TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Catenin beta-1
UniProt ID Catenin beta-1
Gene Name CTNNB1
Gene ID 1499
Synonyms
CTNNB1, CTNNB, EVR7, MRD19, NEDSDV, armadillo
Sequence
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
Pathway Map MAP LINK
T.C. Number 8.A.160.2.1; 8.A.40.1.20
KEGG ID hsa1499
TTD ID T82795
Pfam PF00514; PF01602; PF02547; PF04826; PF05804; PF09759; PF12717; PF13513; PF13646; PF21050
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 75
Pair Name Baicalein, Docetaxel
Phytochemical Name Baicalein
Anticancer drug Name Docetaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Baicalein enhances the antitumor efficacy of docetaxel on nonsmall cell lung cancer in a β-catenin-dependent manner
Combination Pair ID: 1029
Pair Name Carnosic acid, Anti-PD-1 antibody
Phytochemical Name Carnosic acid
Anticancer drug Name Anti-PD-1 antibody
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result CA-NBF combined with anti-PD-1 have stronger immunomodulatory and anticancer effects without increasing biological toxicity.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 4
Pair Name Camptothecin, Doxorubicin
Phytochemical Camptothecin
Drug Doxorubicin
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Catenin beta-1 Expression
Result Camptothecin-doxorubicin combinations showed synergistic antitumor acitivity.
Combination Pair ID: 8
Pair Name Harmine, Paclitaxel
Phytochemical Harmine
Drug Paclitaxel
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer
Combination Pair ID: 9
Pair Name Piperlongumine, Doxorubicin
Phytochemical Piperlongumine
Drug Doxorubicin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells
Combination Pair ID: 10
Pair Name Piperlongumine, Paclitaxel
Phytochemical Piperlongumine
Drug Paclitaxel
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells
Combination Pair ID: 620
Pair Name Tetrandrine, Cisplatin
Phytochemical Tetrandrine
Drug Cisplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo
Combination Pair ID: 78
Pair Name Puerarin, Cisplatin
Phytochemical Puerarin
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Taking these results together, we can draw the conclusion that the PUE enhances the anti-tumor effect of DDP on the drug-resistant A549 cancer in vivo and in vitro through activation of the Wnt signaling pathway.
Combination Pair ID: 1002
Pair Name Dihydroartemisinin, Capecitabine
Phytochemical Dihydroartemisinin
Drug Capecitabine
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result DHA in combination with Cap could be a novel therapeutic strategy for CRC with improved efficacy and reduced side effects.
Combination Pair ID: 1024
Pair Name Toosendanin, Paclitaxel
Phytochemical Toosendanin
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result The results suggest that combination of TSN and PTX is superior to PTX alone, suggesting that it may be a promising alternative adjuvant chemotherapy strategy for patients with TNBC, especially those with metastatic TNBC.
Combination Pair ID: 277
Pair Name Furanodiene, Doxorubicin
Phytochemical Furanodiene
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result These observations indicate that furanodiene is a potential agent that may be utilized to improve the anticancer efficacy of doxorubicin and overcome the risk of chemotherapy in highly metastatic breast cancer.
Combination Pair ID: 294
Pair Name Tanshinone IIA, Doxorubicin
Phytochemical Tanshinone IIA
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Tan II A could be used as a potential chemosensitizer in combination with Dox for breast cancer chemotherapy.
Combination Pair ID: 750
Pair Name Thymoquinone, Fluorouracil
Phytochemical Thymoquinone
Drug Fluorouracil
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Our findings present the first report describing the in vivo enhancement effect of combined TQ and 5-FU against early stages of CRC; however, further studies are required to determine the value of this combination therapy in an advanced long-term model of CRC and also to realize its clinical potential.
Combination Pair ID: 355
Pair Name Withaferin A, Fluorouracil
Phytochemical Withaferin A
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Synergistic antitumor effect of 5-fluorouracil and withaferin-A induces endoplasmic reticulum stress-mediated autophagy and apoptosis in colorectal cancer cells
Combination Pair ID: 397
Pair Name Curcumin, Pyridoxine
Phytochemical Curcumin
Drug Pyridoxine
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Phosphorylation
Result C + B is superior to either agent alone in preventing obesity-promoted colorectal carcinogenesis. Augmented suppression of procancerous signaling pathways may be the means by which this augmentation occurs.
Combination Pair ID: 518
Pair Name All-trans retinoic acid, Salinomycin
Phytochemical All-trans-retinoic acid
Drug Salinomycin
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result S+RA induced differentiation by β-catenin-inhibition-mediated up-regulation of C/EBPs and PU.1 and suppression of c-Myc. S+RA triggered apoptosis through β-catenin-inhibition-regulated ΔΨm collapse and caspase-3/7 activation. Taken together, our findings may provide novel therapeutic strategies for AML patients by targeting the WNT/β-catenin pathway.
Combination Pair ID: 541
Pair Name Sulforaphane, Cisplatin
Phytochemical Sulforaphane
Drug Cisplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result The results of the current study suggests that CIS when supplemented with SFN, inhibits metastasis and stemness potential of TNBC cells by down regulating SIRTs-mediated EMT cascade. Overall this study affirms that, this novel combination could be a promising strategy against SIRT-mediated TNBC metastasis and CIS-resistance.
Combination Pair ID: 543
Pair Name Sulforaphane, Metformin
Phytochemical Sulforaphane
Drug Metformin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Our data indicate that SLFN and MTFN can reduce cancer cell viability via both collaborative and differential effects and suggest that MTFN increases SLFN effectiveness by targeting common molecules/pathways downstream of HER2 and key for CSC signaling.
Combination Pair ID: 927
Pair Name Gamma-Tocotrienol, SU11274
Phytochemical Gamma-Tocotrienol
Drug SU11274
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Catenin beta-1 Expression
Result Suggest that combined γ-tocotrienol and Met inhibitor treatment may provide benefit in treatment of breast cancers characterized by aberrant Met activity.
Combination Pair ID: 937
Pair Name Cordycepin, Temozolomide
Phytochemical Cordycepin
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Cordycepin combined with temozolomide may down-regulate MYC through "MicroRNA in cancer, Proteoglycans in cancer, Pathways in cancer and PI3K-AKT signaling pathway", which in turn regulate the expression of MCL1, CTNNB1, MMP9, PDCD4, thus regulating cell proliferation, migration and apoptosis in glioblastoma.
Combination Pair ID: 960
Pair Name Periplocin, TNF-related apoptosis inducing ligand
Phytochemical Periplocin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B70.1] Esophageal squamous cell carcinoma Investigative
Regulate Info Down-regulation Catenin beta-1 Activity
Result Our data suggest that CPP and TRAIL could be further explored as potential therapeutic approach for esophageal cancer.
Combination Pair ID: 960
Pair Name Periplocin, TNF-related apoptosis inducing ligand
Phytochemical Periplocin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B70.1] Esophageal squamous cell carcinoma Investigative
Regulate Info Down-regulation Catenin beta-1 Phosphorylation
Result Our data suggest that CPP and TRAIL could be further explored as potential therapeutic approach for esophageal cancer.
Combination Pair ID: 961
Pair Name Platycodin D, Cetuximab
Phytochemical Platycodin D
Drug Cetuximab
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Our findings provide a potential strategy to inhibit CRC metastasis during cetuximab therapy by addition of platycodin D.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 565
Pair Name Epibrassinolide, Etoposide
Phytochemical Epibrassinolide
Drug Etoposide
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Catenin beta-1 Expression
Result Castasterone, a Plant Steroid Hormone, Affects Human Small-Cell Lung Cancer Cells and Reverses Multi-Drug Resistance
03. Reference
No. Title Href
1 Baicalein enhances the antitumor efficacy of docetaxel on nonsmall cell lung cancer in a β-catenin-dependent manner. Phytother Res. 2020 Jan;34(1):104-117. doi: 10.1002/ptr.6501. Click
2 Carnosic acid nanocluster-based framework combined with PD-1 inhibitors impeded tumorigenesis and enhanced immunotherapy in hepatocellular carcinoma. Funct Integr Genomics. 2024 Jan 6;24(1):5. doi: 10.1007/s10142-024-01286-2. Click
3 Synergistic antitumor activity of camptothecin-doxorubicin combinations and their conjugates with hyaluronic acid. J Control Release. 2015 Jul 28;210:198-207. doi: 10.1016/j.jconrel.2015.04.031. Click
4 Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer. Oncol Lett. 2016 Aug;12(2):983-988. doi: 10.3892/ol.2016.4696. Click
5 Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells. Chem Biol Interact. 2022 Feb 25;354:109832. doi: 10.1016/j.cbi.2022.109832. Click
6 Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells. Biomed Pharmacother. 2020 Aug;128:110243. doi: 10.1016/j.biopha.2020.110243. Click
7 Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo. Cancer Lett. 2011 May 1;304(1):21-32. doi: 10.1016/j.canlet.2011.01.022. Click
8 Puerarin Enhances the Anti-Tumor Effect of Cisplatin on Drug-Resistant A549 Cancer in vivo and in vitro Through Activation of the Wnt Signaling Pathway. Cancer Manag Res. 2020 Jul 24;12:6279-6289. doi: 10.2147/CMAR.S253327. Click
9 Dihydroartemisinin inhibits the development of colorectal cancer by GSK-3β/TCF7/MMP9 pathway and synergies with capecitabine. Cancer Lett. 2024 Feb 1;582:216596. doi: 10.1016/j.canlet.2023.216596. Click
10 Synergistic Anti-Tumor Effect of Toosendanin and Paclitaxel on Triple-Negative Breast Cancer via Regulating ADORA2A-EMT Related Signaling. Adv Biol (Weinh). 2023 Aug;7(8):e2300062. doi: 10.1002/adbi.202300062. Click
11 Combined effects of furanodiene and doxorubicin on the migration and invasion of MDA-MB-231 breast cancer cells in vitro. Oncol Rep. 2017 Apr;37(4):2016-2024. doi: 10.3892/or.2017.5435. Click
12 Tanshinone II A improves the chemosensitivity of breast cancer cells to doxorubicin by inhibiting β-catenin nuclear translocation. J Biochem Mol Toxicol. 2021 Jan;35(1):e22620. doi: 10.1002/jbt.22620. Epub 2020 Sep 4. Erratum in: J Biochem Mol Toxicol. 2021 Apr;35(4):e22790. Click
13 Thymoquinone subdues tumor growth and potentiates the chemopreventive effect of 5-fluorouracil on the early stages of colorectal carcinogenesis in rats. Drug Des Devel Ther. 2016 Jul 11;10:2239-53. doi: 10.2147/DDDT.S109721. Click
14 Synergistic antitumor effect of 5-fluorouracil and withaferin-A induces endoplasmic reticulum stress-mediated autophagy and apoptosis in colorectal cancer cells. Am J Cancer Res. 2020 Mar 1;10(3):799-815. Click
15 Combined Supplementation with Vitamin B-6 and Curcumin is Superior to Either Agent Alone in Suppressing Obesity-Promoted Colorectal Tumorigenesis in Mice. J Nutr. 2021 Dec 3;151(12):3678-3688. doi: 10.1093/jn/nxab320. Click
16 Combined Application of Salinomycin and ATRA Induces Apoptosis and Differentiation of Acute Myeloid Leukemia Cells by Inhibiting WNT/β-Catenin Pathway. Anticancer Agents Med Chem. 2023;23(9):1074-1084. doi: 10.2174/1871520623666230110121629. Click
17 Sulforaphane-cisplatin combination inhibits the stemness and metastatic potential of TNBCs via down regulation of sirtuins-mediated EMT signaling axis. Phytomedicine. 2021 Apr;84:153492. doi: 10.1016/j.phymed.2021.153492. Click
18 Co-Treatment with Sulforaphane and Nano-Metformin Molecules Accelerates Apoptosis in HER2+ Breast Cancer Cells by Inhibiting Key Molecules. Nutr Cancer. 2020;72(5):835-848. doi: 10.1080/01635581.2019.1655073. Click
19 Combined γ-tocotrienol and Met inhibitor treatment suppresses mammary cancer cell proliferation, epithelial-to-mesenchymal transition and migration. Cell Prolif. 2013 Oct;46(5):538-53. doi: 10.1111/cpr.12059. Click
20 Cordycepin improves sensitivity to temozolomide in glioblastoma cells by down-regulating MYC. J Cancer Res Clin Oncol. 2023 Nov;149(17):16055-16067. doi: 10.1007/s00432-023-05347-0. Click
21 Combination of the natural compound Periplocin and TRAIL induce esophageal squamous cell carcinoma apoptosis in vitro and in vivo: Implication in anticancer therapy. J Exp Clin Cancer Res. 2019 Dec 21;38(1):501. doi: 10.1186/s13046-019-1498-z. Click
22 Combination of the natural compound Periplocin and TRAIL induce esophageal squamous cell carcinoma apoptosis in vitro and in vivo: Implication in anticancer therapy. J Exp Clin Cancer Res. 2019 Dec 21;38(1):501. doi: 10.1186/s13046-019-1498-z. Click
23 Platycodin D represses β-catenin to suppress metastasis of cetuximab-treated KRAS wild-type colorectal cancer cells. Clin Exp Metastasis. 2023 Aug;40(4):339-356. doi: 10.1007/s10585-023-10218-6. Click
24 Castasterone, a Plant Steroid Hormone, Affects Human Small-Cell Lung Cancer Cells and Reverses Multi-Drug Resistance. Pharmaceuticals (Basel). 2023 Jan 23;16(2):170. doi: 10.3390/ph16020170. Click
It has been 559673 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP