InterPAD - DETAILS

MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ

No.	Title	Href
1	Ilexgenin A exerts anti-inflammation and anti-angiogenesis effects through inhibition of STAT3 and PI3K pathways and exhibits synergistic effects with Sorafenib on hepatoma growth. Toxicol Appl Pharmacol. 2017 Jan 15;315:90-101. doi: 10.1016/j.taap.2016.12.008.	`Click`
2	P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin. Biomed Res Int. 2019 Nov 6;2019:6407210. doi: 10.1155/2019/6407210.	`Click`
3	Anticancer Efficacy of 6-Gingerol with Paclitaxel against Wild Type of Human Breast Adenocarcinoma. Molecules. 2022 Apr 22;27(9):2693. doi: 10.3390/molecules27092693.	`Click`
4	Combination of midostaurin and ATRA exerts dose-dependent dual effects on acute myeloid leukemia cells with wild type FLT3. BMC Cancer. 2022 Jul 9;22(1):749. doi: 10.1186/s12885-022-09828-2.	`Click`
5	Combined Application of Salinomycin and ATRA Induces Apoptosis and Differentiation of Acute Myeloid Leukemia Cells by Inhibiting WNT/β-Catenin Pathway. Anticancer Agents Med Chem. 2023;23(9):1074-1084. doi: 10.2174/1871520623666230110121629.	`Click`
6	Synergism between α-mangostin and TRAIL induces apoptosis in squamous cell carcinoma of the oral cavity through the mitochondrial pathway. Oncol Rep. 2017 Dec;38(6):3439-3446. doi: 10.3892/or.2017.6030.	`Click`
7	Apigenin Sensitizes Huh-7 Human Hepatocellular Carcinoma Cells to TRAIL-induced Apoptosis. Biomol Ther (Seoul). 2012 Jan;20(1):62-7. doi: 10.4062/biomolther.2012.20.1.062.	`Click`
8	Arachidin-1, a Prenylated Stilbenoid from Peanut, Enhances the Anticancer Effects of Paclitaxel in Triple-Negative Breast Cancer Cells. Cancers (Basel). 2023;15(2):399. Published 2023 Jan 7. doi:10.3390/cancers15020399	`Click`
9	Artesunate exhibits synergistic anti-cancer effects with cisplatin on lung cancer A549 cells by inhibiting MAPK pathway. Gene. 2021 Jan 15;766:145134. doi: 10.1016/j.gene.2020.145134.	`Click`
10	beta-Elemene, a novel plant-derived antineoplastic agent, increases cisplatin chemosensitivity of lung tumor cells by triggering apoptosis. Oncol Rep. 2009 Jul;22(1):161-70. doi: 10.3892/or_00000420.	`Click`
11	β-Elemene promotes cisplatin-induced cell death in human bladder cancer and other carcinomas. Anticancer Res. 2013 Apr;33(4):1421-8.	`Click`
12	Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.	`Click`
13	Chlorogenic Acid Improves the Regorafenib Effects in Human Hepatocellular Carcinoma Cells. Int J Mol Sci. 2018 May 19;19(5):1518. doi: 10.3390/ijms19051518.	`Click`
14	Synergistic anti-proliferative and apoptotic effect of NVP-BEZ235 and curcumin on human SH-SY5Y neuroblastoma cells. Med Oncol. 2023 Dec 10;41(1):11. doi: 10.1007/s12032-023-02239-8.	`Click`
15	Curcumin and melphalan cotreatment induces cell cycle arrest and apoptosis in MDA-MB-231 breast cancer cells. Sci Rep. 2023 Aug 18;13(1):13446. doi: 10.1038/s41598-023-40535-5.	`Click`
16	Combinatorial Cytotoxic Effects of Damnacanthal and Doxorubicin against Human Breast Cancer MCF-7 Cells in Vitro. Molecules. 2016 Sep 14;21(9):1228. doi: 10.3390/molecules21091228.	`Click`
17	Synergistic anti-cancer activity of the combination of dihydroartemisinin and doxorubicin in breast cancer cells. Pharmacol Rep. 2013;65(2):453-9. doi: 10.1016/s1734-1140(13)71021-1.	`Click`
18	Emodin Sensitizes Cervical Cancer Cells to Vinblastine by Inducing Apoptosis and Mitotic Death. Int J Mol Sci. 2022 Jul 31;23(15):8510. doi: 10.3390/ijms23158510.	`Click`
19	SAHA and EGCG Promote Apoptosis in Triple-negative Breast Cancer Cells, Possibly Through the Modulation of cIAP2. Anticancer Res. 2020 Jan;40(1):9-26. doi: 10.21873/anticanres.13922.	`Click`
20	Evodiamine synergizes with doxorubicin in the treatment of chemoresistant human breast cancer without inhibiting P-glycoprotein. PLoS One. 2014 May 15;9(5):e97512. doi: 10.1371/journal.pone.0097512.	`Click`
21	Furanodiene enhances the anti-cancer effects of doxorubicin on ERα-negative breast cancer cells in vitro. Eur J Pharmacol. 2016 Mar 5;774:10-9. doi: 10.1016/j.ejphar.2015.11.039.	`Click`
22	Gambogic acid sensitizes breast cancer cells to TRAIL-induced apoptosis by promoting the crosstalk of extrinsic and intrinsic apoptotic signalings. Food Chem Toxicol. 2018 Sep;119:334-341. doi: 10.1016/j.fct.2018.02.037.	`Click`
23	ACC010, a novel BRD4 inhibitor, synergized with homoharringtonine in acute myeloid leukemia with FLT3-ITD. Mol Oncol. 2023 Jul;17(7):1402-1418. doi: 10.1002/1878-0261.13368.	`Click`
24	Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429.	`Click`
25	Identification of a novel oxidative stress induced cell death by Sorafenib and oleanolic acid in human hepatocellular carcinoma cells. Biochem Pharmacol. 2016 Oct 15;118:9-17. doi: 10.1016/j.bcp.2016.08.011.	`Click`
26	Potentiation of Cisplatin Cytotoxicity in Resistant Ovarian Cancer SKOV3/Cisplatin Cells by Quercetin Pre-Treatment. Int J Mol Sci. 2023;24(13):10960. Published 2023 Jun 30. doi:10.3390/ijms241310960	`Click`
27	Resveratrol enhances the antitumor effects of temozolomide in glioblastoma via ROS-dependent AMPK-TSC-mTOR signaling pathway. CNS Neurosci Ther. 2012;18(7):536-546. doi:10.1111/j.1755-5949.2012.00319.x	`Click`
28	High Levels of Apoptosis Are Induced in the Human Colon Cancer HT-29 Cell Line by Co-Administration of Sulforaphane and a Peptide Nucleic Acid Targeting miR-15b-5p. Nucleic Acid Ther. 2020 Jun;30(3):164-174. doi: 10.1089/nat.2019.0825.	`Click`
29	Tangeretin boosts the anticancer activity of metformin in breast cancer cells via curbing the energy production. Phytomedicine. 2021 Mar;83:153470. doi: 10.1016/j.phymed.2021.153470.	`Click`
30	Synergistic effect of black tea polyphenol, theaflavin-3,3'-digallate with cisplatin against cisplatin resistant human ovarian cancer cells. J Funct Foods. 2018 Jul;46:1-11. doi: 10.1016/j.jff.2018.04.037.	`Click`
31	Enhanced cytotoxicity and apoptosis by thymoquinone in combination with zoledronic acid in hormone- and drug-resistant prostate cancer cell lines. J BUON. 2014 Oct-Dec;19(4):1055-61.	`Click`
32	Pharmacological Ascorbate Suppresses Growth of Gastric Cancer Cells with GLUT1 Overexpression and Enhances the Efficacy of Oxaliplatin Through Redox Modulation. Theranostics. 2018 Feb 2;8(5):1312-1326. doi: 10.7150/thno.21745.	`Click`
33	Zerumbone-induced reactive oxygen species-mediated oxidative stress re-sensitizes breast cancer cells to paclitaxel. Biotechnol Appl Biochem. 2023 Feb;70(1):28-37. doi: 10.1002/bab.2326.	`Click`

No.

Title

Href

Ilexgenin A exerts anti-inflammation and anti-angiogenesis effects through inhibition of STAT3 and PI3K pathways and exhibits synergistic effects with Sorafenib on hepatoma growth. Toxicol Appl Pharmacol. 2017 Jan 15;315:90-101. doi: 10.1016/j.taap.2016.12.008.

Click

P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin. Biomed Res Int. 2019 Nov 6;2019:6407210. doi: 10.1155/2019/6407210.

Click

Anticancer Efficacy of 6-Gingerol with Paclitaxel against Wild Type of Human Breast Adenocarcinoma. Molecules. 2022 Apr 22;27(9):2693. doi: 10.3390/molecules27092693.

Click

Combination of midostaurin and ATRA exerts dose-dependent dual effects on acute myeloid leukemia cells with wild type FLT3. BMC Cancer. 2022 Jul 9;22(1):749. doi: 10.1186/s12885-022-09828-2.

Click

Combined Application of Salinomycin and ATRA Induces Apoptosis and Differentiation of Acute Myeloid Leukemia Cells by Inhibiting WNT/β-Catenin Pathway. Anticancer Agents Med Chem. 2023;23(9):1074-1084. doi: 10.2174/1871520623666230110121629.

Click

Synergism between α-mangostin and TRAIL induces apoptosis in squamous cell carcinoma of the oral cavity through the mitochondrial pathway. Oncol Rep. 2017 Dec;38(6):3439-3446. doi: 10.3892/or.2017.6030.

Click

Apigenin Sensitizes Huh-7 Human Hepatocellular Carcinoma Cells to TRAIL-induced Apoptosis. Biomol Ther (Seoul). 2012 Jan;20(1):62-7. doi: 10.4062/biomolther.2012.20.1.062.

Click

Arachidin-1, a Prenylated Stilbenoid from Peanut, Enhances the Anticancer Effects of Paclitaxel in Triple-Negative Breast Cancer Cells. Cancers (Basel). 2023;15(2):399. Published 2023 Jan 7. doi:10.3390/cancers15020399

Click

Artesunate exhibits synergistic anti-cancer effects with cisplatin on lung cancer A549 cells by inhibiting MAPK pathway. Gene. 2021 Jan 15;766:145134. doi: 10.1016/j.gene.2020.145134.

Click

beta-Elemene, a novel plant-derived antineoplastic agent, increases cisplatin chemosensitivity of lung tumor cells by triggering apoptosis. Oncol Rep. 2009 Jul;22(1):161-70. doi: 10.3892/or_00000420.

Click

β-Elemene promotes cisplatin-induced cell death in human bladder cancer and other carcinomas. Anticancer Res. 2013 Apr;33(4):1421-8.

Click

Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.

Click

Chlorogenic Acid Improves the Regorafenib Effects in Human Hepatocellular Carcinoma Cells. Int J Mol Sci. 2018 May 19;19(5):1518. doi: 10.3390/ijms19051518.

Click

Synergistic anti-proliferative and apoptotic effect of NVP-BEZ235 and curcumin on human SH-SY5Y neuroblastoma cells. Med Oncol. 2023 Dec 10;41(1):11. doi: 10.1007/s12032-023-02239-8.

Click

Curcumin and melphalan cotreatment induces cell cycle arrest and apoptosis in MDA-MB-231 breast cancer cells. Sci Rep. 2023 Aug 18;13(1):13446. doi: 10.1038/s41598-023-40535-5.

Click

Combinatorial Cytotoxic Effects of Damnacanthal and Doxorubicin against Human Breast Cancer MCF-7 Cells in Vitro. Molecules. 2016 Sep 14;21(9):1228. doi: 10.3390/molecules21091228.

Click

Synergistic anti-cancer activity of the combination of dihydroartemisinin and doxorubicin in breast cancer cells. Pharmacol Rep. 2013;65(2):453-9. doi: 10.1016/s1734-1140(13)71021-1.

Click

Emodin Sensitizes Cervical Cancer Cells to Vinblastine by Inducing Apoptosis and Mitotic Death. Int J Mol Sci. 2022 Jul 31;23(15):8510. doi: 10.3390/ijms23158510.

Click

SAHA and EGCG Promote Apoptosis in Triple-negative Breast Cancer Cells, Possibly Through the Modulation of cIAP2. Anticancer Res. 2020 Jan;40(1):9-26. doi: 10.21873/anticanres.13922.

Click

Evodiamine synergizes with doxorubicin in the treatment of chemoresistant human breast cancer without inhibiting P-glycoprotein. PLoS One. 2014 May 15;9(5):e97512. doi: 10.1371/journal.pone.0097512.

Click

Furanodiene enhances the anti-cancer effects of doxorubicin on ERα-negative breast cancer cells in vitro. Eur J Pharmacol. 2016 Mar 5;774:10-9. doi: 10.1016/j.ejphar.2015.11.039.

Click

Gambogic acid sensitizes breast cancer cells to TRAIL-induced apoptosis by promoting the crosstalk of extrinsic and intrinsic apoptotic signalings. Food Chem Toxicol. 2018 Sep;119:334-341. doi: 10.1016/j.fct.2018.02.037.

Click

ACC010, a novel BRD4 inhibitor, synergized with homoharringtonine in acute myeloid leukemia with FLT3-ITD. Mol Oncol. 2023 Jul;17(7):1402-1418. doi: 10.1002/1878-0261.13368.

Click

Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429.

Click

Identification of a novel oxidative stress induced cell death by Sorafenib and oleanolic acid in human hepatocellular carcinoma cells. Biochem Pharmacol. 2016 Oct 15;118:9-17. doi: 10.1016/j.bcp.2016.08.011.

Click

Potentiation of Cisplatin Cytotoxicity in Resistant Ovarian Cancer SKOV3/Cisplatin Cells by Quercetin Pre-Treatment. Int J Mol Sci. 2023;24(13):10960. Published 2023 Jun 30. doi:10.3390/ijms241310960

Click

Resveratrol enhances the antitumor effects of temozolomide in glioblastoma via ROS-dependent AMPK-TSC-mTOR signaling pathway. CNS Neurosci Ther. 2012;18(7):536-546. doi:10.1111/j.1755-5949.2012.00319.x

Click

High Levels of Apoptosis Are Induced in the Human Colon Cancer HT-29 Cell Line by Co-Administration of Sulforaphane and a Peptide Nucleic Acid Targeting miR-15b-5p. Nucleic Acid Ther. 2020 Jun;30(3):164-174. doi: 10.1089/nat.2019.0825.

Click

Tangeretin boosts the anticancer activity of metformin in breast cancer cells via curbing the energy production. Phytomedicine. 2021 Mar;83:153470. doi: 10.1016/j.phymed.2021.153470.

Click

Synergistic effect of black tea polyphenol, theaflavin-3,3'-digallate with cisplatin against cisplatin resistant human ovarian cancer cells. J Funct Foods. 2018 Jul;46:1-11. doi: 10.1016/j.jff.2018.04.037.

Click

Enhanced cytotoxicity and apoptosis by thymoquinone in combination with zoledronic acid in hormone- and drug-resistant prostate cancer cell lines. J BUON. 2014 Oct-Dec;19(4):1055-61.

Click

Pharmacological Ascorbate Suppresses Growth of Gastric Cancer Cells with GLUT1 Overexpression and Enhances the Efficacy of Oxaliplatin Through Redox Modulation. Theranostics. 2018 Feb 2;8(5):1312-1326. doi: 10.7150/thno.21745.

Click

Zerumbone-induced reactive oxygen species-mediated oxidative stress re-sensitizes breast cancer cells to paclitaxel. Biotechnol Appl Biochem. 2023 Feb;70(1):28-37. doi: 10.1002/bab.2326.

Click

Name	Caspase-7
UniProt ID	CASP7_HUMAN
Gene Name	CASP7
Gene ID	840
Synonyms	CASP7, CASP-7, CMH-1, ICE-LAP3, LICE2, MCH3
Sequence	MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY FSQ
Pathway Map	`MAP LINK`
T.C. Number	8.A.217.1.1
KEGG ID	hsa840
TTD ID	T72252
Pfam	PF00656; PF18601

Pair Name	Ilexgenin A, Sorafenib
Phytochemical Name	Ilexgenin A
Anticancer drug Name	Sorafenib
Disease Info	[ICD-11: 2C12]	Hepatocellular carcinoma	Investigative
Regulate Info	Up-regulation	Caspase-7	Expression
Result	The results described in the present study identifies Ilexgenin A as a promising therapeutic candidate that modulates inflammation, angiogenesis, and HCC growth.

Pair Name	Rutin, Oxaliplatin
Phytochemical Name	Rutin
Anticancer drug Name	Oxaliplatin
Disease Info	[ICD-11: 2B72]	Gastric cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin

Pair Name	[6]-Gingerol, Paclitaxel
Phytochemical	[6]-Gingerol
Drug	Paclitaxel
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Activity
Result	Anticancer Efficacy of 6-Gingerol with Paclitaxel against Wild Type of Human Breast Adenocarcinoma

Pair Name	All-trans retinoic acid, Midostaurin
Phytochemical	All-trans-retinoic acid
Drug	Midostaurin
Disease Info	[ICD-11: 2A60.Z]	Acute myeloid leukemia	Investigative
Regulate Info	Down-regulation	Caspase-7	Expression
Result	Combination of midostaurin and ATRA exerts dose-dependent dual effects on acute myeloid leukemia cells with wild type FLT3

Pair Name	All-trans retinoic acid, Salinomycin
Phytochemical	All-trans-retinoic acid
Drug	Salinomycin
Disease Info	[ICD-11: 2A60.Z]	Acute myeloid leukemia	Investigative
Regulate Info	Down-regulation	Caspase-7	Expression
Result	S+RA induced differentiation by β-catenin-inhibition-mediated up-regulation of C/EBPs and PU.1 and suppression of c-Myc. S+RA triggered apoptosis through β-catenin-inhibition-regulated ΔΨm collapse and caspase-3/7 activation. Taken together, our findings may provide novel therapeutic strategies for AML patients by targeting the WNT/β-catenin pathway.

Pair Name	alpha-Mangostin, TNF-related apoptosis inducing ligand
Phytochemical	alpha-Mangostin
Drug	TNF-related apoptosis inducing ligand
Disease Info	[ICD-11: 2B66.0]	Oral squamous cell carcinoma	Investigative
Regulate Info	Up-regulation	Caspase-7	Activity
Result	Synergism between α-mangostin and TRAIL induces apoptosis in squamous cell carcinoma of the oral cavity through the mitochondrial pathway

Pair Name	Apigenin, TNF-related apoptosis inducing ligand
Phytochemical	Apigenin
Drug	TNF-related apoptosis inducing ligand
Disease Info	[ICD-11: 2C12]	Hepatocellular carcinoma	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	Apigenin sensitizes cells to TRAIL-induced apoptosis by activating both intrinsic and extrinsic apoptotic pathway-related caspases. The augmented apoptotic effect by TRAIL/apigenin combination was accompanied by triggering mitochondria-dependent signaling pathway, as indicated by Bax/Bcl-2 ratio up-regulation

Pair Name	Arachidin-1, Paclitaxel
Phytochemical	Arachidin-1
Drug	Paclitaxel
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	A-1 in combination with Pac inhibited cell proliferation, induced apoptosis through mitochondrial oxidative stress, and reduced TNBC spheroid growth. These findings underscore the impactful effects of the prenylated stilbenoid A-1 as a novel adjuvant for Pac chemotherapy in TNBC treatment.

Pair Name	Artesunate, Cisplatin
Phytochemical	Artesunate
Drug	Cisplatin
Disease Info	[ICD-11: 2C25]	Lung cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Expression
Result	ART exhibited significant anti-tumor effect on A549 cells and this efficiency could be enhanced by combination with CIS

Pair Name	Beta-Elemene, Cisplatin
Phytochemical	Beta-Elemene
Drug	Cisplatin
Disease Info	[ICD-11: 2C25]	Lung cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	Our data provide a rationale for developing a combination of beta-elemene and cisplatin as a regimen for the treatment of lung carcinoma and other cisplatin-resistant tumors.

Pair Name	Bisdemethoxycucurmin, Icotinib
Phytochemical	Bisdemethoxycucurmin
Drug	Icotinib
Disease Info	[ICD-11: 2C25]	Lung cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.

Pair Name	Chlorogenic acid, Regorafenib
Phytochemical	Chlorogenic acid
Drug	Regorafenib
Disease Info	[ICD-11: 2C12]	Hepatocellular carcinoma	Investigative
Regulate Info	Up-regulation	Caspase-7	Expression
Result	This drug combination could be considered as a safe and more effective approach in HCC therapy.

Pair Name	Curcumin, Dactolisib
Phytochemical	Curcumin
Drug	Dactolisib
Disease Info	[ICD-11: 2D11]	Neuroblastoma	Investigative
Regulate Info	Up-regulation	Caspase-7	Expression
Result	Synergistic anti-proliferative and apoptotic effect of NVP-BEZ235 and curcumin on human SH-SY5Y neuroblastoma cells.

Pair Name	Curcumin, Melphalan
Phytochemical	Curcumin
Drug	Melphalan
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Expression
Result	Curcumin and melphalan cotreatment induces cell cycle arrest and apoptosis in MDA-MB-231 breast cancer cells

Pair Name	Epigallocatechin gallate, Vorinostat
Phytochemical	Epigallocatechin gallate
Drug	Vorinostat
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Expression
Result	The compounds were able to decrease the expression of cIAP2 while increasing the expression of pro-apoptotic caspase 7. There were also changes in histone modifications, suggesting a role of epigenetic mechanisms in these changes in expression of cIAP2. These changes resulted in an increase in apoptosis. SAHA and EGCG were also capable of limiting TNBC cell migration across a fibronectin (FN) matrix.

Pair Name	Resveratrol, Temozolomide
Phytochemical	Resveratrol
Drug	Temozolomide
Disease Info	[ICD-11: 2F7Z]	Glioma	Investigative
Regulate Info	Up-regulation	Caspase-7	Expression
Result	TMZ in combination with resveratrol remarkably increased reactive oxygen species (ROS) production, which serves as an upstream signal for AMP-activated protein kinase (AMPK) activation. Subsequently, activated AMPK inhibited mTOR signaling and downregulated antiapoptosis protein Bcl-2, which was contributed to the additive antiproliferation effects of combination treatment. In an orthotopic xenograft model of GBM, TMZ plus resveratrol treatment significantly reduced the volume of tumor, which was confirmed by decreased expression of Ki-67, a marker of proliferation index

Pair Name	Thymoquinone, Zoledronic acid
Phytochemical	Thymoquinone
Drug	Zoledronic acid
Disease Info	[ICD-11: 2C82]	Prostate cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Expression
Result	TQ and ZA had minimal hematological and non-hematological toxicity profile compared to cytotoxic agents. So, this combination may be an alternative approach for patients who are unable to be treated by conventional treatments because of poor performance status.

Pair Name	Damnacanthal, Doxorubicin
Phytochemical	Damnacanthal
Drug	Doxorubicin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Expression
Result	Combinatorial Cytotoxic Effects of Damnacanthal and Doxorubicin against Human Breast Cancer MCF-7 Cells in Vitro

Pair Name	Dihydroartemisinin, Doxorubicin
Phytochemical	Dihydroartemisinin
Drug	Doxorubicin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	This study presented a new opportunity to enhance the effectiveness of future treatment regimens of breast cancer using DOX.

Pair Name	Emodin, Vinblastine
Phytochemical	Emodin
Drug	Vinblastine
Disease Info	[ICD-11: 2C77]	Cervical cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Activity
Result	Emodin Sensitizes Cervical Cancer Cells to Vinblastine by Inducing Apoptosis and Mitotic Death

Pair Name	Evodiamine, Doxorubicin
Phytochemical	Evodiamine
Drug	Doxorubicin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Activity
Result	Our results indicated that EVO enhanced the apoptotic action of DOX by inhibiting the Ras/MEK/ERK cascade and the expression of IAPs without inhibiting the expression and activity of P-glycoprotein (P-gp). Taken together, our data indicate that EVO, a natural product, may be useful applied alone or in combination with DOX for the treatment of resistant breast cancer.

Pair Name	Furanodiene, Doxorubicin
Phytochemical	Furanodiene
Drug	Doxorubicin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Activity
Result	These results indicate that furanodiene may be a promising and safety natural agent for cancer adjuvant therapy in the future.

Pair Name	Gambogic Acid, TNF-related apoptosis inducing ligand
Phytochemical	Gambogic Acid
Drug	TNF-related apoptosis inducing ligand
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	These findings may open a new window in the treatment of breast cancer using TRAIL in combination with GA.

Pair Name	Homoharringtonine, ACC010
Phytochemical	Homoharringtonine
Drug	ACC010
Disease Info	[ICD-11: 2A60.Z]	Acute myeloid leukemia	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	ACC010 and HHT cooperatively downregulated MYC and inhibited FLT3 activation. Further, when HHT was added, ACC010-resistant cells demonstrated a good synergy. We also extended our study to the mouse BaF3 cell line with FLT3-inhibitor-resistant FLT3-ITD/tyrosine kinase domain mutations and AML cells without FLT3-ITD. Collectively, our results suggested that the combination treatment of ACC010 and HHT might be a promising strategy for AML patients, especially those carrying FLT3-ITD.

Pair Name	Medicarpin, TNF-related apoptosis inducing ligand
Phytochemical	Medicarpin
Drug	TNF-related apoptosis inducing ligand
Disease Info	[ICD-11: 2B33.1]	Myeloid leukemia	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway

Pair Name	Oleanolic Acid, Sorafenib
Phytochemical	Oleanolic Acid
Drug	Sorafenib
Disease Info	[ICD-11: 2C12]	Hepatocellular carcinoma	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	OA represents a novel approach to increase the sensitivity of HCC cells to Sorafenib via oxidative stress.

Pair Name	Quercetin, Cisplatin
Phytochemical	Quercetin
Drug	Cisplatin
Disease Info	[ICD-11: 2C73]	Ovarian cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	This study provides further new data for the mechanism by which the QU pre-treatment re-sensitizes SKOV-3/CDDP cells to cisplatin.

Pair Name	Sulforaphane, MiR-15b-5p
Phytochemical	Sulforaphane
Drug	MiR-15b-5p
Disease Info	[ICD-11: 2B90]	Colon cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Expression
Result	Our data demonstrate that this combined treatment leads to a very high proportion of apoptotic HT-29 cells (over 85%), a value higher than the sum of the values of apoptotic cells obtained after singularly administered regents (either SFN or R8-PNA-a15b).

Pair Name	Tangeretin, Metformin
Phytochemical	Tangeretin
Drug	Metformin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	The current work underscores the importance of metformin as an ERMA in tackling breast cancer and as a novel approach to boost its anticancer activity via a synergistic combination with tangeretin.

Pair Name	Theaflavin 3,3'-digallate, Cisplatin
Phytochemical	Theaflavin 3,3'-digallate
Drug	Cisplatin
Disease Info	[ICD-11: 2C73]	Ovarian cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Cleavage
Result	TF3 may be used as an adjuvant for the treatment of advanced ovarian cancer.

Pair Name	Vitamin C, Oxaliplatin
Phytochemical	Vitamin C
Drug	Oxaliplatin
Disease Info	[ICD-11: 2B72]	Gastric cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Activity
Result	The current study showed that GLUT1 expression was inversely correlated with sensitivity of gastric cancer cells to pharmacological ascorbate and suggested that GLUT1 expression in gastric cancer may serve as a marker for sensitivity to pharmacological ascorbate.

Pair Name	Zerumbone, Paclitaxel
Phytochemical	Zerumbone
Drug	Paclitaxel
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Caspase-7	Expression
Result	The prooxidant properties of zerumbone potentially resensitize breast cancer cells to PTX by enhancing intracellular ROS-mediated oxidative stress.