InterPAD - DETAILS

MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TSATVGPKAPSGGKKATQASQEY

No.	Title	Href
1	[10]-Gingerol improves doxorubicin anticancer activity and decreases its side effects in triple negative breast cancer models. Cell Oncol (Dordr). 2020 Oct;43(5):915-929. doi: 10.1007/s13402-020-00539-z.	`Click`
2	Mesenchymal-epithelial transition and AXL inhibitor TP-0903 sensitise triple-negative breast cancer cells to the antimalarial compound, artesunate. Sci Rep. 2024 Jan 3;14(1):425. doi: 10.1038/s41598-023-50710-3.	`Click`
3	Berberine induces oxidative DNA damage and impairs homologous recombination repair in ovarian cancer cells to confer increased sensitivity to PARP inhibition. Cell Death Dis. 2017;8(10):e3070. Published 2017 Oct 5. doi:10.1038/cddis.2017.471	`Click`
4	Modulation of STAT3 Signaling, Cell Redox Defenses and Cell Cycle Checkpoints by β-Caryophyllene in Cholangiocarcinoma Cells: Possible Mechanisms Accounting for Doxorubicin Chemosensitization and Chemoprevention. Cells. 2020 Apr 2;9(4):858. doi: 10.3390/cells9040858.	`Click`
5	β-elemene enhances both radiosensitivity and chemosensitivity of glioblastoma cells through the inhibition of the ATM signaling pathway. Oncol Rep. 2015 Aug;34(2):943-51. doi: 10.3892/or.2015.4050.	`Click`
6	Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.	`Click`
7	Synergistic effect of cryptotanshinone and temozolomide treatment against human glioblastoma cells. Sci Rep. 2023 Dec 9;13(1):21835. doi: 10.1038/s41598-023-48777-z.	`Click`
8	Curcumin enhances poly(ADP-ribose) polymerase inhibitor sensitivity to chemotherapy in breast cancer cells. J Nutr Biochem. 2015 Dec;26(12):1442-7. doi: 10.1016/j.jnutbio.2015.07.015.	`Click`
9	Curcumin sensitizes carboplatin treatment in triple negative breast cancer through reactive oxygen species induced DNA repair pathway. Mol Biol Rep. 2022;49(4):3259-3270. doi:10.1007/s11033-022-07162-1.	`Click`
10	Ginsenoside RG1 augments doxorubicin-induced apoptotic cell death in MDA-MB-231 breast cancer cell lines. J Biochem Mol Toxicol. 2022 Jan;36(1):e22945. doi: 10.1002/jbt.22945.	`Click`
11	Gypenosides Synergistically Enhances the Anti-Tumor Effect of 5-Fluorouracil on Colorectal Cancer In Vitro and In Vivo: A Role for Oxidative Stress-Mediated DNA Damage and p53 Activation. PLoS One. 2015 Sep 14;10(9):e0137888. doi: 10.1371/journal.pone.0137888.	`Click`
12	Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076.	`Click`
13	Selective synergistic anticancer effects of cisplatin and oridonin against human p53-mutant esophageal squamous carcinoma cells. Anticancer Drugs. 2022 Jan 1;33(1):e444-e452. doi: 10.1097/CAD.0000000000001237.	`Click`
14	Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195.	`Click`
15	Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage. Thorac Cancer. 2023 Jul;14(21):2007-2017. doi: 10.1111/1759-7714.14982.	`Click`
16	Piperlongumine potentiates the antitumor efficacy of oxaliplatin through ROS induction in gastric cancer cells. Cell Oncol (Dordr). 2019;42(6):847-860. doi:10.1007/s13402-019-00471-x	`Click`
17	Protocatechuic aldehyde acts synergistically with dacarbazine to augment DNA double-strand breaks and promote apoptosis in cutaneous melanoma cells. BMC Complement Med Ther. 2023 Apr 27;23(1):133. doi: 10.1186/s12906-023-03965-2.	`Click`
18	Synergistic anticancer activity of resveratrol in combination with docetaxel in prostate carcinoma cells. Nutr Res Pract. 2021 Feb;15(1):12-25. doi: 10.4162/nrp.2021.15.1.12.	`Click`
19	Chemosensitizing Effect of Saikosaponin B on B16F10 Melanoma Cells. Nutr Cancer. 2017 Apr;69(3):505-511. doi: 10.1080/01635581.2017.1285407.	`Click`
20	Pharmacological Ascorbate Suppresses Growth of Gastric Cancer Cells with GLUT1 Overexpression and Enhances the Efficacy of Oxaliplatin Through Redox Modulation. Theranostics. 2018 Feb 2;8(5):1312-1326. doi: 10.7150/thno.21745.	`Click`
21	Synergistic enhancement of topotecan-induced cell death by ascorbic acid in human breast MCF-7 tumor cells. Free Radic Biol Med. 2017 Dec;113:406-412. doi: 10.1016/j.freeradbiomed.2017.10.377	`Click`
22	Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway. Phytother Res. 2021 Oct;35(10):5899-5918. doi: 10.1002/ptr.7299	`Click`
23	Artesunate improves venetoclax plus cytarabine AML cell targeting by regulating the Noxa/Bim/Mcl-1/p-Chk1 axis. Cell Death Dis. 2022 Apr 20;13(4):379. doi: 10.1038/s41419-022-04810-z.	`Click`
24	Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004	`Click`
25	Ascorbate sensitizes human osteosarcoma cells to the cytostatic effects of cisplatin. Pharmacol Res Perspect. 2020 Aug;8(4):e00632. doi: 10.1002/prp2.632.	`Click`

No.

Title

Href

[10]-Gingerol improves doxorubicin anticancer activity and decreases its side effects in triple negative breast cancer models. Cell Oncol (Dordr). 2020 Oct;43(5):915-929. doi: 10.1007/s13402-020-00539-z.

Click

Mesenchymal-epithelial transition and AXL inhibitor TP-0903 sensitise triple-negative breast cancer cells to the antimalarial compound, artesunate. Sci Rep. 2024 Jan 3;14(1):425. doi: 10.1038/s41598-023-50710-3.

Click

Berberine induces oxidative DNA damage and impairs homologous recombination repair in ovarian cancer cells to confer increased sensitivity to PARP inhibition. Cell Death Dis. 2017;8(10):e3070. Published 2017 Oct 5. doi:10.1038/cddis.2017.471

Click

Modulation of STAT3 Signaling, Cell Redox Defenses and Cell Cycle Checkpoints by β-Caryophyllene in Cholangiocarcinoma Cells: Possible Mechanisms Accounting for Doxorubicin Chemosensitization and Chemoprevention. Cells. 2020 Apr 2;9(4):858. doi: 10.3390/cells9040858.

Click

β-elemene enhances both radiosensitivity and chemosensitivity of glioblastoma cells through the inhibition of the ATM signaling pathway. Oncol Rep. 2015 Aug;34(2):943-51. doi: 10.3892/or.2015.4050.

Click

Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.

Click

Synergistic effect of cryptotanshinone and temozolomide treatment against human glioblastoma cells. Sci Rep. 2023 Dec 9;13(1):21835. doi: 10.1038/s41598-023-48777-z.

Click

Curcumin enhances poly(ADP-ribose) polymerase inhibitor sensitivity to chemotherapy in breast cancer cells. J Nutr Biochem. 2015 Dec;26(12):1442-7. doi: 10.1016/j.jnutbio.2015.07.015.

Click

Curcumin sensitizes carboplatin treatment in triple negative breast cancer through reactive oxygen species induced DNA repair pathway. Mol Biol Rep. 2022;49(4):3259-3270. doi:10.1007/s11033-022-07162-1.

Click

Ginsenoside RG1 augments doxorubicin-induced apoptotic cell death in MDA-MB-231 breast cancer cell lines. J Biochem Mol Toxicol. 2022 Jan;36(1):e22945. doi: 10.1002/jbt.22945.

Click

Gypenosides Synergistically Enhances the Anti-Tumor Effect of 5-Fluorouracil on Colorectal Cancer In Vitro and In Vivo: A Role for Oxidative Stress-Mediated DNA Damage and p53 Activation. PLoS One. 2015 Sep 14;10(9):e0137888. doi: 10.1371/journal.pone.0137888.

Click

Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076.

Click

Selective synergistic anticancer effects of cisplatin and oridonin against human p53-mutant esophageal squamous carcinoma cells. Anticancer Drugs. 2022 Jan 1;33(1):e444-e452. doi: 10.1097/CAD.0000000000001237.

Click

Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195.

Click

Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage. Thorac Cancer. 2023 Jul;14(21):2007-2017. doi: 10.1111/1759-7714.14982.

Click

Piperlongumine potentiates the antitumor efficacy of oxaliplatin through ROS induction in gastric cancer cells. Cell Oncol (Dordr). 2019;42(6):847-860. doi:10.1007/s13402-019-00471-x

Click

Protocatechuic aldehyde acts synergistically with dacarbazine to augment DNA double-strand breaks and promote apoptosis in cutaneous melanoma cells. BMC Complement Med Ther. 2023 Apr 27;23(1):133. doi: 10.1186/s12906-023-03965-2.

Click

Synergistic anticancer activity of resveratrol in combination with docetaxel in prostate carcinoma cells. Nutr Res Pract. 2021 Feb;15(1):12-25. doi: 10.4162/nrp.2021.15.1.12.

Click

Chemosensitizing Effect of Saikosaponin B on B16F10 Melanoma Cells. Nutr Cancer. 2017 Apr;69(3):505-511. doi: 10.1080/01635581.2017.1285407.

Click

Pharmacological Ascorbate Suppresses Growth of Gastric Cancer Cells with GLUT1 Overexpression and Enhances the Efficacy of Oxaliplatin Through Redox Modulation. Theranostics. 2018 Feb 2;8(5):1312-1326. doi: 10.7150/thno.21745.

Click

Synergistic enhancement of topotecan-induced cell death by ascorbic acid in human breast MCF-7 tumor cells. Free Radic Biol Med. 2017 Dec;113:406-412. doi: 10.1016/j.freeradbiomed.2017.10.377

Click

Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway. Phytother Res. 2021 Oct;35(10):5899-5918. doi: 10.1002/ptr.7299

Click

Artesunate improves venetoclax plus cytarabine AML cell targeting by regulating the Noxa/Bim/Mcl-1/p-Chk1 axis. Cell Death Dis. 2022 Apr 20;13(4):379. doi: 10.1038/s41419-022-04810-z.

Click

Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004

Click

Ascorbate sensitizes human osteosarcoma cells to the cytostatic effects of cisplatin. Pharmacol Res Perspect. 2020 Aug;8(4):e00632. doi: 10.1002/prp2.632.

Click

Name	Histone H2AX
UniProt ID	H2AX_HUMAN
Gene Name	H2AX
Gene ID	3014
Synonyms	H2AX, H2A.X, H2A/X, H2AFX
Sequence	MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSATVGPKAPSGGKKATQASQEY
Pathway Map	`MAP LINK`
T.C. Number	8.A.68.1.14
KEGG ID	hsa3014
TTD ID	T55244
Pfam	PF00125; PF00808; PF16211

Pair Name	10-Gingerol, Doxorubicin
Phytochemical Name	10-Gingerol
Anticancer drug Name	Doxorubicin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	Our data indicate that [10]-gingerol has potential to be used as a neoadjuvant or in combined therapy with doxorubicin, to improve its anticancer activity.

Pair Name	Artesunate, TP-0903
Phytochemical	Artesunate
Drug	TP-0903
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Phosphorylation
Result	Synergistic interactions between TP-0903 and ART indicate that combination approaches involving these compounds can have therapeutic prospects for TNBC treatment.

Pair Name	Berberine, Niraparib
Phytochemical	Berberine
Drug	Niraparib
Disease Info	[ICD-11: 2C73]	Ovarian cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Phosphorylation
Result	The results indicate that by inducing oxidative DNA damage and downregulating HRR in cancer cells berberine is able to further sensitize cancer cells to PARP inhibition. These results demonstrate a potential therapeutic value of combined application of berberine and PARP inhibitors in ovarian cancer treatment.

Pair Name	Beta-Caryophyllene, Doxorubicin
Phytochemical	Beta-Caryophyllene
Drug	Doxorubicin
Disease Info	[ICD-11: 2C17]	Hepatocellular carcinoma	Investigative
Regulate Info	Down-regulation	Histone H2AX	Phosphorylation
Result	This evidence highlighted a possible role of STAT3 as a final effector of a complex network regulated by β-caryophyllene, which leads to an enhanced doxorubicin-sensitivity of cholangiocarcinoma cells and a lowered chemotherapy toxicity in nonmalignant cholangiocytes, thus strengthening the interest for this natural sesquiterpene as a dual-acting chemosensitizing and chemopreventive agent.

Pair Name	Beta-Elemene, Temozolomide
Phytochemical	Beta-Elemene
Drug	Temozolomide
Disease Info	[ICD-11: 2A00]	Glioblastoma multiforme	Investigative
Regulate Info	Down-regulation	Histone H2AX	Expression
Result	These results revealed that β-elemene could significantly increase the radiosensitivity and chemosensitivity of GBM. β-elemene may be used as a potential drug in combination with the radiotherapy and chemotherapy of GBM

Pair Name	Bisdemethoxycucurmin, Icotinib
Phytochemical	Bisdemethoxycucurmin
Drug	Icotinib
Disease Info	[ICD-11: 2C25]	Lung cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.

Pair Name	Cryptotanshinone, Temozolomide
Phytochemical	Cryptotanshinone
Drug	Temozolomide
Disease Info	[ICD-11: 2A00]	Glioblastoma multiforme	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	Combined treatment with CTS and TMZ might be an effective option to overcome the chemoresistance of GBM cells in a long-term treatment strategy.

Pair Name	Curcumin, ABT-888
Phytochemical	Curcumin
Drug	ABT-888
Disease Info	[ICD-11:2B5Y]	Malignant mesenchymal neoplasm	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	Our study indicates that cotreatment of curcumin and PARP inhibitor might be useful for the combination chemotherapy for aggressive breast cancer treatment as a natural bioactive compound.

Pair Name	Curcumin, Carboplatin
Phytochemical	Curcumin
Drug	Carboplatin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	Our data demonstrate that curcumin sensitizes TNBC to the anticancer effect of carboplatin by increasing ROS-induced DNA damage, thus providing an effective combination treatment strategy for TNBC.

Pair Name	Ginsenoside Rg1, Doxorubicin
Phytochemical	Ginsenoside Rg1
Drug	Doxorubicin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	The present results support the chemosensitizing property of ginsenoside Rg1 in triple-negative breast cancer cell lines.

Pair Name	Gynostemma Extract, Fluorouracil
Phytochemical	Gynostemma Extract
Drug	Fluorouracil
Disease Info	[ICD-11: 2B91]	Colorectal cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Phosphorylation
Result	Gypenosides Synergistically Enhances the Anti-Tumor Effect of 5-Fluorouracil on Colorectal Cancer In Vitro and In Vivo: A Role for Oxidative Stress-Mediated DNA Damage and p53 Activation

Pair Name	Licochalcone B, TNF-related apoptosis inducing ligand
Phytochemical	Licochalcone B
Drug	TNF-related apoptosis inducing ligand
Disease Info	[ICD-11: 2C12]	Hepatocellular carcinoma	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC.

Pair Name	Oridonin, Cisplatin
Phytochemical	Oridonin
Drug	Cisplatin
Disease Info	[ICD-11: 2B70]	Esophageal cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	Selective synergistic anticancer effects of cisplatin and oridonin against human p53-mutant esophageal squamous carcinoma cells

Pair Name	Oridonin, Venetoclax
Phytochemical	Oridonin
Drug	Venetoclax
Disease Info	[ICD-11: 2A60.Z]	Acute myeloid leukemia	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	Oridonin and venetoclax synergistically promote AML cell apoptosis by inhibiting AKT signaling.

Pair Name	Patchouli alcohol, Vincristine
Phytochemical	Patchouli alcohol
Drug	Vincristine
Disease Info	[ICD-11: 2C25]	Lung cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Phosphorylation
Result	Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage

Pair Name	Piperlongumine, Oxaliplatin
Phytochemical	Piperlongumine
Drug	Oxaliplatin
Disease Info	[ICD-11: 2B72]	Gastric cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	Piperlongumine significantly enhanced oxaliplatin-induced growth inhibition of these cells and that TrxR1 activity is involved in their synergistic effect both in vitro and in vivo. These data suggest that PL and oxaliplatin combination treatment of gastric cancer may be more effective than oxaliplatin alone.

Pair Name	Protocatechualdehyde, Dacarbazine
Phytochemical	Protocatechualdehyde
Drug	Dacarbazine
Disease Info	[ICD-11: 2C30]	Melanoma	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	Our study demonstrates that the bioactive compound, Protocatechuic aldehyde, synergistically promotes the cytotoxicity of DTIC to melanoma cells through destabilization of MGMT protein. It could be a potential candidate for melanoma chemotherapy.

Pair Name	Resveratrol, Docetaxel
Phytochemical	Resveratrol
Drug	Docetaxel
Disease Info	[ICD-11: 2C82]	Prostate cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Phosphorylation
Result	We report resveratrol as an adjuvant drug candidate for improving the outcome of treatment in DTX therapy. Although the underlying mechanisms of necroptosis should be investigated comprehensively, targeting apoptosis and necroptosis simultaneously in the treatment of cancer can be a useful strategy for the development of promising drug candidates.

Pair Name	Saikosaponin B1, Etoposide
Phytochemical	Saikosaponin B1
Drug	Etoposide
Disease Info	[ICD-11: 2C30]	Melanoma	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	We conclude Saikosaponin B can be an attractive adjuvant for enhancing the clinical effect of cancer chemotherapy.

Pair Name	Vitamin C, Oxaliplatin
Phytochemical	Vitamin C
Drug	Oxaliplatin
Disease Info	[ICD-11: 2B72]	Gastric cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	The current study showed that GLUT1 expression was inversely correlated with sensitivity of gastric cancer cells to pharmacological ascorbate and suggested that GLUT1 expression in gastric cancer may serve as a marker for sensitivity to pharmacological ascorbate.

Pair Name	Vitamin C, Topotecan
Phytochemical	Vitamin C
Drug	Topotecan
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	Synergistic enhancement of topotecan-induced cell death by ascorbic acid in human breast MCF-7 tumor cells.

Pair Name	Zeylenone, Cisplatin
Phytochemical	Zeylenone
Drug	Cisplatin
Disease Info	[ICD-11: 2B51]	Osteosarcoma	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway

Pair Name	Artesunate, Venetoclax
Phytochemical	Artesunate
Drug	Venetoclax
Disease Info	[ICD-11: 2A60.Z]	Acute myeloid leukemia	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	We provide a new triple combination for AML treatment by targeting the Noxa/Mcl-1/Bim axis to reverse Mcl-1/p-Chk1 resistance of cytarabine therapy.

Pair Name	Mitocurcumin, Cytarabine
Phytochemical	Mitocurcumin
Drug	Cytarabine
Disease Info	[ICD-11: 2B33.4]	Leukemia	Investigative
Regulate Info	Up-regulation	Histone H2AX	Phosphorylation
Result	The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis.

Pair Name	Vitamin C, Cisplatin
Phytochemical	Vitamin C
Drug	Cisplatin
Disease Info	[ICD-11: 2B51]	Osteosarcoma	Investigative
Regulate Info	Up-regulation	Histone H2AX	Expression
Result	Our findings provide a rationale for combining cisplatin with ascorbate in therapeutic strategies against OS.