Name | Cytochrome c oxidase subunit 2 | ||
UniProt ID | COX2_HUMAN | ||
Gene Name | COX2 | ||
Gene ID | 4513 | ||
Synonyms |
COX2, COII, MTCO2, MT-CO2
|
||
Sequence |
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQE
METVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNS YMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLN QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL |
||
Pathway Map | MAP LINK | ||
T.C. Number | 3.D.4.11.1 | ||
KEGG ID | hsa4513 | ||
Pfam | PF00116; PF02790; PF06126; PF08058; PF08285; PF11299 |
Pair Name | Chlorogenic acid, Methotrexate | |||
Phytochemical Name | Chlorogenic acid | |||
Anticancer drug Name | Methotrexate | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | These results imply that CGA has perfective effect against MTX-induced liver injury. Hence CGA supplementation might be helpful in abrogation of MTX toxicity. |
Pair Name | Chrysin, Paclitaxel | |||
Phytochemical Name | Chrysin | |||
Anticancer drug Name | Paclitaxel | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | CR exhibited the ability to reduce oxidative DNA damage, exert anti-apoptotic and anti-inflammatory properties, and mitigate the toxic effects of Pax-induced hepatorenal toxicity. |
Pair Name | Baicalin, Fluorouracil | |||
Phytochemical | Baicalin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | Baicalin inhibits GC and enhances 5-Fu by promoting ROS-related ferroptosis in GC. |
Pair Name | Crocin, Sorafenib | |||
Phytochemical | Crocin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | CR potentiates the suppressive effects of SB on tumor growth and provides the opportunity to strengthen the therapeutic effects of SB in the treatment of HCC. |
Pair Name | Curcumin, Nimustine | |||
Phytochemical | Curcumin | |||
Drug | Nimustine | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | Curcumin potentiates the potent antitumor activity of ACNU against glioblastoma by suppressing the PI3K/AKT and NF-kappaB/COX-2 signaling pathways |
Pair Name | Dihydroberberine, Sunitinib | |||
Phytochemical | Dihydroberberine | |||
Drug | Sunitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | DCS induced the expression of cell cycle signal molecules that are known to be affected by JNK and p38. The change of cell cycle, in turn, led to down-regulation of JNK and p38, and further reduced IL-1 secretion. Collectively, these findings highlight potential molecular mechanisms of DCS chemotherapeutic activity and suggest that DCS is an efficacious strategy in NSCLC therapy. |
Pair Name | Eugenol, Gemcitabine | |||
Phytochemical | Eugenol | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | The results suggest that eugenol exerts its anticancer activities via apoptosis induction and anti-inflammatory properties and also provide the first evidence demonstrating synergism between eugenol and gemcitabine, which may enhance The therapeutic index of prevention and/or treatment of cervical cancer. |
Pair Name | Gamma-Tocotrienol, Capecitabine | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Capecitabine | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | Our results show that γ-tocotrienol can potentiate the effects of capecitabine through suppression of NF-κB-regulated markers of proliferation, invasion, angiogenesis, and metastasis. |
Pair Name | Gamma-Tocotrienol, Gemcitabine | |||
Phytochemical | Gamma-Tocotrienol | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | Our findings suggest that γ-T3 can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing NF-κB-mediated inflammatory pathways linked to tumorigenesis. |
Pair Name | Harmine, Paclitaxel | |||
Phytochemical | Harmine | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer |
Pair Name | Oroxylin A, Fluorouracil | |||
Phytochemical | Oroxylin A | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | The anti-hepatocellular carcinoma effects in vitro and in vivo of 5-FU and oroxylin A combinations were synergistic and oroxylin A increased the sensitivity of HepG2 cells to 5-FU by modulating the metabolic enzymes of 5-FU and apoptotic-related proteins |
Pair Name | Oxymatrine, Paclitaxel | |||
Phytochemical | Oxymatrine | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model |
Pair Name | Plumbagin, Celecoxib | |||
Phytochemical | Plumbagin | |||
Drug | Celecoxib | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | Combination of Celecoxib and Plumbagin decreased melanoma cell proliferation and retarded vascular development of tumors mediated by inhibition of COX-2 and STAT3 leading to decreased levels of key cyclins key on which melanoma cell were dependent for survival. |
Pair Name | Resveratrol, Celecoxib | |||
Phytochemical | Resveratrol | |||
Drug | Celecoxib | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | This study showed that in NMU-induced mammary cancer in rats, the combination of resveratrol and celecoxib led to a significant reduction in all tumor parameters. In addition, in terms of tumor volume, the combination was more efficient than celecoxib as a single agent. |
Pair Name | Salvianolic acid B, Celecoxib | |||
Phytochemical | Salvianolic acid B | |||
Drug | Celecoxib | |||
Disease Info | [ICD-11: 2C31.Z] | Head and neck squamous cell carcinoma | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | These results strongly suggest that combination of Sal-B, a multifunctional anticancer agent, with low-dose celecoxib holds potential as a new preventive strategy in targeting inflammatory-associated tumor development. |
Pair Name | Shikonin, Gemcitabine | |||
Phytochemical | Shikonin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | Our results suggest that shikonin can suppress the growth of human pancreatic tumors and potentiate the antitumor effects of gemcitabine through the suppression of NF-κB and NF-κB-regulated gene products. |
Pair Name | Shogaol, Gemcitabine | |||
Phytochemical | Shogaol | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10.0] | Pancreatic ductal adenocarcinoma | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | Our results suggest that 6-shogaol can inhibit the growth of human pancreatic tumors and sensitize them to gemcitabine by suppressing of TLR4/NF-κB-mediated inflammatory pathways linked to tumorigenesis. |
Pair Name | Tectorigenin, Paclitaxel | |||
Phytochemical | Tectorigenin | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | These data suggest that tectorigenin could sensitize paclitaxel-resistant human ovarian cancer cells through inactivation of the Akt/IKK/IκB/NFκB signaling pathway, and promise a new intervention to chemosensitize paclitaxel-induced cytotoxicity in ovarian cancer. |
Pair Name | Thymoquinone, Fluorouracil | |||
Phytochemical | Thymoquinone | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | Our findings present the first report describing the in vivo enhancement effect of combined TQ and 5-FU against early stages of CRC; however, further studies are required to determine the value of this combination therapy in an advanced long-term model of CRC and also to realize its clinical potential. |
Pair Name | Zerumbone, Nimesulide | |||
Phytochemical | Zerumbone | |||
Drug | Nimesulide | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Cytochrome c oxidase subunit 2 | Expression | |
Result | Our results suggest that ZER is a novel food factor for mitigating experimental UC and that use of a combination of agents, with different modes of actions, may be an effective anti-inflammatory strategy. |
No. | Title | Href |
---|---|---|
1 | Protective effect of Chlorogenic acid against methotrexate induced oxidative stress, inflammation and apoptosis in rat liver: An experimental approach. Chem Biol Interact. 2017 Jun 25;272:80-91. doi: 10.1016/j.cbi.2017.05.002. | Click |
2 | Chrysin attenuates paclitaxel-induced hepatorenal toxicity in rats by suppressing oxidative damage, inflammation, and apoptosis. Life Sci. 2023 Nov 1;332:122096. doi: 10.1016/j.lfs.2023.122096. | Click |
3 | Baicalin enhances the efficacy of 5-Fluorouracil in gastric cancer by promoting ROS-mediated ferroptosis. Biomed Pharmacother. 2023 Aug;164:114986. doi: 10.1016/j.biopha.2023.114986. | Click |
4 | Combining Crocin and Sorafenib Improves Their Tumor-Inhibiting Effects in a Rat Model of Diethylnitrosamine-Induced Cirrhotic-Hepatocellular Carcinoma. Cancers (Basel). 2023 Aug 11;15(16):4063. doi: 10.3390/cancers15164063. | Click |
5 | Curcumin Potentiates the Potent Antitumor Activity of ACNU Against Glioblastoma by Suppressing the PI3K/AKT and NF-κB/COX-2 Signaling Pathways [Retraction]. Onco Targets Ther. 2022 Dec 2;15:1479-1480. doi: 10.2147/OTT.S399704. | Click |
6 | Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178. | Click |
7 | Eugenol enhances the chemotherapeutic potential of gemcitabine and induces anticarcinogenic and anti-inflammatory activity in human cervical cancer cells. Cancer Biother Radiopharm. 2011 Oct;26(5):519-27. doi: 10.1089/cbr.2010.0925. | Click |
8 | First evidence that γ-tocotrienol inhibits the growth of human gastric cancer and chemosensitizes it to capecitabine in a xenograft mouse model through the modulation of NF-κB pathway. Clin Cancer Res. 2012 Apr 15;18(8):2220-9. doi: 10.1158/1078-0432.CCR-11-2470. | Click |
9 | {Gamma}-tocotrienol inhibits pancreatic tumors and sensitizes them to gemcitabine treatment by modulating the inflammatory microenvironment. Cancer Res. 2010 Nov 1;70(21):8695-705. doi: 10.1158/0008-5472.CAN-10-2318. Epub 2010 Sep 23. | Click |
10 | Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer. Oncol Lett. 2016 Aug;12(2):983-988. doi: 10.3892/ol.2016.4696. | Click |
11 | Synergistic effect of 5-fluorouracil and the flavanoid oroxylin A on HepG2 human hepatocellular carcinoma and on H22 transplanted mice. Cancer Chemother Pharmacol. 2010 Feb;65(3):481-9. doi: 10.1007/s00280-009-1053-2. | Click |
12 | Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model. Cancers (Basel). 2019 Jan 7;11(1):49. doi: 10.3390/cancers11010049. | Click |
13 | Synergistic inhibitory effects of Celecoxib and Plumbagin on melanoma tumor growth. Cancer Lett. 2017 Jan 28;385:243-250. doi: 10.1016/j.canlet.2016.10.016. | Click |
14 | Resveratrol enhances the chemopreventive effect of celecoxib in chemically induced breast cancer in rats. Eur J Cancer Prev. 2014 Nov;23(6):506-13. doi: 10.1097/CEJ.0000000000000083. | Click |
15 | Combination effects of salvianolic acid B with low-dose celecoxib on inhibition of head and neck squamous cell carcinoma growth in vitro and in vivo. Cancer Prev Res (Phila). 2010 Jun;3(6):787-96. doi: 10.1158/1940-6207.CAPR-09-0243. | Click |
16 | Shikonin suppresses tumor growth and synergizes with gemcitabine in a pancreatic cancer xenograft model: Involvement of NF-κB signaling pathway. Biochem Pharmacol. 2014 Apr 1;88(3):322-33. doi: 10.1016/j.bcp.2014.01.041. | Click |
17 | Antitumor activity of gemcitabine can be potentiated in pancreatic cancer through modulation of TLR4/NF-κB signaling by 6-shogaol. AAPS J. 2014 Mar;16(2):246-57. doi: 10.1208/s12248-013-9558-3. | Click |
18 | Tectorigenin sensitizes paclitaxel-resistant human ovarian cancer cells through downregulation of the Akt and NFκB pathway. Carcinogenesis. 2012 Dec;33(12):2488-98. doi: 10.1093/carcin/bgs302. | Click |
19 | Thymoquinone subdues tumor growth and potentiates the chemopreventive effect of 5-fluorouracil on the early stages of colorectal carcinogenesis in rats. Drug Des Devel Ther. 2016 Jul 11;10:2239-53. doi: 10.2147/DDDT.S109721. | Click |
20 | Suppression of dextran sodium sulfate-induced colitis in mice by zerumbone, a subtropical ginger sesquiterpene, and nimesulide: separately and in combination. Biochem Pharmacol. 2003 Oct 1;66(7):1253-61. doi: 10.1016/s0006-2952(03)00446-5. | Click |