TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Sequestosome-1
UniProt ID SQSTM_HUMAN
Gene Name SQSTM1
Gene ID 8878
Synonyms
SQSTM1, A170, DMRV, FTDALS3, NADGP, OSIL, PDB3, ZIP3, p60, p62, p62B
Sequence
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS
HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV
EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE
SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL
Pathway Map MAP LINK
KEGG ID hsa8878
TTD ID T17367
Pfam PF00564; PF00569; PF16577
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 505
Pair Name Magnoflorine, Doxorubicin
Phytochemical Name Magnoflorine
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result Magnoflorine improves sensitivity to doxorubicin (DOX) of breast cancer cells via inducing apoptosis and autophagy through AKT/mTOR and p38 signaling pathways
Combination Pair ID: 600
Pair Name Escin, Sorafenib
Phytochemical Name Escin
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result This combination also selectively targeted G0/G1 phase of cancer cells. In in vivo study, the combination reduced tumour load and lower elevated serum biochemical parameters. The combination of sorafenib/escin synergistically inhibits autophagy to induce late apoptosis in lung cancer cells' G0/G1 phase.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 1
Pair Name Camptothecin, Sorafenib
Phytochemical Camptothecin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result The synergetic combination significantly increases lipid peroxidation and iron concentration, decreases TAC, GPX4 and GR activity, and reduces the expression of both Nrf2 and SLC7A11. The downregulation of Nrf2 expression has a vital role in the reduction of resistance mediators to sorafenib against HCC cells like (p62, MT1G, and ABCG2) and improves the cellular uptake of sorafenib. The current study provided evidence that Nrf2 inhibition by CPT improves sorafenib's sensitivity and reduces sorafenib's resistance via the augmentation of sorafenib's ferroptosis action.
Combination Pair ID: 14
Pair Name Cepharanthine, Epirubicin
Phytochemical Cepharanthine
Drug Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result Cepharanthine sensitizes human triple negative breast cancer cells to chemotherapeutic agent epirubicin via inducing cofilin oxidation-mediated mitochondrial fission and apoptosis
Combination Pair ID: 972
Pair Name Berbamine, Cisplatin
Phytochemical Berbamine
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result These findings indicate that Ber might be a promising adjuvant for enhancing the cancer cell killing effect of chemotherapy via the inhibition of autophagy. In this process, Nox2 might be a significant mediator of Ber-induced aberrant lysosomal acidification.
Combination Pair ID: 982
Pair Name Kaempferol, Verapamil
Phytochemical Kaempferol
Drug Verapamil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result Kaempferol with Verapamil impeded panoramic chemoevasion pathways in breast cancer through ROS overproduction and disruption of lysosomal biogenesis
Combination Pair ID: 74
Pair Name Baicalein, Cisplatin
Phytochemical Baicalein
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Sequestosome-1 Phosphorylation
Result Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway
Combination Pair ID: 990
Pair Name Baicalein, Doxorubicin
Phytochemical Baicalein
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result Baicalein sensitizes triple negative breast cancer MDA-MB-231 cells to doxorubicin via autophagy-mediated down-regulation of CDK1
Combination Pair ID: 91
Pair Name Isorhamnetin, Chloroquine
Phytochemical Isorhamnetin
Drug Chloroquine
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result Our study highlights the critical role of ROS-mediating CaMKII/Drp1 signaling in the regulation of mitochondrial fission and apoptosis induced by combination of CQ/IH. These findings also suggest that IH could potentially be further developed as a novel chemotherapeutic agent. Furthermore, a combination of IH with classic autophagy/mitophagy inhibitor could represent a novel therapeutic strategy for the treatment of TNBC.
Combination Pair ID: 118
Pair Name Ginsenoside Ro, Fluorouracil
Phytochemical Ginsenoside Ro
Drug Fluorouracil
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result Ginsenoside Ro suppresses autophagy by interfering with autophagosome-lysosome fusion and lysosomal proteolytic activity via the ESR2-NCF1-ROS axis. Subsequently, such autophagic inhibition reduces CHEK1 degradation, enhances CHEK1-mediated DNA damage checkpoint arrest, and thereby sensitizes tumor cells to 5-Fu-induced cell death.
Combination Pair ID: 119
Pair Name Morin Hydrate, Cisplatin
Phytochemical Morin Hydrate
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result Our findings indicate that CP-Mh in combination served as a prominent regulator of autophagy and significant inducer of apoptosis that maintains a homeostatic balance towards HepG2 cells and the subcutaneous tumor model.
Combination Pair ID: 160
Pair Name Celastrol, Tamoxifen
Phytochemical Celastrol
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result The Synergistic Effects of Celastrol in combination with Tamoxifen on Apoptosis and Autophagy in MCF-7 Cells
Combination Pair ID: 671
Pair Name Celastrol, TNF-related apoptosis inducing ligand
Phytochemical Celastrol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result The combined use of TRAIL with celastrol may serve as a safe and adequate therapeutic technique for the treatment of TRAIL‑resistant lung cancer, suggesting that celastrol‑mediated autophagy flux inhibition sensitized TRAIL‑initiated apoptosis via regulation of ROS and ΔΨm.
Combination Pair ID: 1008
Pair Name Artesunate, Metformin
Phytochemical Artesunate
Drug Metformin
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result The study findings suggest that MET used in combination with ART can induce autophagy-dependent apoptosis in GBM cells by activating the ROS-AMPK-mTOR pathway, providing a potential new treatment for GBM.
Combination Pair ID: 186
Pair Name Astragaloside IV, Bevacizumab
Phytochemical Astragaloside IV
Drug Bevacizumab
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result This paper demonstrates that AST-IV enhances the effect of BV on inhibiting proliferation and promoting apoptosis of lung adenocarcinoma cells through inhibiting autophagy pathway.
Combination Pair ID: 686
Pair Name Ginsenoside Rg3, Endostar
Phytochemical Ginsenoside Rg3
Drug Endostar
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result Endostar combined with ginsenoside Rg3 has stronger inhibiting effect on breast cancer tumor growth in tumor-bearing mice than single drug, and it can inhibit angiogenesis and cell invasion, and enhance cell autophagy.
Combination Pair ID: 220
Pair Name Toosendanin, Camptothecin
Phytochemical Toosendanin
Drug Camptothecin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result These results suggest that toosendanin has the potential to be developed into an anti-cancer drug by blocking chemotherapy-induced protective autophagy.
Combination Pair ID: 237
Pair Name Triptonide, Cisplatin
Phytochemical Triptonide
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result Triptonide Restore Cisplatin Sensitivity in Drug-Resistant Gastric Cancer Cells by Inhibiting Protective Autophagy
Combination Pair ID: 244
Pair Name Saikosaponin A, Docetaxel
Phytochemical Saikosaponin A
Drug Docetaxel
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result SSA is posed as a novel QCCs-eradicating agent by aggravating autophagy in QCCs. In combination with the current therapy, SSA has potential to improve treatment effectiveness and to prevent cancer recurrence.
Combination Pair ID: 255
Pair Name Alpha-Hederin, Paclitaxel
Phytochemical Alpha-Hederin
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result Our findings suggest that α-Hed can increase the killing effect of Tax on NSCLC cells by promoting ROS accumulation, and that combining α-Hed with classical Tax represents a novel strategy for treating NSCLC.
Combination Pair ID: 270
Pair Name Pulsatilla saponin D, Temozolomide
Phytochemical Pulsatilla saponin D
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result SB365 inhibits autophagic flux and induces caspase-independent cell death in GBM cells in a manner involving cathepsin B and mainly reactive oxygen species, and its use in combination with temozolomide shows promise for the treatment of GBM.
Combination Pair ID: 288
Pair Name Menadione, Ascorbic Acid
Phytochemical Menadione
Drug Ascorbic Acid
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result These results suggest that AA+MD or MD treatment in combination with autophagy inducers could be further investigated as a novel approach for glioblastoma therapy.
Combination Pair ID: 764
Pair Name Honokiol, Chloroquine
Phytochemical Honokiol
Drug Chloroquine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result An enhanced antitumor effect was demonstrated following treatment with HNK combined with CQ by inhibiting autophagy and inducing apoptosis via a caspase-dependent and cathepsin D-involved manner. This combination may be a novel and useful antitumor approach for chemotherapy in NSCLC.
Combination Pair ID: 772
Pair Name Honokiol, Cabozantinib
Phytochemical Honokiol
Drug Cabozantinib
Disease Info [ICD-11: 2C90.0] Renal cell carcinoma Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result Cabozantinib + Honokiol combination can significantly inhibit c-Met-induced and Nrf2-mediated anti-oxidant pathway in renal cancer cells to promote increased oxidative stress and tumor cell death.
Combination Pair ID: 364
Pair Name Piceatannol, Everolimus
Phytochemical Piceatannol
Drug Everolimus
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result The findings of this study strongly support the application of combinatorial piceatannol and everolimus therapy in future clinical trials for gastric cancer patients.
Combination Pair ID: 804
Pair Name Pterostilbene, Sorafenib
Phytochemical Pterostilbene
Drug Sorafenib
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result PET obviously enhanced sorafenib's antitumour effects against GAC through inhibiting cell proliferation, inducing autophagy and promoting apoptosis. The combination therapy with PET and sorafenib may serve as a novel therapeutic strategy for treating GAC and deserve further clinical trials.
Combination Pair ID: 854
Pair Name Kaempferol, Docetaxel
Phytochemical Kaempferol
Drug Docetaxel
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result The above cellular and animal data suggest that docetaxel in combination with kaempferol has significant anti-prostate cancer effects and that it works by inducing autophagy in cells.
Combination Pair ID: 426
Pair Name Acteoside, Temozolomide
Phytochemical Acteoside
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result It was also determined that TMZ + acteoside induced apoptosis and autophagy through the mitogen‑activated protein kinase signaling pathway. These findings suggest that acteoside has beneficial effects on TMZ‑based glioblastoma therapy.
Combination Pair ID: 483
Pair Name Tiliroside, Sorafenib
Phytochemical Tiliroside
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result Our findings imply that tiliroside is a potent TBK1 inhibitor and a candidate natural anti-cancer product that could function as a sensitizer of sorafenib in HCC treatment by targeting TBK1 to induce ferroptosis.
Combination Pair ID: 486
Pair Name Gambogenic acid, Doxorubicin
Phytochemical Gambogenic acid
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result Gambogenic Acid Inhibits Basal Autophagy of Drug-Resistant Hepatoma Cells and Improves Its Sensitivity to Adriamycin.
Combination Pair ID: 882
Pair Name Gambogic Acid, Chloroquine
Phytochemical Gambogic Acid
Drug Chloroquine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result Gambogic acid induces autophagy and combines synergistically with chloroquine to suppress pancreatic cancer by increasing the accumulation of reactive oxygen species
Combination Pair ID: 499
Pair Name Bisdemethoxycucurmin, Icotinib
Phytochemical Bisdemethoxycucurmin
Drug Icotinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Sequestosome-1 Expression
Result Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.
Combination Pair ID: 564
Pair Name Hederagenin, Cisplatin
Phytochemical Hederagenin
Drug Cisplatin
Disease Info Head and neck cancer
Regulate Info Down-regulation Sequestosome-1 Expression
Result Hederagenin effectively targets cisplatin-resistant HNC cells in vitro and in vivo. Consistent with its effects in other types of cancer, hederagenin markedly induces apoptosis in HNC cells by activating the mitochondria-driven intrinsic apoptotic pathway. We demonstrated that the apoptosis-inducing effects of hederagenin are mediated by the inhibition of the Nrf2-ARE antioxidant pathway.
Combination Pair ID: 586
Pair Name Cantharidin, TNF-related apoptosis inducing ligand
Phytochemical Cantharidin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result The results of the present study revealed that cantharidin effectively sensitized cells to TRAIL‑mediated apoptosis and its effects are likely to be mediated by autophagy, the downregulation of c‑FLIP and the upregulation of DR‑5.
Combination Pair ID: 943
Pair Name Escin, Sorafenib
Phytochemical Escin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result Escin and sorafenib combination potentially up-regulates p62 to block autophagy to induce late apoptosis in liver cancer cells.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 127
Pair Name Epigallocatechin gallate, Gefitinib
Phytochemical Epigallocatechin gallate
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Sequestosome-1 Expression
Result EGCG overcomes Gef resistance by inhibiting autophagy and augmenting cell death through targeting ERK pathway in NSCLC. Gef and EGCG combination therapy may be an effective strategy to overcome acquired resistance in NSCLC.
03. Reference
No. Title Href
1 Magnoflorine improves sensitivity to doxorubicin (DOX) of breast cancer cells via inducing apoptosis and autophagy through AKT/mTOR and p38 signaling pathways. Biomed Pharmacother. 2020 Jan;121:109139. doi: 10.1016/j.biopha.2019.109139. Click
2 Escin enhanced the efficacy of sorafenib by autophagy-mediated apoptosis in lung cancer cells. Phytother Res. 2023 Oct;37(10):4819-4837. doi: 10.1002/ptr.7948. Click
3 Camptothecin Sensitizes Hepatocellular Carcinoma Cells to Sorafenib- Induced Ferroptosis Via Suppression of Nrf2. Inflammation. 2023 Aug;46(4):1493-1511. doi: 10.1007/s10753-023-01823-4. Click
4 Cepharanthine sensitizes human triple negative breast cancer cells to chemotherapeutic agent epirubicin via inducing cofilin oxidation-mediated mitochondrial fission and apoptosis. Acta Pharmacol Sin. 2022 Jan;43(1):177-193. doi: 10.1038/s41401-021-00715-3. Click
5 Berbamine Hydrochloride inhibits lysosomal acidification by activating Nox2 to potentiate chemotherapy-induced apoptosis via the ROS-MAPK pathway in human lung carcinoma cells. Cell Biol Toxicol. 2023 Aug;39(4):1297-1317. doi: 10.1007/s10565-022-09756-8. Click
6 Kaempferol with Verapamil impeded panoramic chemoevasion pathways in breast cancer through ROS overproduction and disruption of lysosomal biogenesis. Phytomedicine. 2023 May;113:154689. doi: 10.1016/j.phymed.2023.154689. Click
7 Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway. Biochem Biophys Res Commun. 2020 Oct 20;531(3):320-327. doi: 10.1016/j.bbrc.2020.07.045. Click
8 Baicalein sensitizes triple negative breast cancer MDA-MB-231 cells to doxorubicin via autophagy-mediated down-regulation of CDK1. Mol Cell Biochem. 2023 Jul;478(7):1519-1531. doi: 10.1007/s11010-022-04597-9. Click
9 ROS-mediated activation and mitochondrial translocation of CaMKII contributes to Drp1-dependent mitochondrial fission and apoptosis in triple-negative breast cancer cells by isorhamnetin and chloroquine. J Exp Clin Cancer Res. 2019 May 28;38(1):225. doi: 10.1186/s13046-019-1201-4. Click
10 Inhibition of autophagosome-lysosome fusion by ginsenoside Ro via the ESR2-NCF1-ROS pathway sensitizes esophageal cancer cells to 5-fluorouracil-induced cell death via the CHEK1-mediated DNA damage checkpoint. Autophagy. 2016;12(9):1593-1613. doi:10.1080/15548627.2016.1192751 Click
11 Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253. Click
12 The Synergistic Effects of Celastrol in combination with Tamoxifen on Apoptosis and Autophagy in MCF-7 Cells. J Immunol Res. 2021 Jul 22;2021:5532269. doi: 10.1155/2021/5532269. Click
13 Autophagy flux inhibition mediated by celastrol sensitized lung cancer cells to TRAIL‑induced apoptosis via regulation of mitochondrial transmembrane potential and reactive oxygen species. Mol Med Rep. 2019 Feb;19(2):984-993. doi: 10.3892/mmr.2018.9757. Click
14 Lower dose of metformin combined with artesunate induced autophagy-dependent apoptosis of glioblastoma by activating ROS-AMPK-mTOR axis. Exp Cell Res. 2023 Sep 1;430(1):113691. doi: 10.1016/j.yexcr.2023.113691. Click
15 Astragaloside IV enhances the sensibility of lung adenocarcinoma cells to bevacizumab by inhibiting autophagy. Drug Dev Res. 2022 Apr;83(2):461-469. doi: 10.1002/ddr.21878. Click
16 Inhibiting effect of Endostar combined with ginsenoside Rg3 on breast cancer tumor growth in tumor-bearing mice. Asian Pac J Trop Med. 2016 Feb;9(2):180-3. doi: 10.1016/j.apjtm.2016.01.010. Click
17 Toosendanin, a novel potent vacuolar-type H+-translocating ATPase inhibitor, sensitizes cancer cells to chemotherapy by blocking protective autophagy. Int J Biol Sci. 2022 Mar 28;18(7):2684-2702. doi: 10.7150/ijbs.71041. Click
18 Triptonide Restore Cisplatin Sensitivity in Drug-Resistant Gastric Cancer Cells by Inhibiting Protective Autophagy Click
19 Saikosaponin A enhances Docetaxel efficacy by selectively inducing death of dormant prostate cancer cells through excessive autophagy. Cancer Lett. 2023 Feb 1;554:216011. doi: 10.1016/j.canlet.2022.216011. Click
20 The Novel Autophagy Inhibitor Alpha-Hederin Promoted Paclitaxel Cytotoxicity by Increasing Reactive Oxygen Species Accumulation in Non-Small Cell Lung Cancer Cells. Int J Mol Sci. 2018 Oct 18;19(10):3221. doi: 10.3390/ijms19103221. Click
21 SB365, Pulsatilla Saponin D Induces Caspase-Independent Cell Death and Augments the Anticancer Effect of Temozolomide in Glioblastoma Multiforme Cells. Molecules. 2019 Sep 5;24(18):3230. doi: 10.3390/molecules24183230. Click
22 Combination of Ascorbic Acid and Menadione Induces Cytotoxic Autophagy in Human Glioblastoma Cells. Oxid Med Cell Longev. 2022 Mar 23;2022:2998132. doi: 10.1155/2022/2998132. Click
23 Honokiol exhibits enhanced antitumor effects with chloroquine by inducing cell death and inhibiting autophagy in human non-small cell lung cancer cells. Oncol Rep. 2015 Sep;34(3):1289-300. doi: 10.3892/or.2015.4091. Click
24 A novel combination therapy with Cabozantinib and Honokiol effectively inhibits c-Met-Nrf2-induced renal tumor growth through increased oxidative stress. Redox Biol. 2023 Dec;68:102945. doi: 10.1016/j.redox.2023.102945. Click
25 Piceatannol enhances Beclin-1 activity to suppress tumor progression and its combination therapy strategy with everolimus in gastric cancer. Sci China Life Sci. 2023 Feb;66(2):298-312. doi: 10.1007/s11427-022-2185-9. Click
26 Pterostilbene enhances sorafenib's anticancer effects on gastric adenocarcinoma. J Cell Mol Med. 2020 Nov;24(21):12525-12536. doi: 10.1111/jcmm.15795. Click
27 Combination of Kaempferol and Docetaxel Induces Autophagy in Prostate Cancer Cells In Vitro and In Vivo. Int J Mol Sci. 2023 Sep 25;24(19):14519. doi: 10.3390/ijms241914519. Click
28 Synergistic anticancer effect of acteoside and temozolomide-based glioblastoma chemotherapy. Int J Mol Med. 2019 Mar;43(3):1478-1486. doi: 10.3892/ijmm.2019.4061. Click
29 Tiliroside targets TBK1 to induce ferroptosis and sensitize hepatocellular carcinoma to sorafenib. Phytomedicine. 2023 Mar;111:154668. doi: 10.1016/j.phymed.2023.154668. Click
30 Gambogenic Acid Inhibits Basal Autophagy of Drug-Resistant Hepatoma Cells and Improves Its Sensitivity to Adriamycin. Biol Pharm Bull. 2022;45(1):63-70. doi: 10.1248/bpb.b21-00511. Click
31 Gambogic acid induces autophagy and combines synergistically with chloroquine to suppress pancreatic cancer by increasing the accumulation of reactive oxygen species. Cancer Cell Int. 2019 Jan 5;19:7. doi: 10.1186/s12935-018-0705-x. Click
32 Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib. Click
33 Hederagenin Induces Apoptosis in Cisplatin-Resistant Head and Neck Cancer Cells by Inhibiting the Nrf2-ARE Antioxidant Pathway. Oxid Med Cell Longev. 2017;2017:5498908. doi:10.1155/2017/5498908 Click
34 Downregulation of c‑FLIP and upregulation of DR‑5 by cantharidin sensitizes TRAIL‑mediated apoptosis in prostate cancer cells via autophagy flux. Int J Mol Med. 2020 Jul;46(1):280-288. doi: 10.3892/ijmm.2020.4566. Click
35 Escin-sorafenib synergy up-regulates LC3-II and p62 to induce apoptosis in hepatocellular carcinoma cells. Environ Toxicol. 2024 Feb;39(2):840-856. doi: 10.1002/tox.23988. Click
36 EGCG overcomes gefitinib resistance by inhibiting autophagy and augmenting cell death through targeting ERK phosphorylation in NSCLC. Onco Targets Ther. 2019 Jul 26;12:6033-6043. doi: 10.2147/OTT.S209441. Click
It has been 519054 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP