TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name BH3-interacting domain death agonist
UniProt ID BID_HUMAN
Gene Name BID
Gene ID 637
Synonyms
BID, FP497
Sequence
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTD
GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSE
EDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQ
NLRTYVRSLARNGMD
Pathway Map MAP LINK
KEGG ID hsa637
Pfam PF00452; PF06393; PF08767; PF15397
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 508
Pair Name Mahanine, Cisplatin
Phytochemical Name Mahanine
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Down-regulation BH3-interacting domain death agonist Cleavage
Result Our results revealed that mahanine may be a prospective agent to reduce the concentration of cisplatin in adjunct for the treatment of cancer and thereby decreasing its toxicity.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 5
Pair Name Homoharringtonine, Suberoylanilide hydroxamic acid (SAHA)
Phytochemical Homoharringtonine
Drug Suberoylanilide hydroxamic acid (SAHA)
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation BH3-interacting domain death agonist Expression
Result The synergistic effect between HHT and SAHA was blocked partially using a specific anti‑TRAIL antibody. The combination therapy was also found to significantly inhibit the growth of leukemia xenografts in vivo with enhanced apoptosis. These results indicate that, by regulating the induction of TRAIL and activation of the TRAIL apoptotic pathway, it is possible to administer HHT at low concentrations in combination with SAHA as an effective therapeutic approach for the treatment of AML.
Combination Pair ID: 16
Pair Name Tetrandrine, Sorafenib
Phytochemical Tetrandrine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation BH3-interacting domain death agonist Expression
Result The antitumour activity of sorafenib plus tetrandrine may be attributed to the induction of the intrinsic apoptosis pathway through ROS/Akt signaling. This finding provides a novel approach that may broaden the clinical application of sorafenib.
Combination Pair ID: 991
Pair Name Nobiletin, Vorinostat
Phytochemical Nobiletin
Drug Vorinostat
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Expression
Result The combination of nobiletin with vorinostat increased histone H3K9 and H3K27 acetylation levels in SCLC mouse tumor tissue and enhanced the expression of the BH3-only proteins BIM and BID. We conclude that nobiletin is a novel natural BH3 mimetic that can cooperate with vorinostat to induce apoptosis and autophagy in SCLC.
Combination Pair ID: 645
Pair Name Tangeretin, Fluorouracil
Phytochemical Tangeretin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation BH3-interacting domain death agonist Expression
Result To our knowledge gained from literature, this study is the first to describe synergistic activity of TAN and 5-FU against colorectal cancer cells.
Combination Pair ID: 657
Pair Name Norizalpinin, Cisplatin
Phytochemical Norizalpinin
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Expression
Result Our data indicated a novel therapeutic strategy to potentiate DDP-induced anti-tumor effect in lung cancer cells with DDP resistance by GG through inactivating p-STAT3/p65 and Bcl-2 pathways.
Combination Pair ID: 119
Pair Name Morin Hydrate, Cisplatin
Phytochemical Morin Hydrate
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Expression
Result Our findings indicate that CP-Mh in combination served as a prominent regulator of autophagy and significant inducer of apoptosis that maintains a homeostatic balance towards HepG2 cells and the subcutaneous tumor model.
Combination Pair ID: 138
Pair Name Neobavaisoflavone, TNF-related apoptosis inducing ligand
Phytochemical Neobavaisoflavone
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Cleavage
Result Taken together, our results suggest that NBIF reduces the resistance of cancer cells to TRAIL and that the combination of NBIF and TRAIL may be a new therapeutic strategy for treating TRAIL-resistant glioma cells.
Combination Pair ID: 157
Pair Name Triptolide, ABT-199
Phytochemical Triptolide
Drug ABT-199
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Expression
Result These findings suggest that the regimen combining TPL and ABT-199 might be active against AML by inducing robust apoptosis through reciprocal regulation of anti- and proapoptotic Bcl-2 family proteins, therefore providing a strong rationale for the clinical investigation of this combination regimen for the treatment of AML.
Combination Pair ID: 1021
Pair Name Betulin, Arsenic oxide (As2O3)
Phytochemical Betulin
Drug Arsenic oxide (As2O3)
Disease Info [ICD-11: 2D11.Y] Neuroblastoma Investigative
Regulate Info Down-regulation BH3-interacting domain death agonist Expression
Result The novel combination of As2O3 plus betulin has the potential to serve as a practical anti-neuroblastoma drug.
Combination Pair ID: 250
Pair Name Ginsenoside Rg5, Paclitaxel
Phytochemical Ginsenoside Rg5
Drug Paclitaxel
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Expression
Result Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel
Combination Pair ID: 716
Pair Name Nimbolide, Tumor necrosis factor-alpha
Phytochemical Nimbolide
Drug Tumor necrosis factor-alpha
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation BH3-interacting domain death agonist Expression
Result Our findings overall indicate that nimbolide may enhance TNF-α-mediated cellular proliferation inhibition through increasing cell apoptosis of HT-29 cells by up-reglation of DR5 expression via the JNK pathway.
Combination Pair ID: 284
Pair Name Shikonin, 4-hydroxytamoxifen
Phytochemical Shikonin
Drug 4-hydroxytamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation BH3-interacting domain death agonist Expression
Result The combination of SK and 4-OHT shows highly efficient anticancer effects on breast cancer therapy. SK may be a promising candidate as an adjuvant to 4-OHT for breast cancer treatments, especially for ER- breast cancer.
Combination Pair ID: 724
Pair Name Shikonin, TNF-related apoptosis inducing ligand
Phytochemical Shikonin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Expression
Result The results indicated that shikonin sensitized resistant cancer cells to TRAIL-induced cytotoxicity via the modulation of the JNK, STAT3 and AKT pathways, the downregulation of antiapoptotic proteins and the upregulation of proapoptotic proteins.
Combination Pair ID: 729
Pair Name Emodin, Cytarabine
Phytochemical Emodin
Drug Cytarabine
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation BH3-interacting domain death agonist Expression
Result Emodin and its combination with Ara-C may be considered a promising therapeutic approach in AML and worthy of further investigation.
Combination Pair ID: 327
Pair Name Caffeic acid, Paclitaxel
Phytochemical Caffeic acid
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Expression
Result Our results indicated that CA inhibited NSCLC H1299 cell growth by inducing apoptosis and CA and PTX combined produced a synergistic anti-cancer effect in H1299 cells.
Combination Pair ID: 791
Pair Name Bufalin, Doxorubicin
Phytochemical Bufalin
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Expression
Result These results suggested that the combination of cinobufacini and doxorubicin may provide a new strategy for inhibiting the proliferation of HCC cells.
Combination Pair ID: 798
Pair Name Piceatannol, Gemcitabine
Phytochemical Piceatannol
Drug Gemcitabine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Expression
Result The findings from this study show that piceatannol can enhance the cytotoxic effects of gemcitabine by enhancing expression of the proapoptotic protein Bak, thereby providing the rational basis for a novel combination strategy for the treatment of NSCLC.
Combination Pair ID: 831
Pair Name Capsaicin, 3,3'-diindolylmethane
Phytochemical Capsaicin
Drug 3,3'-diindolylmethane
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Expression
Result The present study suggests capsaicin and DIM work synergistically to inhibit cell proliferation and induce apoptosis in colorectal cancer through modulating transcriptional activity of NF-κB, p53, and target genes associated with apoptosis.
Combination Pair ID: 881
Pair Name Gambogic Acid, TNF-related apoptosis inducing ligand
Phytochemical Gambogic Acid
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation BH3-interacting domain death agonist Expression
Result These findings may open a new window in the treatment of breast cancer using TRAIL in combination with GA.
Combination Pair ID: 497
Pair Name Medicarpin, TNF-related apoptosis inducing ligand
Phytochemical Medicarpin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B33.1] Myeloid leukemia Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Expression
Result Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway
Combination Pair ID: 957
Pair Name Noscapine, Gemcitabine
Phytochemical Noscapine
Drug Gemcitabine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation BH3-interacting domain death agonist Expression
Result Nos potentiated the anticancer activity of Gem in an additive to synergistic manner against lung cancer via antiangiogenic and apoptotic pathways. These findings suggest potential benefit for use of NGC chemotherapy for treatment of lung cancer.
Combination Pair ID: 611
Pair Name Periplocin, TNF-related apoptosis inducing ligand
Phytochemical Periplocin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation BH3-interacting domain death agonist Expression
Result Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway
Combination Pair ID: 1041
Pair Name Plumbagin, rsTRAIL
Phytochemical Plumbagin
Drug rsTRAIL
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Down-regulation BH3-interacting domain death agonist Expression
Result Our results suggest that both plumbagin and rsTRAIL could be used as a single agent or synergistical agents to induce apoptosis of leukemic Kasumi‑1 cells in vitro and in vivo.
03. Reference
No. Title Href
1 Improved chemosensitivity in cervical cancer to cisplatin: synergistic activity of mahanine through STAT3 inhibition. Cancer Lett. 2014 Aug 28;351(1):81-90. doi: 10.1016/j.canlet.2014.05.005. Click
2 Homoharringtonine and SAHA synergistically enhance apoptosis in human acute myeloid leukemia cells through upregulation of TRAIL and death receptors. Mol Med Rep. 2013 Jun;7(6):1838-44. doi: 10.3892/mmr.2013.1440. Click
3 Synergistic antitumour activity of sorafenib in combination with tetrandrine is mediated by reactive oxygen species (ROS)/Akt signaling. Br J Cancer. 2013 Jul 23;109(2):342-50. doi: 10.1038/bjc.2013.334. Click
4 The novel small molecule BH3 mimetic nobiletin synergizes with vorinostat to induce apoptosis and autophagy in small cell lung cancer. Biochem Pharmacol. 2023 Oct;216:115807. doi: 10.1016/j.bcp.2023.115807. Click
5 Synergistic therapy with tangeretin and 5-fluorouracil accelerates the ROS/JNK mediated apoptotic pathway in human colorectal cancer cell. Food Chem Toxicol. 2020 Sep;143:111529. doi: 10.1016/j.fct.2020.111529. Click
6 Galangin (GG) combined with cisplatin (DDP) to suppress human lung cancer by inhibition of STAT3-regulated NF-κB and Bcl-2/Bax signaling pathways. Biomed Pharmacother. 2018 Jan;97:213-224. doi: 10.1016/j.biopha.2017.10.059. Click
7 Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253. Click
8 Neobavaisoflavone sensitizes apoptosis via the inhibition of metastasis in TRAIL-resistant human glioma U373MG cells. Life Sci. 2014 Jan 30;95(2):101-7. doi: 10.1016/j.lfs.2013.10.035. Click
9 Combining triptolide with ABT-199 is effective against acute myeloid leukemia through reciprocal regulation of Bcl-2 family proteins and activation of the intrinsic apoptotic pathway. Cell Death Dis. 2020 Jul 22;11(7):555. doi: 10.1038/s41419-020-02762-w. Click
10 Involvement of Mitochondrial Damage and Oxidative Stress in Apoptosis Induced by Betulin Plus Arsenic Trioxide in Neuroblastoma Cells. Anticancer Res. 2023 Jun;43(6):2467-2476. doi: 10.21873/anticanres.16414. Click
11 Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel. Genes (Basel). 2022 Jun 24;13(7):1142. doi: 10.3390/genes13071142. Click
12 Combination of Nimbolide and TNF-α-Increases Human Colon Adenocarcinoma Cell Death through JNK-mediated DR5 Up- regulation. Asian Pac J Cancer Prev. 2016;17(5):2637-41. Click
13 Shikonin and 4-hydroxytamoxifen synergistically inhibit the proliferation of breast cancer cells through activating apoptosis signaling pathway in vitro and in vivo. Chin Med. 2020 Mar 10;15:23. doi: 10.1186/s13020-020-00305-1. Click
14 Shikonin sensitizes A549 cells to TRAIL-induced apoptosis through the JNK, STAT3 and AKT pathways. BMC Cell Biol. 2018 Dec 29;19(1):29. doi: 10.1186/s12860-018-0179-7. Click
15 Emodin and Its Combination with Cytarabine Induce Apoptosis in Resistant Acute Myeloid Leukemia Cells in Vitro and in Vivo. Cell Physiol Biochem. 2018;48(5):2061-2073. doi: 10.1159/000492544. Click
16 Synergistic Anticancer Activity of Combined Use of Caffeic Acid with Paclitaxel Enhances Apoptosis of Non-Small-Cell Lung Cancer H1299 Cells in Vivo and in Vitro. Cell Physiol Biochem. 2018;48(4):1433-1442. doi: 10.1159/000492253. Click
17 Combination of Cinobufacini and Doxorubicin Increases Apoptosis of Hepatocellular Carcinoma Cells through the Fas- and Mitochondria-Mediated Pathways. Am J Chin Med. 2017;45(7):1537-1556. doi: 10.1142/S0192415X17500835. Click
18 Piceatannol Enhances the Antitumor Efficacy of Gemcitabine in Human A549 Non-Small Cell Lung Cancer Cells. Oncol Res. 2014;22(4):213-217. doi: 10.3727/096504015X14386062091398. Click
19 Synergistic anticancer activity of capsaicin and 3,3'-diindolylmethane in human colorectal cancer. J Agric Food Chem. 2015 May 6;63(17):4297-304. doi: 10.1021/jf506098s. Click
20 Gambogic acid sensitizes breast cancer cells to TRAIL-induced apoptosis by promoting the crosstalk of extrinsic and intrinsic apoptotic signalings. Food Chem Toxicol. 2018 Sep;119:334-341. doi: 10.1016/j.fct.2018.02.037. Click
21 Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. Click
22 Enhanced anticancer activity of gemcitabine in combination with noscapine via antiangiogenic and apoptotic pathway against non-small cell lung cancer. PLoS One. 2011;6(11):e27394. doi: 10.1371/journal.pone.0027394. Click
23 Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway. Mol Carcinog. 2019 Jun;58(6):1033-1045. doi: 10.1002/mc.22991. Click
24 Plumbagin enhances TRAIL-induced apoptosis of human leukemic Kasumi‑1 cells through upregulation of TRAIL death receptor expression, activation of caspase-8 and inhibition of cFLIP. Oncol Rep. 2017;37(6):3423-3432. doi:10.3892/or.2017.5627 Click
It has been None visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP