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Our study suggests that bufalin eliminates resistance to osimertinib by inhibiting Ku70-mediated MCL-1 overexpression, indicating that a combination of osimertinib and bufalin could be an effective additional treatment to overcome acquired resistance to osimertinib in NSCLC cells.
Combination Pair ID: 877
Pair Name Gossypol, Gemcitabine
Phytochemical Gossypol
Drug Gemcitabine
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Induced myeloid leukemia cell differentiation protein Mcl-1 Expression
Result Combination therapy with gossypol reveals synergism against gemcitabine resistance in cancer cells with high BCL-2 expression
03. Reference
No. Title Href
1 Synergistic antitumour activity of sorafenib in combination with tetrandrine is mediated by reactive oxygen species (ROS)/Akt signaling. Br J Cancer. 2013 Jul 23;109(2):342-50. doi: 10.1038/bjc.2013.334. Click
2 Targeting Na+ /K+ -ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma. Br J Pharmacol. 2021 Nov;178(21):4389-4407. doi: 10.1111/bph.15616. Click
3 Fisetin, a phytochemical, potentiates sorafenib-induced apoptosis and abrogates tumor growth in athymic nude mice implanted with BRAF-mutated melanoma cells. Oncotarget. 2015 Sep 29;6(29):28296-311. doi: 10.18632/oncotarget.5064. Click
4 The novel small molecule BH3 mimetic nobiletin synergizes with vorinostat to induce apoptosis and autophagy in small cell lung cancer. Biochem Pharmacol. 2023 Oct;216:115807. doi: 10.1016/j.bcp.2023.115807. Click
5 Amentoflavone Enhances the Therapeutic Efficacy of Sorafenib by Inhibiting Anti-apoptotic Potential and Potentiating Apoptosis in Hepatocellular Carcinoma In Vivo. Anticancer Res. 2018 Apr;38(4):2119-2125. doi: 10.21873/anticanres.12452. Click
6 Combined treatment with sorafenib and silibinin synergistically targets both HCC cells and cancer stem cells by enhanced inhibition of the phosphorylation of STAT3/ERK/AKT. Eur J Pharmacol. 2018 Aug 5;832:39-49. doi: 10.1016/j.ejphar.2018.05.027. Click
7 Epigenetic modifications and p21-cyclin B1 nexus in anticancer effect of histone deacetylase inhibitors in combination with silibinin on non-small cell lung cancer cells. Epigenetics. 2012 Oct;7(10):1161-72. doi: 10.4161/epi.22070. Click
8 Kurarinone Synergizes TRAIL-Induced Apoptosis in Gastric Cancer Cells. Cell Biochem Biophys. 2015 May;72(1):241-9. doi: 10.1007/s12013-014-0444-0. Click
9 Artesunate synergistically promotes sorafenib‑induced apoptosis and ferroptosis in non‑Hodgkin lymphoma cells through inhibition of the STAT3 pathway. Oncol Rep. 2023 Jul;50(1):147. doi: 10.3892/or.2023.8584. Click
10 Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195. Click
11 Ursolic acid enhances the antitumor effects of sorafenib associated with Mcl-1-related apoptosis and SLC7A11-dependent ferroptosis in human cancer. Pharmacol Res. 2022 Aug;182:106306. doi: 10.1016/j.phrs.2022.106306. Click
12 Synergistic anti-tumor effect of dual drug co-assembled nanoparticles based on ursolic acid and sorafenib. Colloids Surf B Biointerfaces. 2024 Feb;234:113724. doi: 10.1016/j.colsurfb.2023.113724. Click
13 Oleuropein reduces cisplatin resistance in ovarian cancer by targeting apoptotic pathway regulators. Life Sci. 2021 Aug 1;278:119525. doi: 10.1016/j.lfs.2021.119525. Click
14 Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel. Genes (Basel). 2022 Jun 24;13(7):1142. doi: 10.3390/genes13071142. Click
15 Shikonin sensitizes A549 cells to TRAIL-induced apoptosis through the JNK, STAT3 and AKT pathways. BMC Cell Biol. 2018 Dec 29;19(1):29. doi: 10.1186/s12860-018-0179-7. Click
16 Overcoming acquired resistance of EGFR-mutant NSCLC cells to the third generation EGFR inhibitor, osimertinib, with the natural product honokiol. Mol Oncol. 2020 Apr;14(4):882-895. doi: 10.1002/1878-0261.12645. Click
17 Bufalin and 5-fluorouracil synergistically induce apoptosis in colorectal cancer cells. Oncol Lett. 2018 May;15(5):8019-8026. doi: 10.3892/ol.2018.8332. Click
18 OSW-1 induces apoptosis and cyto-protective autophagy, and synergizes with chemotherapy on triple negative breast cancer metastasis. Cell Oncol (Dordr). 2022 Dec;45(6):1255-1275. doi: 10.1007/s13402-022-00716-2. Click
19 Resveratrol potentiates the anti-tumor effects of rapamycin in papillary thyroid cancer: PI3K/AKT/mTOR pathway involved. Arch Biochem Biophys. 2020 Aug 15;689:108461. doi: 10.1016/j.abb.2020.108461. Click
20 Curcumin reduces paclitaxel resistance in ovarian carcinoma cells by upregulating SNIP1 and inhibiting NFκB activity. Biochem Pharmacol. 2023 Jun;212:115581. doi: 10.1016/j.bcp.2023.115581. Click
21 Curcumin Enhances the Anticancer Effects of Binimetinib on Melanoma Cells by Inducing Mitochondrial Dysfunction and Cell Apoptosis with Necroptosis. Ann Dermatol. 2023 Jun;35(3):217-228. doi: 10.5021/ad.22.200. Click
22 Inhibition of Cell Proliferation in an NRAS Mutant Melanoma Cell Line by Combining Sorafenib and α-Mangostin. PLoS One. 2016 May 6;11(5):e0155217. doi: 10.1371/journal.pone.0155217. Click
23 (-)Gossypol and its combination with imatinib induce apoptosis in human chronic myeloid leukemic cells. Leuk Lymphoma. 2007 Nov;48(11):2204-12. doi: 10.1080/10428190701583991. Click
24 Downregulation of BCL2 by AT-101 enhances the antileukaemic effect of lenalidomide both by an immune dependant and independent manner. Br J Haematol. 2012 Apr;157(1):59-66. doi: 10.1111/j.1365-2141.2011.08984.x. Click
25 Synthetic lethality of combined AT-101 with idarubicin in acute myeloid leukemia via blockade of DNA repair and activation of intrinsic apoptotic pathway. Cancer Lett. 2019 Oct 1;461:31-43. doi: 10.1016/j.canlet.2019.07.003. Click
26 Targeting Nrf2 with wogonin overcomes cisplatin resistance in head and neck cancer. Apoptosis. 2016;21(11):1265-1278. doi:10.1007/s10495-016-1284-8 Click
27 Cordycepin improves sensitivity to temozolomide in glioblastoma cells by down-regulating MYC. J Cancer Res Clin Oncol. 2023 Nov;149(17):16055-16067. doi: 10.1007/s00432-023-05347-0. Click
28 Phenethyl isothiocyanate synergistically induces apoptosis with Gefitinib in non-small cell lung cancer cells via endoplasmic reticulum stress-mediated degradation of Mcl-1. Mol Carcinog. 2020 Jun;59(6):590-603. doi: 10.1002/mc.23184. Click
29 Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway. Mol Carcinog. 2019 Jun;58(6):1033-1045. doi: 10.1002/mc.22991. Click
30 Platycodin D induces apoptotic cell death through PI3K/AKT and MAPK/ERK pathways and synergizes with venetoclax in acute myeloid leukemia. Eur J Pharmacol. 2023 Oct 5;956:175957. doi: 10.1016/j.ejphar.2023.175957. Click
31 Enhanced anticancer activity by the combination of vinpocetine and sorafenib via PI3K/AKT/GSK-3β signaling axis in hepatocellular carcinoma cells. Anticancer Drugs. 2021 Aug 1;32(7):727-733. doi: 10.1097/CAD.0000000000001056. Click
32 Amentoflavone enhances sorafenib-induced apoptosis through extrinsic and intrinsic pathways in sorafenib-resistant hepatocellular carcinoma SK-Hep1 cells in vitro. Oncol Lett. 2017 Sep;14(3):3229-3234. doi: 10.3892/ol.2017.6540. Click
33 Artesunate improves venetoclax plus cytarabine AML cell targeting by regulating the Noxa/Bim/Mcl-1/p-Chk1 axis. Cell Death Dis. 2022 Apr 20;13(4):379. doi: 10.1038/s41419-022-04810-z. Click
34 Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction. Cell Oncol (Dordr). 2021 Feb;44(1):135-150. doi: 10.1007/s13402-020-00557-x. Click
35 Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004 Click
36 Imperatorin acts as a cisplatin sensitizer via downregulating Mcl-1 expression in HCC chemotherapy. Tumour Biol. 2016 Jan;37(1):331-9. doi: 10.1007/s13277-015-3591-z. Click
37 Degradation of MCL-1 by bufalin reverses acquired resistance to osimertinib in EGFR-mutant lung cancer. Toxicol Appl Pharmacol. 2019 Sep 15;379:114662. doi: 10.1016/j.taap.2019.114662. Click
38 Combination therapy with gossypol reveals synergism against gemcitabine resistance in cancer cells with high BCL-2 expression. PLoS One. 2012;7(12):e50786. doi: 10.1371/journal.pone.0050786. Click
It has been 460774 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP