| Name | 26S proteasome non-ATPase regulatory subunit 9 | ||
| UniProt ID | PSMD9_HUMAN | ||
| Gene Name | PSMD9 | ||
| Gene ID | 5715 | ||
| Synonyms |
PSMD9, Rpn4, p27
|
||
| Sequence |
MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCE
GYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAM SRKLGQSESQGPPRAFAKVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIGSVV QHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIPLQR |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa5715 | ||
| Pfam | PF00595; PF02617; PF04495; PF13180; PF17820; PF18265 | ||
| Pair Name | Biochanin A, SB590885 | |||
| Phytochemical Name | Biochanin A | |||
| Anticancer drug Name | SB590885 | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | The results identify an effective combination therapy for the most aggressive form of HCC and provide the possibility of therapeutic improvement for patients with advanced HCC. | |||
| Pair Name | [6]-Gingerol, Cisplatin | |||
| Phytochemical | [6]-Gingerol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | [6]-Gingerol enhances the cisplatin sensitivity of gastric cancer cells through inhibition of proliferation and invasion via PI3K/AKT signaling pathway | |||
| Pair Name | AKBA, Cisplatin | |||
| Phytochemical | AKBA | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Acetyl-11-keto-beta-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway | |||
| Pair Name | Apigenin, Doxorubicin | |||
| Phytochemical | Apigenin | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells | |||
| Pair Name | Bergamottin, Simvastatin | |||
| Phytochemical | Bergamottin | |||
| Drug | Simvastatin | |||
| Disease Info | [ICD-11: 2A20.1] | Chronic myelogenous leukemia | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Discussion and conclusion Our results provide novel insight into the role of SV and BGM in potentially preventing and treating cancer through modulation of NF-κB signalling pathway and its regulated gene products. | |||
| Pair Name | Britannin, Vincristine | |||
| Phytochemical | Britannin | |||
| Drug | Vincristine | |||
| Disease Info | [ICD-11: 2B33.3] | Acute lymphoblastic leukemia | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Our results proposed a mechanism for the cytotoxic effect of Britannin, either as a single agent or in combination with Vincristine, in NALM-6 cells. | |||
| Pair Name | Britannin, Vincristine | |||
| Phytochemical | Britannin | |||
| Drug | Vincristine | |||
| Disease Info | [ICD-11: 2B33.3] | Acute lymphoblastic leukemia | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | The results of this study showed for the first time that Britannin, as a natural Sesquiterpene Lactone, has cytotoxic effects that could be considered as an anti-leukemic agent in the treatment of ALL. However, there is still a demand for further studies that examine the efficacy and the safety of this purified compound. | |||
| Pair Name | Butein, Cisplatin | |||
| Phytochemical | Butein | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a | |||
| Pair Name | Caffeic acid phenethyl ester, Cisplatin | |||
| Phytochemical | Caffeic acid phenethyl ester | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | This study reveals the therapeutic potential of CAPE in cisplatin-resistant ovarian tumors as well as in tumors expressing USP8. | |||
| Pair Name | Cucurbitacin B, Cisplatin | |||
| Phytochemical | Cucurbitacin B | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C94] | Bladder cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Our results showed that CuB may be a new agent that can support conventional treatment in bladder cancer. Our study is important in terms of enlightening new pathways and developing new treatment methods in the treatment of bladder cancer. | |||
| Pair Name | Curcumin, Arsenic trioxide | |||
| Phytochemical | Curcumin | |||
| Drug | Arsenic trioxide | |||
| Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Our results suggested that curcumin and As2O3 combination therapy exerts more significant anti-leukemia effects in the treatment of AML than curcumin or As2O3 monotherapy by up-regulating p53 pathway and down-regulating the JAK2/STAT3 pathway. | |||
| Pair Name | Daurinoline, Sorafenib | |||
| Phytochemical | Daurinoline | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Our study provides insights into the molecular mechanisms underlying DS-induced inhibition of VM, which may facilitate the development of a novel clinical anti-HCC drug. Moreover, our findings suggest that the combination of DS and sorafenib constitutes a potential therapeutic strategy for HCC. | |||
| Pair Name | Delta-Tocotrienol, Cisplatin | |||
| Phytochemical | Delta-Tocotrienol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis | |||
| Pair Name | Flavokawain B, Bortezomib | |||
| Phytochemical | Flavokawain B | |||
| Drug | Bortezomib | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | These findings provide a rationale for further investigating combination of FKB and Bortezomib for treatment of RB deficient, castration-resistant prostate cancer. | |||
| Pair Name | Forskolin, Paclitaxel | |||
| Phytochemical | Forskolin | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Our findings encourage the design of future studies aimed at further exploring the Forskolin employment in NSCLC treatment. | |||
| Pair Name | Halofuginone, Cisplatin | |||
| Phytochemical | Halofuginone | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Halofuginone Sensitizes Lung Cancer Organoids to Cisplatin via Suppressing PI3K/AKT and MAPK Signaling Pathways | |||
| Pair Name | Homoharringtonine, ACC010 | |||
| Phytochemical | Homoharringtonine | |||
| Drug | ACC010 | |||
| Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | ACC010 and HHT cooperatively downregulated MYC and inhibited FLT3 activation. Further, when HHT was added, ACC010-resistant cells demonstrated a good synergy. We also extended our study to the mouse BaF3 cell line with FLT3-inhibitor-resistant FLT3-ITD/tyrosine kinase domain mutations and AML cells without FLT3-ITD. Collectively, our results suggested that the combination treatment of ACC010 and HHT might be a promising strategy for AML patients, especially those carrying FLT3-ITD. | |||
| Pair Name | Licochalcone B, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Licochalcone B | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC. | |||
| Pair Name | Magnolin, B-RAF Inhibitors | |||
| Phytochemical | Magnolin | |||
| Drug | B-RAF Inhibitors | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway | |||
| Pair Name | Nobiletin, Palbociclib | |||
| Phytochemical | Nobiletin | |||
| Drug | Palbociclib | |||
| Disease Info | [ICD-11: 2C90.0] | Renal cell carcinoma | Investigative | |
| Regulate Info | Down-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Nobiletin downregulates the SKP2-p21/p27-CDK2 axis to inhibit tumor progression and shows synergistic effects with palbociclib on renal cell carcinoma | |||
| Pair Name | Platycodin D, Oxaliplatin | |||
| Phytochemical | Platycodin D | |||
| Drug | Oxaliplatin | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Our results showed that PD is suitable as a promising agent for overcoming oxaliplatin-resistant colorectal cancer. | |||
| Pair Name | Pristimerin, Sorafenib | |||
| Phytochemical | Pristimerin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway | |||
| Pair Name | Sulforaphane, Everolimus | |||
| Phytochemical | Sulforaphane | |||
| Drug | Everolimus | |||
| Disease Info | [ICD-11: 2C94] | Bladder cancer | Investigative | |
| Regulate Info | Down-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | The addition of SFN to the long-term everolimus application inhibits resistance development in bladder cancer cells in vitro. Therefore, sulforaphane may hold potential for treating bladder carcinoma in patients with resistance to an mTOR inhibitor. | |||
| Pair Name | Xanthorrhizol, Tamoxifen | |||
| Phytochemical | Xanthorrhizol | |||
| Drug | Tamoxifen | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | It can be concluded that while there is no significant herb-drug interaction between xanthorrhizol and tamoxifen in vitro, there is such an interaction in tumor-bearing mice, which provides important information that affects breast cancer treatment translational research. | |||
| Pair Name | Cordycepin, Cisplatin | |||
| Phytochemical | Cordycepin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Our results suggested that Cor in combination with DDP could be an additional therapeutic option for the treatment of DDP-resistant NSCLC. | |||
| Pair Name | Honokiol, Paclitaxel | |||
| Phytochemical | Honokiol | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | 26S proteasome non-ATPase regulatory subunit 9 | Expression | |
| Result | Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction | |||
| No. | Title | Href |
|---|---|---|
| 1 | The combination of Biochanin A and SB590885 potentiates the inhibition of tumour progression in hepatocellular carcinoma. Cancer Cell Int. 2020 Aug 5;20:371. doi: 10.1186/s12935-020-01463-w. | Click |
| 2 | [6]-Gingerol enhances the cisplatin sensitivity of gastric cancer cells through inhibition of proliferation and invasion via PI3K/AKT signaling pathway. Phytother Res. 2019 May;33(5):1353-1362. doi: 10.1002/ptr.6325. | Click |
| 3 | Acetyl-11-keto-β-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway. Cell Biol Toxicol. 2021 Apr;37(2):209-228. doi: 10.1007/s10565-020-09541-5. | Click |
| 4 | Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells. Exp Oncol. 2021 Jun;43(2):125-134. doi: 10.32471/exp-oncology.2312-8852.vol-43-no-2.16096. | Click |
| 5 | Simvastatin in combination with bergamottin potentiates TNF-induced apoptosis through modulation of NF-κB signalling pathway in human chronic myelogenous leukaemia. Pharm Biol. 2016 Oct;54(10):2050-60. doi: 10.3109/13880209.2016.1141221. | Click |
| 6 | Britannin, a sesquiterpene lactone induces ROS-dependent apoptosis in NALM-6, REH, and JURKAT cell lines and produces a synergistic effect with vincristine. Mol Biol Rep. 2021 Sep;48(9):6249-6258. doi: 10.1007/s11033-021-06572-x. | Click |
| 7 | Britannin a Sesquiterpene Lactone from Inula aucheriana Exerted an Anti-leukemic Effect in Acute Lymphoblastic Leukemia (ALL) Cells and Enhanced the Sensitivity of the Cells to Vincristine. Nutr Cancer. 2022;74(3):965-977. doi: 10.1080/01635581.2021.1931700. | Click |
| 8 | Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a. Int J Mol Med. 2015 Oct;36(4):957-66. doi: 10.3892/ijmm.2015.2324. | Click |
| 9 | Caffeic acid phenethyl ester targets ubiquitin-specific protease 8 and synergizes with cisplatin in endometrioid ovarian carcinoma cells. Biochem Pharmacol. 2022 Mar;197:114900. doi: 10.1016/j.bcp.2021.114900. | Click |
| 10 | Cucurbitacin B and cisplatin induce the cell death pathways in MB49 mouse bladder cancer model. Exp Biol Med (Maywood). 2020 May;245(9):805-814. doi: 10.1177/1535370220917367. | Click |
| 11 | Curcumin combined with arsenic trioxide in the treatment of acute myeloid leukemia: network pharmacology analysis and experimental validation. J Cancer Res Clin Oncol. 2023 Jan;149(1):219-230. doi: 10.1007/s00432-022-04463-7. | Click |
| 12 | The role of daurisoline treatment in hepatocellular carcinoma: Inhibiting vasculogenic mimicry formation and enhancing sensitivity to sorafenib. Phytomedicine. 2021 Nov;92:153740. doi: 10.1016/j.phymed.2021.153740. | Click |
| 13 | δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis. Cell Prolif. 2021 Nov;54(11):e13111. doi: 10.1111/cpr.13111. | Click |
| 14 | Flavokawain B targets protein neddylation for enhancing the anti-prostate cancer effect of Bortezomib via Skp2 degradation. Cell Commun Signal. 2019 Mar 18;17(1):25. doi: 10.1186/s12964-019-0338-2. | Click |
| 15 | Forskolin affects proliferation, migration and Paclitaxel-mediated cytotoxicity in non-small-cell lung cancer cell lines via adenylyl cyclase/cAMP axis. Eur J Cell Biol. 2023 Jun;102(2):151292. doi: 10.1016/j.ejcb.2023.151292. | Click |
| 16 | Halofuginone Sensitizes Lung Cancer Organoids to Cisplatin via Suppressing PI3K/AKT and MAPK Signaling Pathways. Front Cell Dev Biol. 2021 Nov 24;9:773048. doi: 10.3389/fcell.2021.773048. | Click |
| 17 | ACC010, a novel BRD4 inhibitor, synergized with homoharringtonine in acute myeloid leukemia with FLT3-ITD. Mol Oncol. 2023 Jul;17(7):1402-1418. doi: 10.1002/1878-0261.13368. | Click |
| 18 | Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. | Click |
| 19 | Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway. Am J Transl Res. 2019 Jun 15;11(6):3816-3824. | Click |
| 20 | Nobiletin downregulates the SKP2-p21/p27-CDK2 axis to inhibit tumor progression and shows synergistic effects with palbociclib on renal cell carcinoma. Cancer Biol Med. 2021 Feb 15;18(1):227-244. doi: 10.20892/j.issn.2095-3941.2020.0186. | Click |
| 21 | Platycodin D confers oxaliplatin Resistance in Colorectal Cancer by activating the LATS2/YAP1 axis of the hippo signaling pathway. J Cancer. 2023 Jan 22;14(3):393-402. doi: 10.7150/jca.77322. | Click |
| 22 | Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway. Phytomedicine. 2021 Jun;86:153563. doi: 10.1016/j.phymed.2021.153563. | Click |
| 23 | Chronic Sulforaphane Administration Inhibits Resistance to the mTOR-Inhibitor Everolimus in Bladder Cancer Cells. Int J Mol Sci. 2020 Jun 4;21(11):4026. doi: 10.3390/ijms21114026. | Click |
| 24 | In vitro and in vivo effects of xanthorrhizol on human breast cancer MCF-7 cells treated with tamoxifen. J Pharmacol Sci. 2014;125(4):375-85. doi: 10.1254/jphs.14024fp. | Click |
| 25 | Cordycepin Reverses Cisplatin Resistance in Non-small Cell Lung Cancer by Activating AMPK and Inhibiting AKT Signaling Pathway. Front Cell Dev Biol. 2021 Jan 15;8:609285. doi: 10.3389/fcell.2020.609285. | Click |
| 26 | Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction. Cell Oncol (Dordr). 2021 Feb;44(1):135-150. doi: 10.1007/s13402-020-00557-x. | Click |
