TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Histone H2AX
UniProt ID H2AX_HUMAN
Gene Name H2AX
Gene ID 3014
Synonyms
H2AX, H2A.X, H2A/X, H2AFX
Sequence
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TSATVGPKAPSGGKKATQASQEY
Pathway Map MAP LINK
T.C. Number 8.A.68.1.14
KEGG ID hsa3014
TTD ID T55244
Pfam PF00125; PF00808; PF16211
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 484
Pair Name 10-Gingerol, Doxorubicin
Phytochemical Name 10-Gingerol
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result Our data indicate that [10]-gingerol has potential to be used as a neoadjuvant or in combined therapy with doxorubicin, to improve its anticancer activity.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 59
Pair Name Saikosaponin B1, Etoposide
Phytochemical Saikosaponin B1
Drug Etoposide
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result We conclude Saikosaponin B can be an attractive adjuvant for enhancing the clinical effect of cancer chemotherapy.
Combination Pair ID: 129
Pair Name Licochalcone B, TNF-related apoptosis inducing ligand
Phytochemical Licochalcone B
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC.
Combination Pair ID: 1007
Pair Name Artesunate, TP-0903
Phytochemical Artesunate
Drug TP-0903
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Histone H2AX Phosphorylation
Result Synergistic interactions between TP-0903 and ART indicate that combination approaches involving these compounds can have therapeutic prospects for TNBC treatment.
Combination Pair ID: 183
Pair Name Oridonin, Cisplatin
Phytochemical Oridonin
Drug Cisplatin
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result Selective synergistic anticancer effects of cisplatin and oridonin against human p53-mutant esophageal squamous carcinoma cells
Combination Pair ID: 1009
Pair Name Oridonin, Venetoclax
Phytochemical Oridonin
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result Oridonin and venetoclax synergistically promote AML cell apoptosis by inhibiting AKT signaling.
Combination Pair ID: 208
Pair Name Ginsenoside Rg1, Doxorubicin
Phytochemical Ginsenoside Rg1
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result The present results support the chemosensitizing property of ginsenoside Rg1 in triple-negative breast cancer cell lines.
Combination Pair ID: 707
Pair Name Beta-Elemene, Temozolomide
Phytochemical Beta-Elemene
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Histone H2AX Expression
Result These results revealed that β-elemene could significantly increase the radiosensitivity and chemosensitivity of GBM. β-elemene may be used as a potential drug in combination with the radiotherapy and chemotherapy of GBM
Combination Pair ID: 1033
Pair Name Patchouli alcohol, Vincristine
Phytochemical Patchouli alcohol
Drug Vincristine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Histone H2AX Phosphorylation
Result Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage
Combination Pair ID: 263
Pair Name Gynostemma Extract, Fluorouracil
Phytochemical Gynostemma Extract
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Histone H2AX Phosphorylation
Result Gypenosides Synergistically Enhances the Anti-Tumor Effect of 5-Fluorouracil on Colorectal Cancer In Vitro and In Vivo: A Role for Oxidative Stress-Mediated DNA Damage and p53 Activation
Combination Pair ID: 1038
Pair Name Cryptotanshinone, Temozolomide
Phytochemical Cryptotanshinone
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result Combined treatment with CTS and TMZ might be an effective option to overcome the chemoresistance of GBM cells in a long-term treatment strategy.
Combination Pair ID: 756
Pair Name Berberine, Niraparib
Phytochemical Berberine
Drug Niraparib
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Histone H2AX Phosphorylation
Result The results indicate that by inducing oxidative DNA damage and downregulating HRR in cancer cells berberine is able to further sensitize cancer cells to PARP inhibition. These results demonstrate a potential therapeutic value of combined application of berberine and PARP inhibitors in ovarian cancer treatment.
Combination Pair ID: 377
Pair Name Resveratrol, Docetaxel
Phytochemical Resveratrol
Drug Docetaxel
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Histone H2AX Phosphorylation
Result We report resveratrol as an adjuvant drug candidate for improving the outcome of treatment in DTX therapy. Although the underlying mechanisms of necroptosis should be investigated comprehensively, targeting apoptosis and necroptosis simultaneously in the treatment of cancer can be a useful strategy for the development of promising drug candidates.
Combination Pair ID: 396
Pair Name Curcumin, Carboplatin
Phytochemical Curcumin
Drug Carboplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result Our data demonstrate that curcumin sensitizes TNBC to the anticancer effect of carboplatin by increasing ROS-induced DNA damage, thus providing an effective combination treatment strategy for TNBC.
Combination Pair ID: 822
Pair Name Curcumin, ABT-888
Phytochemical Curcumin
Drug ABT-888
Disease Info [ICD-11:2B5Y] Malignant mesenchymal neoplasm Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result Our study indicates that cotreatment of curcumin and PARP inhibitor might be useful for the combination chemotherapy for aggressive breast cancer treatment as a natural bioactive compound.
Combination Pair ID: 475
Pair Name Protocatechualdehyde, Dacarbazine
Phytochemical Protocatechualdehyde
Drug Dacarbazine
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result Our study demonstrates that the bioactive compound, Protocatechuic aldehyde, synergistically promotes the cytotoxicity of DTIC to melanoma cells through destabilization of MGMT protein. It could be a potential candidate for melanoma chemotherapy.
Combination Pair ID: 499
Pair Name Bisdemethoxycucurmin, Icotinib
Phytochemical Bisdemethoxycucurmin
Drug Icotinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.
Combination Pair ID: 537
Pair Name Vitamin C, Topotecan
Phytochemical Vitamin C
Drug Topotecan
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result Synergistic enhancement of topotecan-induced cell death by ascorbic acid in human breast MCF-7 tumor cells.
Combination Pair ID: 540
Pair Name Vitamin C, Oxaliplatin
Phytochemical Vitamin C
Drug Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result The current study showed that GLUT1 expression was inversely correlated with sensitivity of gastric cancer cells to pharmacological ascorbate and suggested that GLUT1 expression in gastric cancer may serve as a marker for sensitivity to pharmacological ascorbate.
Combination Pair ID: 581
Pair Name Zeylenone, Cisplatin
Phytochemical Zeylenone
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway
Combination Pair ID: 589
Pair Name Beta-Caryophyllene, Doxorubicin
Phytochemical Beta-Caryophyllene
Drug Doxorubicin
Disease Info [ICD-11: 2C17] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Histone H2AX Phosphorylation
Result This evidence highlighted a possible role of STAT3 as a final effector of a complex network regulated by β-caryophyllene, which leads to an enhanced doxorubicin-sensitivity of cholangiocarcinoma cells and a lowered chemotherapy toxicity in nonmalignant cholangiocytes, thus strengthening the interest for this natural sesquiterpene as a dual-acting chemosensitizing and chemopreventive agent.
Combination Pair ID: 419
Pair Name Piperlongumine, Oxaliplatin
Phytochemical Piperlongumine
Drug Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result Piperlongumine significantly enhanced oxaliplatin-induced growth inhibition of these cells and that TrxR1 activity is involved in their synergistic effect both in vitro and in vivo. These data suggest that PL and oxaliplatin combination treatment of gastric cancer may be more effective than oxaliplatin alone.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 172
Pair Name Artesunate, Venetoclax
Phytochemical Artesunate
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result We provide a new triple combination for AML treatment by targeting the Noxa/Mcl-1/Bim axis to reverse Mcl-1/p-Chk1 resistance of cytarabine therapy.
Combination Pair ID: 770
Pair Name Mitocurcumin, Cytarabine
Phytochemical Mitocurcumin
Drug Cytarabine
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Up-regulation Histone H2AX Phosphorylation
Result The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis.
Combination Pair ID: 539
Pair Name Vitamin C, Cisplatin
Phytochemical Vitamin C
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Histone H2AX Expression
Result Our findings provide a rationale for combining cisplatin with ascorbate in therapeutic strategies against OS.
03. Reference
No. Title Href
1 [10]-Gingerol improves doxorubicin anticancer activity and decreases its side effects in triple negative breast cancer models. Cell Oncol (Dordr). 2020 Oct;43(5):915-929. doi: 10.1007/s13402-020-00539-z. Click
2 Chemosensitizing Effect of Saikosaponin B on B16F10 Melanoma Cells. Nutr Cancer. 2017 Apr;69(3):505-511. doi: 10.1080/01635581.2017.1285407. Click
3 Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. Click
4 Mesenchymal-epithelial transition and AXL inhibitor TP-0903 sensitise triple-negative breast cancer cells to the antimalarial compound, artesunate. Sci Rep. 2024 Jan 3;14(1):425. doi: 10.1038/s41598-023-50710-3. Click
5 Selective synergistic anticancer effects of cisplatin and oridonin against human p53-mutant esophageal squamous carcinoma cells. Anticancer Drugs. 2022 Jan 1;33(1):e444-e452. doi: 10.1097/CAD.0000000000001237. Click
6 Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195. Click
7 Ginsenoside RG1 augments doxorubicin-induced apoptotic cell death in MDA-MB-231 breast cancer cell lines. J Biochem Mol Toxicol. 2022 Jan;36(1):e22945. doi: 10.1002/jbt.22945. Click
8 β-elemene enhances both radiosensitivity and chemosensitivity of glioblastoma cells through the inhibition of the ATM signaling pathway. Oncol Rep. 2015 Aug;34(2):943-51. doi: 10.3892/or.2015.4050. Click
9 Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage. Thorac Cancer. 2023 Jul;14(21):2007-2017. doi: 10.1111/1759-7714.14982. Click
10 Gypenosides Synergistically Enhances the Anti-Tumor Effect of 5-Fluorouracil on Colorectal Cancer In Vitro and In Vivo: A Role for Oxidative Stress-Mediated DNA Damage and p53 Activation. PLoS One. 2015 Sep 14;10(9):e0137888. doi: 10.1371/journal.pone.0137888. Click
11 Synergistic effect of cryptotanshinone and temozolomide treatment against human glioblastoma cells. Sci Rep. 2023 Dec 9;13(1):21835. doi: 10.1038/s41598-023-48777-z. Click
12 Berberine induces oxidative DNA damage and impairs homologous recombination repair in ovarian cancer cells to confer increased sensitivity to PARP inhibition. Cell Death Dis. 2017;8(10):e3070. Published 2017 Oct 5. doi:10.1038/cddis.2017.471 Click
13 Synergistic anticancer activity of resveratrol in combination with docetaxel in prostate carcinoma cells. Nutr Res Pract. 2021 Feb;15(1):12-25. doi: 10.4162/nrp.2021.15.1.12. Click
14 Curcumin sensitizes carboplatin treatment in triple negative breast cancer through reactive oxygen species induced DNA repair pathway. Mol Biol Rep. 2022;49(4):3259-3270. doi:10.1007/s11033-022-07162-1. Click
15 Curcumin enhances poly(ADP-ribose) polymerase inhibitor sensitivity to chemotherapy in breast cancer cells. J Nutr Biochem. 2015 Dec;26(12):1442-7. doi: 10.1016/j.jnutbio.2015.07.015. Click
16 Protocatechuic aldehyde acts synergistically with dacarbazine to augment DNA double-strand breaks and promote apoptosis in cutaneous melanoma cells. BMC Complement Med Ther. 2023 Apr 27;23(1):133. doi: 10.1186/s12906-023-03965-2. Click
17 Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib. Click
18 Synergistic enhancement of topotecan-induced cell death by ascorbic acid in human breast MCF-7 tumor cells. Free Radic Biol Med. 2017 Dec;113:406-412. doi: 10.1016/j.freeradbiomed.2017.10.377 Click
19 Pharmacological Ascorbate Suppresses Growth of Gastric Cancer Cells with GLUT1 Overexpression and Enhances the Efficacy of Oxaliplatin Through Redox Modulation. Theranostics. 2018 Feb 2;8(5):1312-1326. doi: 10.7150/thno.21745. Click
20 Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway. Phytother Res. 2021 Oct;35(10):5899-5918. doi: 10.1002/ptr.7299 Click
21 Modulation of STAT3 Signaling, Cell Redox Defenses and Cell Cycle Checkpoints by β-Caryophyllene in Cholangiocarcinoma Cells: Possible Mechanisms Accounting for Doxorubicin Chemosensitization and Chemoprevention. Cells. 2020 Apr 2;9(4):858. doi: 10.3390/cells9040858. Click
22 Piperlongumine potentiates the antitumor efficacy of oxaliplatin through ROS induction in gastric cancer cells. Cell Oncol (Dordr). 2019;42(6):847-860. doi:10.1007/s13402-019-00471-x Click
23 Artesunate improves venetoclax plus cytarabine AML cell targeting by regulating the Noxa/Bim/Mcl-1/p-Chk1 axis. Cell Death Dis. 2022 Apr 20;13(4):379. doi: 10.1038/s41419-022-04810-z. Click
24 Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004 Click
25 Ascorbate sensitizes human osteosarcoma cells to the cytostatic effects of cisplatin. Pharmacol Res Perspect. 2020 Aug;8(4):e00632. doi: 10.1002/prp2.632. Click
It has been 350863 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP