TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Cyclin-dependent kinase 1
UniProt ID CDK1_HUMAN
Gene Name CDK1
Gene ID 983
Synonyms
CDK1, CDC2, CDC28A, P34CDC2
Sequence
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Pathway Map MAP LINK
T.C. Number 1.I.1.1.3
KEGG ID hsa983
TTD ID T49898
Pfam PF00069; PF01633; PF01636; PF03109; PF06293; PF07387; PF07714; PF12330; PF14531
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 272
Pair Name Deoxyelephantopin, Cisplatin
Phytochemical Name Deoxyelephantopin
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result The CP and DET combination may be an effective intervention for melanoma with reduced side effects.
Combination Pair ID: 484
Pair Name 10-Gingerol, Doxorubicin
Phytochemical Name 10-Gingerol
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result Our data indicate that [10]-gingerol has potential to be used as a neoadjuvant or in combined therapy with doxorubicin, to improve its anticancer activity.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 12
Pair Name Piperlongumine, Sorafenib
Phytochemical Piperlongumine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result Piperlongumine synergistically enhances the antitumour activity of sorafenib by mediating ROS-AMPK activation and targeting CPSF7 in liver cancer
Combination Pair ID: 31
Pair Name Berbamine, Arcyriaflavin A
Phytochemical Berbamine
Drug Arcyriaflavin A
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells.
Combination Pair ID: 47
Pair Name Dihydroberberine, Sunitinib
Phytochemical Dihydroberberine
Drug Sunitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Cyclin-dependent kinase 1 Expression
Result DCS induced the expression of cell cycle signal molecules that are known to be affected by JNK and p38. The change of cell cycle, in turn, led to down-regulation of JNK and p38, and further reduced IL-1 secretion. Collectively, these findings highlight potential molecular mechanisms of DCS chemotherapeutic activity and suggest that DCS is an efficacious strategy in NSCLC therapy.
Combination Pair ID: 64
Pair Name Luteolin, Oxaliplatin
Phytochemical Luteolin
Drug Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis
Combination Pair ID: 990
Pair Name Baicalein, Doxorubicin
Phytochemical Baicalein
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result Baicalein sensitizes triple negative breast cancer MDA-MB-231 cells to doxorubicin via autophagy-mediated down-regulation of CDK1
Combination Pair ID: 100
Pair Name Silibinin, Paclitaxel
Phytochemical Silibinin
Drug Paclitaxel
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines
Combination Pair ID: 129
Pair Name Licochalcone B, TNF-related apoptosis inducing ligand
Phytochemical Licochalcone B
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Phosphorylation
Result LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC.
Combination Pair ID: 129
Pair Name Licochalcone B, TNF-related apoptosis inducing ligand
Phytochemical Licochalcone B
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC.
Combination Pair ID: 134
Pair Name Flavokawain A, Herceptin
Phytochemical Flavokawain A
Drug Herceptin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Phosphorylation
Result Our results suggest FKA as a promising and novel apoptosis inducer and G2 blocking agent that, in combination with Herceptin, enhances for the treatment of HER2-overexpressing breast cancer.
Combination Pair ID: 141
Pair Name Silibinin, Doxorubicin
Phytochemical Silibinin
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Activity
Result Inhibitory effects of Silibinin combined with doxorubicin in hepatocellular carcinoma; an in vivo study
Combination Pair ID: 213
Pair Name Betulinic acid, Imatinib
Phytochemical Betulinic acid
Drug Imatinib
Disease Info [ICD-11: 2B33.2] Chronic myeloid leukemia Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result Our findings demonstrated that HDAC3 is an essential factor in BCR-ABL1 kinase-independent IM resistance, and that BA in combination with IM may be a novel treatment strategy for overcoming IM resistance in CML.
Combination Pair ID: 232
Pair Name AKBA, Cisplatin
Phytochemical AKBA
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Phosphorylation
Result Acetyl-11-keto-beta-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway
Combination Pair ID: 375
Pair Name Resveratrol, Cisplatin
Phytochemical Resveratrol
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Cyclin-dependent kinase 1 Phosphorylation
Result These results indicated that RES is a promising adjuvant for DDP during GC chemotherapy.
Combination Pair ID: 435
Pair Name Garcinol, Paclitaxel
Phytochemical Garcinol
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model
Combination Pair ID: 547
Pair Name Sulforaphane, Cisplatin
Phytochemical Sulforaphane
Drug Cisplatin
Disease Info [ICD-11: 2C28] Malignant mesothelioma Investigative
Regulate Info Up-regulation Cyclin-dependent kinase 1 Phosphorylation
Result Pro-oxidant activity of sulforaphane and cisplatin potentiates apoptosis and simultaneously promotes autophagy in malignant mesothelioma cells
Combination Pair ID: 549
Pair Name Sulforaphane, Everolimus
Phytochemical Sulforaphane
Drug Everolimus
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Up-regulation Cyclin-dependent kinase 1 Phosphorylation
Result The addition of SFN to the long-term everolimus application inhibits resistance development in bladder cancer cells in vitro. Therefore, sulforaphane may hold potential for treating bladder carcinoma in patients with resistance to an mTOR inhibitor.
Combination Pair ID: 904
Pair Name Sulforaphane, TNF-related apoptosis inducing ligand
Phytochemical Sulforaphane
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result The ability of sulforaphane to inhibit tumor growth, metastasis, and angiogenesis and to enhance the therapeutic potential of TRAIL suggests that sulforaphane alone or in combination with TRAIL can be used for the management of prostate cancer.
Combination Pair ID: 947
Pair Name Phenethyl isothiocyanate, Dasatinib
Phytochemical Phenethyl isothiocyanate
Drug Dasatinib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result PEITC showed to enhance dasatinib action in treating HCC with increased production of ROS that induced cell cycle arrest followed by mitotic catastrophe, and to induce oxeiptosis. These results highlight the role that ITCs may have in cancer therapy as a complement of clinically approved chemotherapeutic drugs
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 17
Pair Name Raloxifene hydrochloride, Paclitaxel
Phytochemical Raloxifene hydrochloride
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Cyclin-dependent kinase 1 Phosphorylation
Result Reversal effects of Raloxifene on paclitaxel resistance in 2 MDR breast cancer cells
Combination Pair ID: 105
Pair Name Chrysin, Fluorouracil
Phytochemical Chrysin
Drug Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result Potentiating activities of chrysin in the therapeutic efficacy of 5-fluorouracil in gastric cancer cells
Combination Pair ID: 110
Pair Name Norizalpinin, Imatinib
Phytochemical Norizalpinin
Drug Imatinib
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Down-regulation Cyclin-dependent kinase 1 Expression
Result Galangin increases the cytotoxic activity of imatinib mesylate in imatinib-sensitive and imatinib-resistant Bcr-Abl expressing leukemia cells
03. Reference
No. Title Href
1 Phyto-sesquiterpene lactone deoxyelephantopin and cisplatin synergistically suppress lung metastasis of B16 melanoma in mice with reduced nephrotoxicity. Phytomedicine. 2019 Mar 15;56:194-206. doi: 10.1016/j.phymed.2018.11.005. Click
2 [10]-Gingerol improves doxorubicin anticancer activity and decreases its side effects in triple negative breast cancer models. Cell Oncol (Dordr). 2020 Oct;43(5):915-929. doi: 10.1007/s13402-020-00539-z. Click
3 Piperlongumine synergistically enhances the antitumour activity of sorafenib by mediating ROS-AMPK activation and targeting CPSF7 in liver cancer. Pharmacol Res. 2022 Mar;177:106140. doi: 10.1016/j.phrs.2022.106140. Click
4 Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. Click
5 Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178. Click
6 Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis. Oncol Lett. 2022 Jan;23(1):16. doi: 10.3892/ol.2021.13134. Click
7 Baicalein sensitizes triple negative breast cancer MDA-MB-231 cells to doxorubicin via autophagy-mediated down-regulation of CDK1. Mol Cell Biochem. 2023 Jul;478(7):1519-1531. doi: 10.1007/s11010-022-04597-9. Click
8 Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines. Mol Med Rep. 2018 Aug;18(2):1835-1841. doi: 10.3892/mmr.2018.9129. Click
9 Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. Click
10 Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. Click
11 Induction of G2M Arrest by Flavokawain A, a Kava Chalcone, Increases the Responsiveness of HER2-Overexpressing Breast Cancer Cells to Herceptin. Molecules. 2017 Mar 14;22(3):462. doi: 10.3390/molecules22030462. Click
12 Inhibitory effects of Silibinin combined with doxorubicin in hepatocellular carcinoma; an in vivo study. J BUON. 2016 Jul-Aug;21(4):917-924. Click
13 Betulinic acid restores imatinib sensitivity in BCR-ABL1 kinase-independent, imatinib-resistant chronic myeloid leukemia by increasing HDAC3 ubiquitination and degradation. Ann N Y Acad Sci. 2020 May;1467(1):77-93. doi: 10.1111/nyas.14298. Click
14 Acetyl-11-keto-β-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway. Cell Biol Toxicol. 2021 Apr;37(2):209-228. doi: 10.1007/s10565-020-09541-5. Click
15 Resveratrol synergizes with cisplatin in antineoplastic effects against AGS gastric cancer cells by inducing endoplasmic reticulum stress‑mediated apoptosis and G2/M phase arrest. Oncol Rep. 2020 Oct;44(4):1605-1615. doi: 10.3892/or.2020.7708. Click
16 Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. Click
17 Pro-oxidant activity of sulforaphane and cisplatin potentiates apoptosis and simultaneously promotes autophagy in malignant mesothelioma cells. Mol Med Rep. 2017 Aug;16(2):2133-2141. doi: 10.3892/mmr.2017.6789. Click
18 Chronic Sulforaphane Administration Inhibits Resistance to the mTOR-Inhibitor Everolimus in Bladder Cancer Cells. Int J Mol Sci. 2020 Jun 4;21(11):4026. doi: 10.3390/ijms21114026. Click
19 Sulforaphane enhances the therapeutic potential of TRAIL in prostate cancer orthotopic model through regulation of apoptosis, metastasis, and angiogenesis. Clin Cancer Res. 2008 Nov 1;14(21):6855-66. doi: 10.1158/1078-0432.CCR-08-0903. Click
20 Phenethyl isothiocyanate and dasatinib combination synergistically reduces hepatocellular carcinoma growth via cell cycle arrest and oxeiptosis. Front Pharmacol. 2023 Oct 4;14:1264032. doi: 10.3389/fphar.2023.1264032. Click
21 Reversal effects of Raloxifene on paclitaxel resistance in 2 MDR breast cancer cells. Cancer Biol Ther. 2015;16(12):1794-801. doi: 10.1080/15384047.2015.1095409. Click
22 Potentiating activities of chrysin in the therapeutic efficacy of 5-fluorouracil in gastric cancer cells. Oncol Lett. 2021 Jan;21(1):24. doi: 10.3892/ol.2020.12285. Click
23 Galangin increases the cytotoxic activity of imatinib mesylate in imatinib-sensitive and imatinib-resistant Bcr-Abl expressing leukemia cells. Cancer Lett. 2008 Jul 8;265(2):289-97. doi: 10.1016/j.canlet.2008.02.025. Click
It has been 223000 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP