TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Caspase-7
UniProt ID CASP7_HUMAN
Gene Name CASP7
Gene ID 840
Synonyms
CASP7, CASP-7, CMH-1, ICE-LAP3, LICE2, MCH3
Sequence
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ
Pathway Map MAP LINK
T.C. Number 8.A.217.1.1
KEGG ID hsa840
TTD ID T72252
Pfam PF00656; PF18601
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 79
Pair Name Rutin, Oxaliplatin
Phytochemical Name Rutin
Anticancer drug Name Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin
Combination Pair ID: 261
Pair Name Ilexgenin A, Sorafenib
Phytochemical Name Ilexgenin A
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-7 Expression
Result The results described in the present study identifies Ilexgenin A as a promising therapeutic candidate that modulates inflammation, angiogenesis, and HCC growth.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 967
Pair Name Homoharringtonine, ACC010
Phytochemical Homoharringtonine
Drug ACC010
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result ACC010 and HHT cooperatively downregulated MYC and inhibited FLT3 activation. Further, when HHT was added, ACC010-resistant cells demonstrated a good synergy. We also extended our study to the mouse BaF3 cell line with FLT3-inhibitor-resistant FLT3-ITD/tyrosine kinase domain mutations and AML cells without FLT3-ITD. Collectively, our results suggested that the combination treatment of ACC010 and HHT might be a promising strategy for AML patients, especially those carrying FLT3-ITD.
Combination Pair ID: 22
Pair Name Evodiamine, Doxorubicin
Phytochemical Evodiamine
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-7 Activity
Result Our results indicated that EVO enhanced the apoptotic action of DOX by inhibiting the Ras/MEK/ERK cascade and the expression of IAPs without inhibiting the expression and activity of P-glycoprotein (P-gp). Taken together, our data indicate that EVO, a natural product, may be useful applied alone or in combination with DOX for the treatment of resistant breast cancer.
Combination Pair ID: 637
Pair Name Apigenin, TNF-related apoptosis inducing ligand
Phytochemical Apigenin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result Apigenin sensitizes cells to TRAIL-induced apoptosis by activating both intrinsic and extrinsic apoptotic pathway-related caspases. The augmented apoptotic effect by TRAIL/apigenin combination was accompanied by triggering mitochondria-dependent signaling pathway, as indicated by Bax/Bcl-2 ratio up-regulation
Combination Pair ID: 86
Pair Name Tangeretin, Metformin
Phytochemical Tangeretin
Drug Metformin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result The current work underscores the importance of metformin as an ERMA in tackling breast cancer and as a novel approach to boost its anticancer activity via a synergistic combination with tangeretin.
Combination Pair ID: 125
Pair Name Epigallocatechin gallate, Vorinostat
Phytochemical Epigallocatechin gallate
Drug Vorinostat
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-7 Expression
Result The compounds were able to decrease the expression of cIAP2 while increasing the expression of pro-apoptotic caspase 7. There were also changes in histone modifications, suggesting a role of epigenetic mechanisms in these changes in expression of cIAP2. These changes resulted in an increase in apoptosis. SAHA and EGCG were also capable of limiting TNBC cell migration across a fibronectin (FN) matrix.
Combination Pair ID: 673
Pair Name Dihydroartemisinin, Doxorubicin
Phytochemical Dihydroartemisinin
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result This study presented a new opportunity to enhance the effectiveness of future treatment regimens of breast cancer using DOX.
Combination Pair ID: 168
Pair Name Resveratrol, Temozolomide
Phytochemical Resveratrol
Drug Temozolomide
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Up-regulation Caspase-7 Expression
Result TMZ in combination with resveratrol remarkably increased reactive oxygen species (ROS) production, which serves as an upstream signal for AMP-activated protein kinase (AMPK) activation. Subsequently, activated AMPK inhibited mTOR signaling and downregulated antiapoptosis protein Bcl-2, which was contributed to the additive antiproliferation effects of combination treatment. In an orthotopic xenograft model of GBM, TMZ plus resveratrol treatment significantly reduced the volume of tumor, which was confirmed by decreased expression of Ki-67, a marker of proliferation index
Combination Pair ID: 674
Pair Name Artesunate, Cisplatin
Phytochemical Artesunate
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-7 Expression
Result ART exhibited significant anti-tumor effect on A549 cells and this efficiency could be enhanced by combination with CIS
Combination Pair ID: 194
Pair Name Oleanolic Acid, Sorafenib
Phytochemical Oleanolic Acid
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result OA represents a novel approach to increase the sensitivity of HCC cells to Sorafenib via oxidative stress.
Combination Pair ID: 698
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result Our data provide a rationale for developing a combination of beta-elemene and cisplatin as a regimen for the treatment of lung carcinoma and other cisplatin-resistant tumors.
Combination Pair ID: 701
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Up-regulation Caspase-7 Activity
Result Cisplatin combined with β-elemene as a chemosensitizer warrants further pre-clinical therapeutic studies and may be useful for the treatment of cisplatin-resistant bladder cancer and other types of carcinomas.
Combination Pair ID: 278
Pair Name Furanodiene, Doxorubicin
Phytochemical Furanodiene
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-7 Activity
Result These results indicate that furanodiene may be a promising and safety natural agent for cancer adjuvant therapy in the future.
Combination Pair ID: 289
Pair Name Emodin, Vinblastine
Phytochemical Emodin
Drug Vinblastine
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Caspase-7 Activity
Result Emodin Sensitizes Cervical Cancer Cells to Vinblastine by Inducing Apoptosis and Mitotic Death
Combination Pair ID: 748
Pair Name Thymoquinone, Zoledronic acid
Phytochemical Thymoquinone
Drug Zoledronic acid
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Caspase-7 Expression
Result TQ and ZA had minimal hematological and non-hematological toxicity profile compared to cytotoxic agents. So, this combination may be an alternative approach for patients who are unable to be treated by conventional treatments because of poor performance status.
Combination Pair ID: 315
Pair Name Damnacanthal, Doxorubicin
Phytochemical Damnacanthal
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-7 Expression
Result Combinatorial Cytotoxic Effects of Damnacanthal and Doxorubicin against Human Breast Cancer MCF-7 Cells in Vitro
Combination Pair ID: 773
Pair Name Chlorogenic acid, Regorafenib
Phytochemical Chlorogenic acid
Drug Regorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-7 Expression
Result This drug combination could be considered as a safe and more effective approach in HCC therapy.
Combination Pair ID: 825
Pair Name Curcumin, Dactolisib
Phytochemical Curcumin
Drug Dactolisib
Disease Info [ICD-11: 2D11.Y] Neuroblastoma Investigative
Regulate Info Up-regulation Caspase-7 Expression
Result Synergistic anti-proliferative and apoptotic effect of NVP-BEZ235 and curcumin on human SH-SY5Y neuroblastoma cells.
Combination Pair ID: 826
Pair Name Curcumin, Melphalan
Phytochemical Curcumin
Drug Melphalan
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-7 Expression
Result Curcumin and melphalan cotreatment induces cell cycle arrest and apoptosis in MDA-MB-231 breast cancer cells
Combination Pair ID: 434
Pair Name [6]-Gingerol, Paclitaxel
Phytochemical [6]-Gingerol
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-7 Activity
Result Anticancer Efficacy of 6-Gingerol with Paclitaxel against Wild Type of Human Breast Adenocarcinoma
Combination Pair ID: 441
Pair Name alpha-Mangostin, TNF-related apoptosis inducing ligand
Phytochemical alpha-Mangostin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B66.0] Oral squamous cell carcinoma Investigative
Regulate Info Up-regulation Caspase-7 Activity
Result Synergism between α-mangostin and TRAIL induces apoptosis in squamous cell carcinoma of the oral cavity through the mitochondrial pathway
Combination Pair ID: 867
Pair Name Theaflavin 3,3'-digallate, Cisplatin
Phytochemical Theaflavin 3,3'-digallate
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result TF3 may be used as an adjuvant for the treatment of advanced ovarian cancer.
Combination Pair ID: 476
Pair Name Quercetin, Cisplatin
Phytochemical Quercetin
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result This study provides further new data for the mechanism by which the QU pre-treatment re-sensitizes SKOV-3/CDDP cells to cisplatin.
Combination Pair ID: 881
Pair Name Gambogic Acid, TNF-related apoptosis inducing ligand
Phytochemical Gambogic Acid
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result These findings may open a new window in the treatment of breast cancer using TRAIL in combination with GA.
Combination Pair ID: 497
Pair Name Medicarpin, TNF-related apoptosis inducing ligand
Phytochemical Medicarpin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B33.1] Myeloid leukemia Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway
Combination Pair ID: 499
Pair Name Bisdemethoxycucurmin, Icotinib
Phytochemical Bisdemethoxycucurmin
Drug Icotinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib.
Combination Pair ID: 515
Pair Name All-trans retinoic acid, Midostaurin
Phytochemical All-trans-retinoic acid
Drug Midostaurin
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Caspase-7 Expression
Result Combination of midostaurin and ATRA exerts dose-dependent dual effects on acute myeloid leukemia cells with wild type FLT3
Combination Pair ID: 518
Pair Name All-trans retinoic acid, Salinomycin
Phytochemical All-trans-retinoic acid
Drug Salinomycin
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Caspase-7 Expression
Result S+RA induced differentiation by β-catenin-inhibition-mediated up-regulation of C/EBPs and PU.1 and suppression of c-Myc. S+RA triggered apoptosis through β-catenin-inhibition-regulated ΔΨm collapse and caspase-3/7 activation. Taken together, our findings may provide novel therapeutic strategies for AML patients by targeting the WNT/β-catenin pathway.
Combination Pair ID: 540
Pair Name Vitamin C, Oxaliplatin
Phytochemical Vitamin C
Drug Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-7 Activity
Result The current study showed that GLUT1 expression was inversely correlated with sensitivity of gastric cancer cells to pharmacological ascorbate and suggested that GLUT1 expression in gastric cancer may serve as a marker for sensitivity to pharmacological ascorbate.
Combination Pair ID: 542
Pair Name Sulforaphane, MiR-15b-5p
Phytochemical Sulforaphane
Drug MiR-15b-5p
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Caspase-7 Expression
Result Our data demonstrate that this combined treatment leads to a very high proportion of apoptotic HT-29 cells (over 85%), a value higher than the sum of the values of apoptotic cells obtained after singularly administered regents (either SFN or R8-PNA-a15b).
Combination Pair ID: 563
Pair Name Arachidin-1, Paclitaxel
Phytochemical Arachidin-1
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-7 Cleavage
Result A-1 in combination with Pac inhibited cell proliferation, induced apoptosis through mitochondrial oxidative stress, and reduced TNBC spheroid growth. These findings underscore the impactful effects of the prenylated stilbenoid A-1 as a novel adjuvant for Pac chemotherapy in TNBC treatment.
Combination Pair ID: 570
Pair Name Zerumbone, Paclitaxel
Phytochemical Zerumbone
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Caspase-7 Expression
Result The prooxidant properties of zerumbone potentially resensitize breast cancer cells to PTX by enhancing intracellular ROS-mediated oxidative stress.
03. Reference
No. Title Href
1 P38 Signal Transduction Pathway Has More Cofactors on Apoptosis of SGC-7901 Gastric Cancer Cells Induced by Combination of Rutin and Oxaliplatin. Biomed Res Int. 2019 Nov 6;2019:6407210. doi: 10.1155/2019/6407210. Click
2 Ilexgenin A exerts anti-inflammation and anti-angiogenesis effects through inhibition of STAT3 and PI3K pathways and exhibits synergistic effects with Sorafenib on hepatoma growth. Toxicol Appl Pharmacol. 2017 Jan 15;315:90-101. doi: 10.1016/j.taap.2016.12.008. Click
3 ACC010, a novel BRD4 inhibitor, synergized with homoharringtonine in acute myeloid leukemia with FLT3-ITD. Mol Oncol. 2023 Jul;17(7):1402-1418. doi: 10.1002/1878-0261.13368. Click
4 Evodiamine synergizes with doxorubicin in the treatment of chemoresistant human breast cancer without inhibiting P-glycoprotein. PLoS One. 2014 May 15;9(5):e97512. doi: 10.1371/journal.pone.0097512. Click
5 Apigenin Sensitizes Huh-7 Human Hepatocellular Carcinoma Cells to TRAIL-induced Apoptosis. Biomol Ther (Seoul). 2012 Jan;20(1):62-7. doi: 10.4062/biomolther.2012.20.1.062. Click
6 Tangeretin boosts the anticancer activity of metformin in breast cancer cells via curbing the energy production. Phytomedicine. 2021 Mar;83:153470. doi: 10.1016/j.phymed.2021.153470. Click
7 SAHA and EGCG Promote Apoptosis in Triple-negative Breast Cancer Cells, Possibly Through the Modulation of cIAP2. Anticancer Res. 2020 Jan;40(1):9-26. doi: 10.21873/anticanres.13922. Click
8 Synergistic anti-cancer activity of the combination of dihydroartemisinin and doxorubicin in breast cancer cells. Pharmacol Rep. 2013;65(2):453-9. doi: 10.1016/s1734-1140(13)71021-1. Click
9 Resveratrol enhances the antitumor effects of temozolomide in glioblastoma via ROS-dependent AMPK-TSC-mTOR signaling pathway. CNS Neurosci Ther. 2012;18(7):536-546. doi:10.1111/j.1755-5949.2012.00319.x Click
10 Artesunate exhibits synergistic anti-cancer effects with cisplatin on lung cancer A549 cells by inhibiting MAPK pathway. Gene. 2021 Jan 15;766:145134. doi: 10.1016/j.gene.2020.145134. Click
11 Identification of a novel oxidative stress induced cell death by Sorafenib and oleanolic acid in human hepatocellular carcinoma cells. Biochem Pharmacol. 2016 Oct 15;118:9-17. doi: 10.1016/j.bcp.2016.08.011. Click
12 beta-Elemene, a novel plant-derived antineoplastic agent, increases cisplatin chemosensitivity of lung tumor cells by triggering apoptosis. Oncol Rep. 2009 Jul;22(1):161-70. doi: 10.3892/or_00000420. Click
13 β-Elemene promotes cisplatin-induced cell death in human bladder cancer and other carcinomas. Anticancer Res. 2013 Apr;33(4):1421-8. Click
14 Furanodiene enhances the anti-cancer effects of doxorubicin on ERα-negative breast cancer cells in vitro. Eur J Pharmacol. 2016 Mar 5;774:10-9. doi: 10.1016/j.ejphar.2015.11.039. Click
15 Emodin Sensitizes Cervical Cancer Cells to Vinblastine by Inducing Apoptosis and Mitotic Death. Int J Mol Sci. 2022 Jul 31;23(15):8510. doi: 10.3390/ijms23158510. Click
16 Enhanced cytotoxicity and apoptosis by thymoquinone in combination with zoledronic acid in hormone- and drug-resistant prostate cancer cell lines. J BUON. 2014 Oct-Dec;19(4):1055-61. Click
17 Combinatorial Cytotoxic Effects of Damnacanthal and Doxorubicin against Human Breast Cancer MCF-7 Cells in Vitro. Molecules. 2016 Sep 14;21(9):1228. doi: 10.3390/molecules21091228. Click
18 Chlorogenic Acid Improves the Regorafenib Effects in Human Hepatocellular Carcinoma Cells. Int J Mol Sci. 2018 May 19;19(5):1518. doi: 10.3390/ijms19051518. Click
19 Synergistic anti-proliferative and apoptotic effect of NVP-BEZ235 and curcumin on human SH-SY5Y neuroblastoma cells. Med Oncol. 2023 Dec 10;41(1):11. doi: 10.1007/s12032-023-02239-8. Click
20 Curcumin and melphalan cotreatment induces cell cycle arrest and apoptosis in MDA-MB-231 breast cancer cells. Sci Rep. 2023 Aug 18;13(1):13446. doi: 10.1038/s41598-023-40535-5. Click
21 Anticancer Efficacy of 6-Gingerol with Paclitaxel against Wild Type of Human Breast Adenocarcinoma. Molecules. 2022 Apr 22;27(9):2693. doi: 10.3390/molecules27092693. Click
22 Synergism between α-mangostin and TRAIL induces apoptosis in squamous cell carcinoma of the oral cavity through the mitochondrial pathway. Oncol Rep. 2017 Dec;38(6):3439-3446. doi: 10.3892/or.2017.6030. Click
23 Synergistic effect of black tea polyphenol, theaflavin-3,3'-digallate with cisplatin against cisplatin resistant human ovarian cancer cells. J Funct Foods. 2018 Jul;46:1-11. doi: 10.1016/j.jff.2018.04.037. Click
24 Potentiation of Cisplatin Cytotoxicity in Resistant Ovarian Cancer SKOV3/Cisplatin Cells by Quercetin Pre-Treatment. Int J Mol Sci. 2023;24(13):10960. Published 2023 Jun 30. doi:10.3390/ijms241310960 Click
25 Gambogic acid sensitizes breast cancer cells to TRAIL-induced apoptosis by promoting the crosstalk of extrinsic and intrinsic apoptotic signalings. Food Chem Toxicol. 2018 Sep;119:334-341. doi: 10.1016/j.fct.2018.02.037. Click
26 Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. Click
27 Our data indicate that BMDC has the potential to improve the treatment of primary EGFR-TKI resistant NISCLC that cannot be controlled with single-target agent, such as icotinib. Click
28 Combination of midostaurin and ATRA exerts dose-dependent dual effects on acute myeloid leukemia cells with wild type FLT3. BMC Cancer. 2022 Jul 9;22(1):749. doi: 10.1186/s12885-022-09828-2. Click
29 Combined Application of Salinomycin and ATRA Induces Apoptosis and Differentiation of Acute Myeloid Leukemia Cells by Inhibiting WNT/β-Catenin Pathway. Anticancer Agents Med Chem. 2023;23(9):1074-1084. doi: 10.2174/1871520623666230110121629. Click
30 Pharmacological Ascorbate Suppresses Growth of Gastric Cancer Cells with GLUT1 Overexpression and Enhances the Efficacy of Oxaliplatin Through Redox Modulation. Theranostics. 2018 Feb 2;8(5):1312-1326. doi: 10.7150/thno.21745. Click
31 High Levels of Apoptosis Are Induced in the Human Colon Cancer HT-29 Cell Line by Co-Administration of Sulforaphane and a Peptide Nucleic Acid Targeting miR-15b-5p. Nucleic Acid Ther. 2020 Jun;30(3):164-174. doi: 10.1089/nat.2019.0825. Click
32 Arachidin-1, a Prenylated Stilbenoid from Peanut, Enhances the Anticancer Effects of Paclitaxel in Triple-Negative Breast Cancer Cells. Cancers (Basel). 2023;15(2):399. Published 2023 Jan 7. doi:10.3390/cancers15020399 Click
33 Zerumbone-induced reactive oxygen species-mediated oxidative stress re-sensitizes breast cancer cells to paclitaxel. Biotechnol Appl Biochem. 2023 Feb;70(1):28-37. doi: 10.1002/bab.2326. Click
It has been 587416 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP