TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name 26S proteasome non-ATPase regulatory subunit 9
UniProt ID PSMD9_HUMAN
Gene Name PSMD9
Gene ID 5715
Synonyms
PSMD9, Rpn4, p27
Sequence
MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCE
GYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAM
SRKLGQSESQGPPRAFAKVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIGSVV
QHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIPLQR
Pathway Map MAP LINK
KEGG ID hsa5715
Pfam PF00595; PF02617; PF04495; PF13180; PF17820; PF18265
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 464
Pair Name Biochanin A, SB590885
Phytochemical Name Biochanin A
Anticancer drug Name SB590885
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result The results identify an effective combination therapy for the most aggressive form of HCC and provide the possibility of therapeutic improvement for patients with advanced HCC.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 432
Pair Name [6]-Gingerol, Cisplatin
Phytochemical [6]-Gingerol
Drug Cisplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result [6]-Gingerol enhances the cisplatin sensitivity of gastric cancer cells through inhibition of proliferation and invasion via PI3K/AKT signaling pathway
Combination Pair ID: 232
Pair Name AKBA, Cisplatin
Phytochemical AKBA
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Acetyl-11-keto-beta-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway
Combination Pair ID: 76
Pair Name Apigenin, Doxorubicin
Phytochemical Apigenin
Drug Doxorubicin
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells
Combination Pair ID: 332
Pair Name Bergamottin, Simvastatin
Phytochemical Bergamottin
Drug Simvastatin
Disease Info [ICD-11: 2A20.1] Chronic myelogenous leukemia Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Discussion and conclusion Our results provide novel insight into the role of SV and BGM in potentially preventing and treating cancer through modulation of NF-κB signalling pathway and its regulated gene products.
Combination Pair ID: 280
Pair Name Britannin, Vincristine
Phytochemical Britannin
Drug Vincristine
Disease Info [ICD-11: 2B33.3] Acute lymphoblastic leukemia Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Our results proposed a mechanism for the cytotoxic effect of Britannin, either as a single agent or in combination with Vincristine, in NALM-6 cells.
Combination Pair ID: 281
Pair Name Britannin, Vincristine
Phytochemical Britannin
Drug Vincristine
Disease Info [ICD-11: 2B33.3] Acute lymphoblastic leukemia Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result The results of this study showed for the first time that Britannin, as a natural Sesquiterpene Lactone, has cytotoxic effects that could be considered as an anti-leukemic agent in the treatment of ALL. However, there is still a demand for further studies that examine the efficacy and the safety of this purified compound.
Combination Pair ID: 112
Pair Name Butein, Cisplatin
Phytochemical Butein
Drug Cisplatin
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a
Combination Pair ID: 323
Pair Name Caffeic acid phenethyl ester, Cisplatin
Phytochemical Caffeic acid phenethyl ester
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result This study reveals the therapeutic potential of CAPE in cisplatin-resistant ovarian tumors as well as in tumors expressing USP8.
Combination Pair ID: 217
Pair Name Cucurbitacin B, Cisplatin
Phytochemical Cucurbitacin B
Drug Cisplatin
Disease Info [ICD-11: 2C94] Bladder cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Our results showed that CuB may be a new agent that can support conventional treatment in bladder cancer. Our study is important in terms of enlightening new pathways and developing new treatment methods in the treatment of bladder cancer.
Combination Pair ID: 400
Pair Name Curcumin, Arsenic trioxide
Phytochemical Curcumin
Drug Arsenic trioxide
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Our results suggested that curcumin and As2O3 combination therapy exerts more significant anti-leukemia effects in the treatment of AML than curcumin or As2O3 monotherapy by up-regulating p53 pathway and down-regulating the JAK2/STAT3 pathway.
Combination Pair ID: 53
Pair Name Daurinoline, Sorafenib
Phytochemical Daurinoline
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Our study provides insights into the molecular mechanisms underlying DS-induced inhibition of VM, which may facilitate the development of a novel clinical anti-HCC drug. Moreover, our findings suggest that the combination of DS and sorafenib constitutes a potential therapeutic strategy for HCC.
Combination Pair ID: 590
Pair Name Delta-Tocotrienol, Cisplatin
Phytochemical Delta-Tocotrienol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis
Combination Pair ID: 148
Pair Name Flavokawain B, Bortezomib
Phytochemical Flavokawain B
Drug Bortezomib
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result These findings provide a rationale for further investigating combination of FKB and Bortezomib for treatment of RB deficient, castration-resistant prostate cancer.
Combination Pair ID: 613
Pair Name Forskolin, Paclitaxel
Phytochemical Forskolin
Drug Paclitaxel
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Our findings encourage the design of future studies aimed at further exploring the Forskolin employment in NSCLC treatment.
Combination Pair ID: 13
Pair Name Halofuginone, Cisplatin
Phytochemical Halofuginone
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Halofuginone Sensitizes Lung Cancer Organoids to Cisplatin via Suppressing PI3K/AKT and MAPK Signaling Pathways
Combination Pair ID: 967
Pair Name Homoharringtonine, ACC010
Phytochemical Homoharringtonine
Drug ACC010
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result ACC010 and HHT cooperatively downregulated MYC and inhibited FLT3 activation. Further, when HHT was added, ACC010-resistant cells demonstrated a good synergy. We also extended our study to the mouse BaF3 cell line with FLT3-inhibitor-resistant FLT3-ITD/tyrosine kinase domain mutations and AML cells without FLT3-ITD. Collectively, our results suggested that the combination treatment of ACC010 and HHT might be a promising strategy for AML patients, especially those carrying FLT3-ITD.
Combination Pair ID: 129
Pair Name Licochalcone B, TNF-related apoptosis inducing ligand
Phytochemical Licochalcone B
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC.
Combination Pair ID: 342
Pair Name Magnolin, B-RAF Inhibitors
Phytochemical Magnolin
Drug B-RAF Inhibitors
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway
Combination Pair ID: 82
Pair Name Nobiletin, Palbociclib
Phytochemical Nobiletin
Drug Palbociclib
Disease Info [ICD-11: 2C90.0] Renal cell carcinoma Investigative
Regulate Info Down-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Nobiletin downregulates the SKP2-p21/p27-CDK2 axis to inhibit tumor progression and shows synergistic effects with palbociclib on renal cell carcinoma
Combination Pair ID: 963
Pair Name Platycodin D, Oxaliplatin
Phytochemical Platycodin D
Drug Oxaliplatin
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Our results showed that PD is suitable as a promising agent for overcoming oxaliplatin-resistant colorectal cancer.
Combination Pair ID: 587
Pair Name Pristimerin, Sorafenib
Phytochemical Pristimerin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway
Combination Pair ID: 549
Pair Name Sulforaphane, Everolimus
Phytochemical Sulforaphane
Drug Everolimus
Disease Info [ICD-11: 2C94] Bladder cancer Investigative
Regulate Info Down-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result The addition of SFN to the long-term everolimus application inhibits resistance development in bladder cancer cells in vitro. Therefore, sulforaphane may hold potential for treating bladder carcinoma in patients with resistance to an mTOR inhibitor.
Combination Pair ID: 282
Pair Name Xanthorrhizol, Tamoxifen
Phytochemical Xanthorrhizol
Drug Tamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result It can be concluded that while there is no significant herb-drug interaction between xanthorrhizol and tamoxifen in vitro, there is such an interaction in tumor-bearing mice, which provides important information that affects breast cancer treatment translational research.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 596
Pair Name Cordycepin, Cisplatin
Phytochemical Cordycepin
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Our results suggested that Cor in combination with DDP could be an additional therapeutic option for the treatment of DDP-resistant NSCLC.
Combination Pair ID: 316
Pair Name Honokiol, Paclitaxel
Phytochemical Honokiol
Drug Paclitaxel
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation 26S proteasome non-ATPase regulatory subunit 9 Expression
Result Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction
03. Reference
No. Title Href
1 The combination of Biochanin A and SB590885 potentiates the inhibition of tumour progression in hepatocellular carcinoma. Cancer Cell Int. 2020 Aug 5;20:371. doi: 10.1186/s12935-020-01463-w. Click
2 [6]-Gingerol enhances the cisplatin sensitivity of gastric cancer cells through inhibition of proliferation and invasion via PI3K/AKT signaling pathway. Phytother Res. 2019 May;33(5):1353-1362. doi: 10.1002/ptr.6325. Click
3 Acetyl-11-keto-β-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway. Cell Biol Toxicol. 2021 Apr;37(2):209-228. doi: 10.1007/s10565-020-09541-5. Click
4 Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells. Exp Oncol. 2021 Jun;43(2):125-134. doi: 10.32471/exp-oncology.2312-8852.vol-43-no-2.16096. Click
5 Simvastatin in combination with bergamottin potentiates TNF-induced apoptosis through modulation of NF-κB signalling pathway in human chronic myelogenous leukaemia. Pharm Biol. 2016 Oct;54(10):2050-60. doi: 10.3109/13880209.2016.1141221. Click
6 Britannin, a sesquiterpene lactone induces ROS-dependent apoptosis in NALM-6, REH, and JURKAT cell lines and produces a synergistic effect with vincristine. Mol Biol Rep. 2021 Sep;48(9):6249-6258. doi: 10.1007/s11033-021-06572-x. Click
7 Britannin a Sesquiterpene Lactone from Inula aucheriana Exerted an Anti-leukemic Effect in Acute Lymphoblastic Leukemia (ALL) Cells and Enhanced the Sensitivity of the Cells to Vincristine. Nutr Cancer. 2022;74(3):965-977. doi: 10.1080/01635581.2021.1931700. Click
8 Butein sensitizes HeLa cells to cisplatin through the AKT and ERK/p38 MAPK pathways by targeting FoxO3a. Int J Mol Med. 2015 Oct;36(4):957-66. doi: 10.3892/ijmm.2015.2324. Click
9 Caffeic acid phenethyl ester targets ubiquitin-specific protease 8 and synergizes with cisplatin in endometrioid ovarian carcinoma cells. Biochem Pharmacol. 2022 Mar;197:114900. doi: 10.1016/j.bcp.2021.114900. Click
10 Cucurbitacin B and cisplatin induce the cell death pathways in MB49 mouse bladder cancer model. Exp Biol Med (Maywood). 2020 May;245(9):805-814. doi: 10.1177/1535370220917367. Click
11 Curcumin combined with arsenic trioxide in the treatment of acute myeloid leukemia: network pharmacology analysis and experimental validation. J Cancer Res Clin Oncol. 2023 Jan;149(1):219-230. doi: 10.1007/s00432-022-04463-7. Click
12 The role of daurisoline treatment in hepatocellular carcinoma: Inhibiting vasculogenic mimicry formation and enhancing sensitivity to sorafenib. Phytomedicine. 2021 Nov;92:153740. doi: 10.1016/j.phymed.2021.153740. Click
13 δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis. Cell Prolif. 2021 Nov;54(11):e13111. doi: 10.1111/cpr.13111. Click
14 Flavokawain B targets protein neddylation for enhancing the anti-prostate cancer effect of Bortezomib via Skp2 degradation. Cell Commun Signal. 2019 Mar 18;17(1):25. doi: 10.1186/s12964-019-0338-2. Click
15 Forskolin affects proliferation, migration and Paclitaxel-mediated cytotoxicity in non-small-cell lung cancer cell lines via adenylyl cyclase/cAMP axis. Eur J Cell Biol. 2023 Jun;102(2):151292. doi: 10.1016/j.ejcb.2023.151292. Click
16 Halofuginone Sensitizes Lung Cancer Organoids to Cisplatin via Suppressing PI3K/AKT and MAPK Signaling Pathways. Front Cell Dev Biol. 2021 Nov 24;9:773048. doi: 10.3389/fcell.2021.773048. Click
17 ACC010, a novel BRD4 inhibitor, synergized with homoharringtonine in acute myeloid leukemia with FLT3-ITD. Mol Oncol. 2023 Jul;17(7):1402-1418. doi: 10.1002/1878-0261.13368. Click
18 Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. Click
19 Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway. Am J Transl Res. 2019 Jun 15;11(6):3816-3824. Click
20 Nobiletin downregulates the SKP2-p21/p27-CDK2 axis to inhibit tumor progression and shows synergistic effects with palbociclib on renal cell carcinoma. Cancer Biol Med. 2021 Feb 15;18(1):227-244. doi: 10.20892/j.issn.2095-3941.2020.0186. Click
21 Platycodin D confers oxaliplatin Resistance in Colorectal Cancer by activating the LATS2/YAP1 axis of the hippo signaling pathway. J Cancer. 2023 Jan 22;14(3):393-402. doi: 10.7150/jca.77322. Click
22 Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway. Phytomedicine. 2021 Jun;86:153563. doi: 10.1016/j.phymed.2021.153563. Click
23 Chronic Sulforaphane Administration Inhibits Resistance to the mTOR-Inhibitor Everolimus in Bladder Cancer Cells. Int J Mol Sci. 2020 Jun 4;21(11):4026. doi: 10.3390/ijms21114026. Click
24 In vitro and in vivo effects of xanthorrhizol on human breast cancer MCF-7 cells treated with tamoxifen. J Pharmacol Sci. 2014;125(4):375-85. doi: 10.1254/jphs.14024fp. Click
25 Cordycepin Reverses Cisplatin Resistance in Non-small Cell Lung Cancer by Activating AMPK and Inhibiting AKT Signaling Pathway. Front Cell Dev Biol. 2021 Jan 15;8:609285. doi: 10.3389/fcell.2020.609285. Click
26 Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction. Cell Oncol (Dordr). 2021 Feb;44(1):135-150. doi: 10.1007/s13402-020-00557-x. Click
It has been 131593 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP