Name | BH3-interacting domain death agonist | ||
UniProt ID | BID_HUMAN | ||
Gene Name | BID | ||
Gene ID | 637 | ||
Synonyms |
BID, FP497
|
||
Sequence |
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTD
GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSE EDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQ NLRTYVRSLARNGMD |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa637 | ||
Pfam | PF00452; PF06393; PF08767; PF15397 |
Pair Name | Mahanine, Cisplatin | |||
Phytochemical Name | Mahanine | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2C77.Z] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | BH3-interacting domain death agonist | Cleavage | |
Result | Our results revealed that mahanine may be a prospective agent to reduce the concentration of cisplatin in adjunct for the treatment of cancer and thereby decreasing its toxicity. |
Pair Name | Homoharringtonine, Suberoylanilide hydroxamic acid (SAHA) | |||
Phytochemical | Homoharringtonine | |||
Drug | Suberoylanilide hydroxamic acid (SAHA) | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | BH3-interacting domain death agonist | Expression | |
Result | The synergistic effect between HHT and SAHA was blocked partially using a specific anti‑TRAIL antibody. The combination therapy was also found to significantly inhibit the growth of leukemia xenografts in vivo with enhanced apoptosis. These results indicate that, by regulating the induction of TRAIL and activation of the TRAIL apoptotic pathway, it is possible to administer HHT at low concentrations in combination with SAHA as an effective therapeutic approach for the treatment of AML. |
Pair Name | Tetrandrine, Sorafenib | |||
Phytochemical | Tetrandrine | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | BH3-interacting domain death agonist | Expression | |
Result | The antitumour activity of sorafenib plus tetrandrine may be attributed to the induction of the intrinsic apoptosis pathway through ROS/Akt signaling. This finding provides a novel approach that may broaden the clinical application of sorafenib. |
Pair Name | Nobiletin, Vorinostat | |||
Phytochemical | Nobiletin | |||
Drug | Vorinostat | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Expression | |
Result | The combination of nobiletin with vorinostat increased histone H3K9 and H3K27 acetylation levels in SCLC mouse tumor tissue and enhanced the expression of the BH3-only proteins BIM and BID. We conclude that nobiletin is a novel natural BH3 mimetic that can cooperate with vorinostat to induce apoptosis and autophagy in SCLC. |
Pair Name | Tangeretin, Fluorouracil | |||
Phytochemical | Tangeretin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | BH3-interacting domain death agonist | Expression | |
Result | To our knowledge gained from literature, this study is the first to describe synergistic activity of TAN and 5-FU against colorectal cancer cells. |
Pair Name | Norizalpinin, Cisplatin | |||
Phytochemical | Norizalpinin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Expression | |
Result | Our data indicated a novel therapeutic strategy to potentiate DDP-induced anti-tumor effect in lung cancer cells with DDP resistance by GG through inactivating p-STAT3/p65 and Bcl-2 pathways. |
Pair Name | Morin Hydrate, Cisplatin | |||
Phytochemical | Morin Hydrate | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Expression | |
Result | Our findings indicate that CP-Mh in combination served as a prominent regulator of autophagy and significant inducer of apoptosis that maintains a homeostatic balance towards HepG2 cells and the subcutaneous tumor model. |
Pair Name | Neobavaisoflavone, TNF-related apoptosis inducing ligand | |||
Phytochemical | Neobavaisoflavone | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2F7Z] | Glioma | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Cleavage | |
Result | Taken together, our results suggest that NBIF reduces the resistance of cancer cells to TRAIL and that the combination of NBIF and TRAIL may be a new therapeutic strategy for treating TRAIL-resistant glioma cells. |
Pair Name | Triptolide, ABT-199 | |||
Phytochemical | Triptolide | |||
Drug | ABT-199 | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Expression | |
Result | These findings suggest that the regimen combining TPL and ABT-199 might be active against AML by inducing robust apoptosis through reciprocal regulation of anti- and proapoptotic Bcl-2 family proteins, therefore providing a strong rationale for the clinical investigation of this combination regimen for the treatment of AML. |
Pair Name | Betulin, Arsenic oxide (As2O3) | |||
Phytochemical | Betulin | |||
Drug | Arsenic oxide (As2O3) | |||
Disease Info | [ICD-11: 2D11.Y] | Neuroblastoma | Investigative | |
Regulate Info | Down-regulation | BH3-interacting domain death agonist | Expression | |
Result | The novel combination of As2O3 plus betulin has the potential to serve as a practical anti-neuroblastoma drug. |
Pair Name | Ginsenoside Rg5, Paclitaxel | |||
Phytochemical | Ginsenoside Rg5 | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C77.Z] | Cervical cancer | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Expression | |
Result | Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel |
Pair Name | Nimbolide, Tumor necrosis factor-alpha | |||
Phytochemical | Nimbolide | |||
Drug | Tumor necrosis factor-alpha | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | BH3-interacting domain death agonist | Expression | |
Result | Our findings overall indicate that nimbolide may enhance TNF-α-mediated cellular proliferation inhibition through increasing cell apoptosis of HT-29 cells by up-reglation of DR5 expression via the JNK pathway. |
Pair Name | Shikonin, 4-hydroxytamoxifen | |||
Phytochemical | Shikonin | |||
Drug | 4-hydroxytamoxifen | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | BH3-interacting domain death agonist | Expression | |
Result | The combination of SK and 4-OHT shows highly efficient anticancer effects on breast cancer therapy. SK may be a promising candidate as an adjuvant to 4-OHT for breast cancer treatments, especially for ER- breast cancer. |
Pair Name | Shikonin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Shikonin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Expression | |
Result | The results indicated that shikonin sensitized resistant cancer cells to TRAIL-induced cytotoxicity via the modulation of the JNK, STAT3 and AKT pathways, the downregulation of antiapoptotic proteins and the upregulation of proapoptotic proteins. |
Pair Name | Emodin, Cytarabine | |||
Phytochemical | Emodin | |||
Drug | Cytarabine | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | BH3-interacting domain death agonist | Expression | |
Result | Emodin and its combination with Ara-C may be considered a promising therapeutic approach in AML and worthy of further investigation. |
Pair Name | Caffeic acid, Paclitaxel | |||
Phytochemical | Caffeic acid | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Expression | |
Result | Our results indicated that CA inhibited NSCLC H1299 cell growth by inducing apoptosis and CA and PTX combined produced a synergistic anti-cancer effect in H1299 cells. |
Pair Name | Bufalin, Doxorubicin | |||
Phytochemical | Bufalin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Expression | |
Result | These results suggested that the combination of cinobufacini and doxorubicin may provide a new strategy for inhibiting the proliferation of HCC cells. |
Pair Name | Piceatannol, Gemcitabine | |||
Phytochemical | Piceatannol | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Expression | |
Result | The findings from this study show that piceatannol can enhance the cytotoxic effects of gemcitabine by enhancing expression of the proapoptotic protein Bak, thereby providing the rational basis for a novel combination strategy for the treatment of NSCLC. |
Pair Name | Capsaicin, 3,3'-diindolylmethane | |||
Phytochemical | Capsaicin | |||
Drug | 3,3'-diindolylmethane | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Expression | |
Result | The present study suggests capsaicin and DIM work synergistically to inhibit cell proliferation and induce apoptosis in colorectal cancer through modulating transcriptional activity of NF-κB, p53, and target genes associated with apoptosis. |
Pair Name | Gambogic Acid, TNF-related apoptosis inducing ligand | |||
Phytochemical | Gambogic Acid | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | BH3-interacting domain death agonist | Expression | |
Result | These findings may open a new window in the treatment of breast cancer using TRAIL in combination with GA. |
Pair Name | Medicarpin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Medicarpin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B33.1] | Myeloid leukemia | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Expression | |
Result | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway |
Pair Name | Noscapine, Gemcitabine | |||
Phytochemical | Noscapine | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | BH3-interacting domain death agonist | Expression | |
Result | Nos potentiated the anticancer activity of Gem in an additive to synergistic manner against lung cancer via antiangiogenic and apoptotic pathways. These findings suggest potential benefit for use of NGC chemotherapy for treatment of lung cancer. |
Pair Name | Periplocin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Periplocin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | BH3-interacting domain death agonist | Expression | |
Result | Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway |
Pair Name | Plumbagin, rsTRAIL | |||
Phytochemical | Plumbagin | |||
Drug | rsTRAIL | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Down-regulation | BH3-interacting domain death agonist | Expression | |
Result | Our results suggest that both plumbagin and rsTRAIL could be used as a single agent or synergistical agents to induce apoptosis of leukemic Kasumi‑1 cells in vitro and in vivo. |
No. | Title | Href |
---|---|---|
1 | Improved chemosensitivity in cervical cancer to cisplatin: synergistic activity of mahanine through STAT3 inhibition. Cancer Lett. 2014 Aug 28;351(1):81-90. doi: 10.1016/j.canlet.2014.05.005. | Click |
2 | Homoharringtonine and SAHA synergistically enhance apoptosis in human acute myeloid leukemia cells through upregulation of TRAIL and death receptors. Mol Med Rep. 2013 Jun;7(6):1838-44. doi: 10.3892/mmr.2013.1440. | Click |
3 | Synergistic antitumour activity of sorafenib in combination with tetrandrine is mediated by reactive oxygen species (ROS)/Akt signaling. Br J Cancer. 2013 Jul 23;109(2):342-50. doi: 10.1038/bjc.2013.334. | Click |
4 | The novel small molecule BH3 mimetic nobiletin synergizes with vorinostat to induce apoptosis and autophagy in small cell lung cancer. Biochem Pharmacol. 2023 Oct;216:115807. doi: 10.1016/j.bcp.2023.115807. | Click |
5 | Synergistic therapy with tangeretin and 5-fluorouracil accelerates the ROS/JNK mediated apoptotic pathway in human colorectal cancer cell. Food Chem Toxicol. 2020 Sep;143:111529. doi: 10.1016/j.fct.2020.111529. | Click |
6 | Galangin (GG) combined with cisplatin (DDP) to suppress human lung cancer by inhibition of STAT3-regulated NF-κB and Bcl-2/Bax signaling pathways. Biomed Pharmacother. 2018 Jan;97:213-224. doi: 10.1016/j.biopha.2017.10.059. | Click |
7 | Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253. | Click |
8 | Neobavaisoflavone sensitizes apoptosis via the inhibition of metastasis in TRAIL-resistant human glioma U373MG cells. Life Sci. 2014 Jan 30;95(2):101-7. doi: 10.1016/j.lfs.2013.10.035. | Click |
9 | Combining triptolide with ABT-199 is effective against acute myeloid leukemia through reciprocal regulation of Bcl-2 family proteins and activation of the intrinsic apoptotic pathway. Cell Death Dis. 2020 Jul 22;11(7):555. doi: 10.1038/s41419-020-02762-w. | Click |
10 | Involvement of Mitochondrial Damage and Oxidative Stress in Apoptosis Induced by Betulin Plus Arsenic Trioxide in Neuroblastoma Cells. Anticancer Res. 2023 Jun;43(6):2467-2476. doi: 10.21873/anticanres.16414. | Click |
11 | Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel. Genes (Basel). 2022 Jun 24;13(7):1142. doi: 10.3390/genes13071142. | Click |
12 | Combination of Nimbolide and TNF-α-Increases Human Colon Adenocarcinoma Cell Death through JNK-mediated DR5 Up- regulation. Asian Pac J Cancer Prev. 2016;17(5):2637-41. | Click |
13 | Shikonin and 4-hydroxytamoxifen synergistically inhibit the proliferation of breast cancer cells through activating apoptosis signaling pathway in vitro and in vivo. Chin Med. 2020 Mar 10;15:23. doi: 10.1186/s13020-020-00305-1. | Click |
14 | Shikonin sensitizes A549 cells to TRAIL-induced apoptosis through the JNK, STAT3 and AKT pathways. BMC Cell Biol. 2018 Dec 29;19(1):29. doi: 10.1186/s12860-018-0179-7. | Click |
15 | Emodin and Its Combination with Cytarabine Induce Apoptosis in Resistant Acute Myeloid Leukemia Cells in Vitro and in Vivo. Cell Physiol Biochem. 2018;48(5):2061-2073. doi: 10.1159/000492544. | Click |
16 | Synergistic Anticancer Activity of Combined Use of Caffeic Acid with Paclitaxel Enhances Apoptosis of Non-Small-Cell Lung Cancer H1299 Cells in Vivo and in Vitro. Cell Physiol Biochem. 2018;48(4):1433-1442. doi: 10.1159/000492253. | Click |
17 | Combination of Cinobufacini and Doxorubicin Increases Apoptosis of Hepatocellular Carcinoma Cells through the Fas- and Mitochondria-Mediated Pathways. Am J Chin Med. 2017;45(7):1537-1556. doi: 10.1142/S0192415X17500835. | Click |
18 | Piceatannol Enhances the Antitumor Efficacy of Gemcitabine in Human A549 Non-Small Cell Lung Cancer Cells. Oncol Res. 2014;22(4):213-217. doi: 10.3727/096504015X14386062091398. | Click |
19 | Synergistic anticancer activity of capsaicin and 3,3'-diindolylmethane in human colorectal cancer. J Agric Food Chem. 2015 May 6;63(17):4297-304. doi: 10.1021/jf506098s. | Click |
20 | Gambogic acid sensitizes breast cancer cells to TRAIL-induced apoptosis by promoting the crosstalk of extrinsic and intrinsic apoptotic signalings. Food Chem Toxicol. 2018 Sep;119:334-341. doi: 10.1016/j.fct.2018.02.037. | Click |
21 | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. | Click |
22 | Enhanced anticancer activity of gemcitabine in combination with noscapine via antiangiogenic and apoptotic pathway against non-small cell lung cancer. PLoS One. 2011;6(11):e27394. doi: 10.1371/journal.pone.0027394. | Click |
23 | Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway. Mol Carcinog. 2019 Jun;58(6):1033-1045. doi: 10.1002/mc.22991. | Click |
24 | Plumbagin enhances TRAIL-induced apoptosis of human leukemic Kasumi‑1 cells through upregulation of TRAIL death receptor expression, activation of caspase-8 and inhibition of cFLIP. Oncol Rep. 2017;37(6):3423-3432. doi:10.3892/or.2017.5627 | Click |