TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Nuclear factor erythroid 2-related factor 2
UniProt ID NF2L2_HUMAN
Gene Name NFE2L2
Gene ID 4780
Synonyms
NFE2L2, HEBP1, IMDDHH, NRF2, Nrf-2
Sequence
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQE
QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM
QLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM
QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVG
NCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHS
VESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA
QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD
FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLL
KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
DVKKN
Pathway Map MAP LINK
KEGG ID hsa4780
TTD ID T88505
Pfam PF00170; PF03131; PF07716; PF15996; PF17001
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 36
Pair Name Amygdalin, Sorafenib
Phytochemical Name Amygdalin
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2D91] Ehrlich ascites carcinoma Investigative
Regulate Info Up-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Amy improved the antitumor effect of Sor and had a protective role on liver damage induced by EAC in mice.
Combination Pair ID: 207
Pair Name Ginsenoside Rh2, Doxorubicin
Phytochemical Name Ginsenoside Rh2
Anticancer drug Name Doxorubicin
Disease Info [ICD-11:2D40] Ehrlich's adenocarcinoma Investigative
Regulate Info Up-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Rh2-induced direct activation of Nrf2 might provide additional benefits by minimizing DOX toxicity towards non-cancerous cells.
Combination Pair ID: 453
Pair Name Mangiferin, Cisplatin
Phytochemical Name Mangiferin
Anticancer drug Name Cisplatin
Disease Info Nephrotoxicity Investigative
Regulate Info Up-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result The study reveals a mechanistic basis of mangiferin action against cisplatin induced nephrotoxicity. Since Mangiferin shows synergistic anticancer activity with cisplatin, it can be considered as a promising drug candidate, to be used in combination with cisplatin.
Combination Pair ID: 554
Pair Name Sulforaphane, Selenium
Phytochemical Name Sulforaphane
Anticancer drug Name Selenium
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Combined SFN and Se treatment synergistically upregulated TrxR-1, which plays a significant role in maintaining intracellular redox homeostasis and contributed to the SFN-induced protection against free radical-mediated oxidative damage in normal colonic cells.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 1
Pair Name Camptothecin, Sorafenib
Phytochemical Camptothecin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result The synergetic combination significantly increases lipid peroxidation and iron concentration, decreases TAC, GPX4 and GR activity, and reduces the expression of both Nrf2 and SLC7A11. The downregulation of Nrf2 expression has a vital role in the reduction of resistance mediators to sorafenib against HCC cells like (p62, MT1G, and ABCG2) and improves the cellular uptake of sorafenib. The current study provided evidence that Nrf2 inhibition by CPT improves sorafenib's sensitivity and reduces sorafenib's resistance via the augmentation of sorafenib's ferroptosis action.
Combination Pair ID: 26
Pair Name Trigonelline, Cisplatin
Phytochemical Trigonelline
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Phosphorylation
Result Our study demonstrated that Trigonelline blocks Nrf2 activation and its nuclear translocation via inhibition of EGFR signalling pathway. It has improved responsiveness of NSCLC cells for Cisplatin and Etoposide and could be a promising choice for lung cancer therapy. Toxicol In Vitro. 2021 Feb;70:105038. doi: 10.1016/j.tiv.2020.105038.
Combination Pair ID: 61
Pair Name Luteolin, Paclitaxel
Phytochemical Luteolin
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result These findings suggest that luteolin treatment significantly attenuated the hallmarks of breast cancer stemness by downregulating Nrf2-mediated expressions. Luteolin constitutes a potential agent for use in cancer stemness-targeted breast cancer treatments.
Combination Pair ID: 626
Pair Name Luteolin, Oxaliplatin
Phytochemical Luteolin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Nuclear factor erythroid 2-related factor 2 Activity
Result Luteolin can induce p53-mediated apoptosis regardless of oxaliplatin treatment and may eliminate oxaliplatin-resistant p53-null colorectal cells
Combination Pair ID: 74
Pair Name Baicalein, Cisplatin
Phytochemical Baicalein
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Activity
Result Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway
Combination Pair ID: 154
Pair Name Triptolide, Doxorubicin
Phytochemical Triptolide
Drug Doxorubicin
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result The present study indicated that Nrf2 served a critical role in leukemia cell resistance to DOX and triptolide‑induced ferroptosis and suggested a potential strategy of combination therapy using triptolide and DOX in leukemia treatment.
Combination Pair ID: 177
Pair Name Brusatol, Cytarabine
Phytochemical Brusatol
Drug Cytarabine
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Inhibition of Nrf2-mediated glucose metabolism by brusatol synergistically sensitizes acute myeloid leukemia to Ara-C
Combination Pair ID: 251
Pair Name Bruceine D, Gemcitabine
Phytochemical Bruceine D
Drug Gemcitabine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Our experimental findings indicate that BD, a potent Nrf2 inhibitor, holds promise for further development into a novel adjuvant therapy for PDAC.
Combination Pair ID: 772
Pair Name Honokiol, Cabozantinib
Phytochemical Honokiol
Drug Cabozantinib
Disease Info [ICD-11: 2C90.0] Renal cell carcinoma Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Cabozantinib + Honokiol combination can significantly inhibit c-Met-induced and Nrf2-mediated anti-oxidant pathway in renal cancer cells to promote increased oxidative stress and tumor cell death.
Combination Pair ID: 807
Pair Name Polydatin, Brusatol
Phytochemical Polydatin
Drug Brusatol
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result We could significantly reduce tumor cell growth while avoiding toxic side effects, providing a treatment method with greater clinical application value for TNBC treatment.
Combination Pair ID: 483
Pair Name Tiliroside, Sorafenib
Phytochemical Tiliroside
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Our findings imply that tiliroside is a potent TBK1 inhibitor and a candidate natural anti-cancer product that could function as a sensitizer of sorafenib in HCC treatment by targeting TBK1 to induce ferroptosis.
Combination Pair ID: 491
Pair Name Wogonin, Cisplatin
Phytochemical Wogonin
Drug Cisplatin
Disease Info Head and neck cancer
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Wogonin induced selective cell death by targeting the antioxidant defense mechanisms enhanced in the resistant HNC cells and activating cell death pathways involving PUMA and PARP. Hence, wogonin significantly sensitized resistant HNC cells to cisplatin both in vitro and in vivo. Wogonin is a promising anticancer candidate that induces ROS accumulation and selective cytotoxicity in HNC cells and can help to overcome cisplatin-resistance in this cancer.
Combination Pair ID: 507
Pair Name Glucosinalbate, Doxorubicin
Phytochemical Glucosinalbate
Drug Doxorubicin
Disease Info [ICD-11: 2C90] Ehrlich ascites carcinoma Investigative
Regulate Info Up-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host.
Combination Pair ID: 513
Pair Name All-trans retinoic acid, Decitabine
Phytochemical All-trans-retinoic acid
Drug Decitabine
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result These results demonstrate that combining DAC and ATRA has potential for the clinical treatment of HR-MDS/AML and merits further exploration.
Combination Pair ID: 533
Pair Name Vitamin C, Erastin
Phytochemical Vitamin C
Drug Erastin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result The combination of erastin and vitamin C exerts a synergistic effect of classical and nonclassical modes to induce ferroptosis in PC cells, which may provide a promising therapeutic strategy for PC.
Combination Pair ID: 533
Pair Name Vitamin C, Erastin
Phytochemical Vitamin C
Drug Erastin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result The combination of erastin and vitamin C exerts a synergistic effect of classical and nonclassical modes to induce ferroptosis in PC cells, which may provide a promising therapeutic strategy for PC.
Combination Pair ID: 558
Pair Name Lycopene, Cisplatin
Phytochemical Lycopene
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Lycopene increases the sensitization of cervical cancer cells to cisplatin via inhibition of cell viability, up-regulation of Bax expression, and down-regulation of Bcl-2 expression. Furthermore, the anticancer effect of lycopene might be also associated with suppression of NF-κB-mediated inflammatory responses, and modulation of Nrf2-mediated oxidative stress. The results of the present study suggest that lycopene and concurrent cisplatin chemotherapy might have a role in improving the treatment of cervical cancer.
Combination Pair ID: 564
Pair Name Hederagenin, Cisplatin
Phytochemical Hederagenin
Drug Cisplatin
Disease Info Head and neck cancer
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Hederagenin effectively targets cisplatin-resistant HNC cells in vitro and in vivo. Consistent with its effects in other types of cancer, hederagenin markedly induces apoptosis in HNC cells by activating the mitochondria-driven intrinsic apoptotic pathway. We demonstrated that the apoptosis-inducing effects of hederagenin are mediated by the inhibition of the Nrf2-ARE antioxidant pathway.
Combination Pair ID: 584
Pair Name Dehydrobruceine B, Cisplatin
Phytochemical Dehydrobruceine B
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result These results generated a rationale for further investigation of DHB combined with CDDP as a potential therapeutic strategy in lung cancer.
Combination Pair ID: 959
Pair Name Periplocin, Gemcitabine
Phytochemical Periplocin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 979
Pair Name Quercetin, Fluorouracil
Phytochemical Quercetin
Drug Fluorouracil
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Our results suggest that Que reverses 5-FU resistance in CC cells via modulating the Nrf2/HO-1 pathway.
Combination Pair ID: 137
Pair Name Parthenolide, Doxorubicin
Phytochemical Parthenolide
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result PN prevented the acquisition of resistance induced by Mitox and DOX treatment in MDA-MB231 cells. This effect was mediated by inhibition of overexpression of both Nrf2 and its target activities. Therefore, within MDA-MB231 cell lines, PN not only exerts toxic effects on stem-like cells, which are responsible for tumour recurrence, but also prevents drug resistance
Combination Pair ID: 178
Pair Name Brusatol, Gemcitabine
Phytochemical Brusatol
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Our results suggest that brusatol is capable of enhancing the antitumour effects of gemcitabine in both pancreatic cancer cells and PANC-1 xenografts via suppressing the Nrf2 pathway.
Combination Pair ID: 682
Pair Name Ursolic acid, Cisplatin
Phytochemical Ursolic acid
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result The results confirmed the sensibilization of UA on HepG2/DDP cells to cisplatin, which was possibly mediated via the Nrf2/antioxidant response element pathway.
Combination Pair ID: 884
Pair Name Wogonin, Doxorubicin
Phytochemical Wogonin
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Wogonin reversed drug resistance and its reversal mechanism might be due to the suppression of Nrf2 signaling pathway, indicating the feasibility of using Nrf2 inhibitors to increase efficacy of chemotherapeutic drugs.
Combination Pair ID: 887
Pair Name Berberine, Lapatinib
Phytochemical Berberine
Drug Lapatinib
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result Berberine reverses Lapatinib resistance of HER2-positive breast cancer cells by increasing the level of ROS
Combination Pair ID: 917
Pair Name 2,3,5,6-Tetramethylpyrazine, Cisplatin
Phytochemical 2,3,5,6-Tetramethylpyrazine
Drug Cisplatin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Nuclear factor erythroid 2-related factor 2 Expression
Result A series of ligustrazine-derived chalcones-modified platinum(IV) complexes were synthesized and evaluated for their anti-proliferative potency and generated an optimal platinum(IV) complex 16a. The above-described results indicated that 16a obtained different anti-cancer mechanisms of CDDP, which could initiate mitochondria-dependent apoptosis and xCT-GPX4 axial-mediated ferroptosis in PANC-1/CDDP cells.
03. Reference
No. Title Href
1 Amygdalin potentiates the anti-cancer effect of Sorafenib on Ehrlich ascites carcinoma and ameliorates the associated liver damage. Sci Rep. 2022 Apr 20;12(1):6494. doi: 10.1038/s41598-022-10517-0. Click
2 Probable Mechanisms of Doxorubicin Antitumor Activity Enhancement by Ginsenoside Rh2. Molecules. 2022 Jan 19;27(3):628. doi: 10.3390/molecules27030628. Click
3 Mangiferin Ameliorates Cisplatin Induced Acute Kidney Injury by Upregulating Nrf-2 via the Activation of PI3K and Exhibits Synergistic Anticancer Activity With Cisplatin. Front Pharmacol. 2018 Jun 18;9:638. doi: 10.3389/fphar.2018.00638. Click
4 Synergy between sulforaphane and selenium in protection against oxidative damage in colonic CCD841 cells. Nutr Res. 2015 Jul;35(7):610-7. doi: 10.1016/j.nutres.2015.05.011. Click
5 Camptothecin Sensitizes Hepatocellular Carcinoma Cells to Sorafenib- Induced Ferroptosis Via Suppression of Nrf2. Inflammation. 2023 Aug;46(4):1493-1511. doi: 10.1007/s10753-023-01823-4. Click
6 Trigonelline inhibits Nrf2 via EGFR signalling pathway and augments efficacy of Cisplatin and Etoposide in NSCLC cells. Toxicol In Vitro. 2021 Feb;70:105038. doi: 10.1016/j.tiv.2020.105038. Click
7 Luteolin Inhibits Breast Cancer Stemness and Enhances Chemosensitivity through the Nrf2-Mediated Pathway. Molecules. 2021 Oct 26;26(21):6452. doi: 10.3390/molecules26216452. Click
8 Luteolin Shifts Oxaliplatin-Induced Cell Cycle Arrest at G₀/G₁ to Apoptosis in HCT116 Human Colorectal Carcinoma Cells. Nutrients. 2019 Apr 2;11(4):770. doi: 10.3390/nu11040770. Click
9 Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway. Biochem Biophys Res Commun. 2020 Oct 20;531(3):320-327. doi: 10.1016/j.bbrc.2020.07.045. Click
10 Triptolide promotes ferroptosis by suppressing Nrf2 to overcome leukemia cell resistance to doxorubicin. Mol Med Rep. 2023 Jan;27(1):17. doi: 10.3892/mmr.2022.12904. Click
11 Inhibition of Nrf2-mediated glucose metabolism by brusatol synergistically sensitizes acute myeloid leukemia to Ara-C. Biomed Pharmacother. 2021 Oct;142:111652. doi: 10.1016/j.biopha.2021.111652. Click
12 Brucein D augments the chemosensitivity of gemcitabine in pancreatic cancer via inhibiting the Nrf2 pathway. J Exp Clin Cancer Res. 2022 Mar 10;41(1):90. doi: 10.1186/s13046-022-02270-z. Click
13 A novel combination therapy with Cabozantinib and Honokiol effectively inhibits c-Met-Nrf2-induced renal tumor growth through increased oxidative stress. Redox Biol. 2023 Dec;68:102945. doi: 10.1016/j.redox.2023.102945. Click
14 Natural Compounds, Optimal Combination of Brusatol and Polydatin Promote Anti-Tumor Effect in Breast Cancer by Targeting Nrf2 Signaling Pathway. Int J Mol Sci. 2023 May 5;24(9):8265. doi: 10.3390/ijms24098265. Click
15 Tiliroside targets TBK1 to induce ferroptosis and sensitize hepatocellular carcinoma to sorafenib. Phytomedicine. 2023 Mar;111:154668. doi: 10.1016/j.phymed.2023.154668. Click
16 Targeting Nrf2 with wogonin overcomes cisplatin resistance in head and neck cancer. Apoptosis. 2016;21(11):1265-1278. doi:10.1007/s10495-016-1284-8 Click
17 Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. Click
18 All-trans retinoic acid enhances the cytotoxic effect of decitabine on myelodysplastic syndromes and acute myeloid leukaemia by activating the RARα-Nrf2 complex. Br J Cancer. 2023 Feb;128(4):691-701. doi: 10.1038/s41416-022-02074-0. Click
19 Vitamin C Sensitizes Pancreatic Cancer Cells to Erastin-Induced Ferroptosis by Activating the AMPK/Nrf2/HMOX1 Pathway. Oxid Med Cell Longev. 2022 Jul 19;2022:5361241. doi: 10.1155/2022/5361241. Click
20 Vitamin C Sensitizes Pancreatic Cancer Cells to Erastin-Induced Ferroptosis by Activating the AMPK/Nrf2/HMOX1 Pathway. Oxid Med Cell Longev. 2022 Jul 19;2022:5361241. doi: 10.1155/2022/5361241. Click
21 Lycopene sensitizes the cervical cancer cells to cisplatin via targeting nuclear factor- kappa B (NF-κB) pathway. Turk J Med Sci. 2021 Feb 26;51(1):368-374. doi: 10.3906/sag-2005-413. Click
22 Hederagenin Induces Apoptosis in Cisplatin-Resistant Head and Neck Cancer Cells by Inhibiting the Nrf2-ARE Antioxidant Pathway. Oxid Med Cell Longev. 2017;2017:5498908. doi:10.1155/2017/5498908 Click
23 Dehydrobruceine B enhances the cisplatin-induced cytotoxicity through regulation of the mitochondrial apoptotic pathway in lung cancer A549 cells. Biomed Pharmacother. 2017 May;89:623-631. doi: 10.1016/j.biopha.2017.02.055. Click
24 Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells. Biomed Pharmacother. 2023 Jan;157:114039. doi: 10.1016/j.biopha.2022.114039. Click
25 Quercetin reverses 5-fluorouracil resistance in colon cancer cells by modulating the NRF2/HO-1 pathway. Eur J Histochem. 2023 Aug 7;67(3):3719. doi: 10.4081/ejh.2023.3719. Click
26 Parthenolide prevents resistance of MDA-MB231 cells to doxorubicin and mitoxantrone: the role of Nrf2. Cell Death Discov. 2017;3:17078. Published 2017 Dec 4. doi:10.1038/cddiscovery.2017.78 Click
27 Brusatol Enhances the Chemotherapy Efficacy of Gemcitabine in Pancreatic Cancer via the Nrf2 Signalling PathwayBrusatol Enhances the Chemotherapy Efficacy of Gemcitabine in Pancreatic Cancer via the Nrf2 Signalling Pathway. Oxid Med Cell Longev. 2018 Apr 18;2018:2360427. doi: 10.1155/2018/2360427. Click
28 Ursolic acid sensitizes cisplatin-resistant HepG2/DDP cells to cisplatin via inhibiting Nrf2/ARE pathway. Drug Des Devel Ther. 2016 Oct 25;10:3471-3481. doi: 10.2147/DDDT.S110505. Click
29 Drug resistance associates with activation of Nrf2 in MCF-7/DOX cells, and wogonin reverses it by down-regulating Nrf2-mediated cellular defense response. Mol Carcinog. 2013;52(10):824-834. doi:10.1002/mc.21921 Click
30 Berberine reverses Lapatinib resistance of HER2-positive breast cancer cells by increasing the level of ROS. Cancer Biol Ther. 2016;17(9):925-934. doi:10.1080/15384047.2016.1210728 Click
31 Ligustrazine-Derived Chalcones-Modified Platinum(IV) Complexes Intervene in Cisplatin Resistance in Pancreatic Cancer through Ferroptosis and Apoptosis. J Med Chem. 2023 Oct 12;66(19):13587-13606. doi: 10.1021/acs.jmedchem.3c00922. Click
It has been 583322 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP