| Name | G2/mitotic-specific cyclin-B1 | ||
| UniProt ID | CCNB1_HUMAN | ||
| Gene Name | CCNB1 | ||
| Gene ID | 891 | ||
| Synonyms |
CCNB1, CCNB
|
||
| Sequence |
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS ALVQDLAKAVAKV |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.I.1.1.3 | ||
| KEGG ID | hsa891 | ||
| TTD ID | T98459 | ||
| Pfam | PF00134; PF02703; PF02984; PF05887 | ||
| Pair Name | Baicalein, Docetaxel | |||
| Phytochemical Name | Baicalein | |||
| Anticancer drug Name | Docetaxel | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | Baicalein enhances the antitumor efficacy of docetaxel on nonsmall cell lung cancer in a β-catenin-dependent manner | |||
| Pair Name | Epigallocatechin gallate, Irinotecan | |||
| Phytochemical Name | Epigallocatechin gallate | |||
| Anticancer drug Name | Irinotecan | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | EGCG synergizes the therapeutic effect of irinotecan through enhanced DNA damage in human colorectal cancer cells | |||
| Pair Name | Artesunate, Cisplatin | |||
| Phytochemical | Artesunate | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | ART exhibited significant anti-tumor effect on A549 cells and this efficiency could be enhanced by combination with CIS | |||
| Pair Name | Berbamine, Arcyriaflavin A | |||
| Phytochemical | Berbamine | |||
| Drug | Arcyriaflavin A | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells. | |||
| Pair Name | Beta-Elemene, Bortezomib | |||
| Phytochemical | Beta-Elemene | |||
| Drug | Bortezomib | |||
| Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | Elemene sensitizes pancreatic cancer cells to bortezomib by enhancing proteasome inhibition via molecular patch mechanism | |||
| Pair Name | Beta-Elemene, Cisplatin | |||
| Phytochemical | Beta-Elemene | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | β-elemenal may have greater potential as an anticancer alternative to β-elemene in treating lung cancer and other tumors. | |||
| Pair Name | Capsaicin, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Capsaicin | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | A combined regimen using capsaicin and TRAIL may provide a safe and effective strategy for treating malignant gliomas. | |||
| Pair Name | Cryptotanshinone, Trifluridine | |||
| Phytochemical | Cryptotanshinone | |||
| Drug | Trifluridine | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | FTD combined with CTS has a synergistic anti-gastric cancer effect as shown by in vitro and in vivo experiments, and the combined treatment of FTD and CTS will be a promising treatment option for advanced gastric cancer. | |||
| Pair Name | Dihydroberberine, Sunitinib | |||
| Phytochemical | Dihydroberberine | |||
| Drug | Sunitinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | DCS induced the expression of cell cycle signal molecules that are known to be affected by JNK and p38. The change of cell cycle, in turn, led to down-regulation of JNK and p38, and further reduced IL-1 secretion. Collectively, these findings highlight potential molecular mechanisms of DCS chemotherapeutic activity and suggest that DCS is an efficacious strategy in NSCLC therapy. | |||
| Pair Name | Garcinol, Paclitaxel | |||
| Phytochemical | Garcinol | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model | |||
| Pair Name | Kurarinone, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Kurarinone | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | Kurarinone Synergizes TRAIL-Induced Apoptosis in Gastric Cancer Cells | |||
| Pair Name | Licochalcone B, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Licochalcone B | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC. | |||
| Pair Name | Luteolin, Cisplatin | |||
| Phytochemical | Luteolin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | These findings indicate the anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cells and luteolin may be a promising candidate agent used in the treatment of gastric cancer. | |||
| Pair Name | Luteolin, Oxaliplatin | |||
| Phytochemical | Luteolin | |||
| Drug | Oxaliplatin | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis | |||
| Pair Name | Phenethyl isothiocyanate, Dasatinib | |||
| Phytochemical | Phenethyl isothiocyanate | |||
| Drug | Dasatinib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | PEITC showed to enhance dasatinib action in treating HCC with increased production of ROS that induced cell cycle arrest followed by mitotic catastrophe, and to induce oxeiptosis. These results highlight the role that ITCs may have in cancer therapy as a complement of clinically approved chemotherapeutic drugs | |||
| Pair Name | Resveratrol, Cisplatin | |||
| Phytochemical | Resveratrol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | These results indicated that RES is a promising adjuvant for DDP during GC chemotherapy. | |||
| Pair Name | Resveratrol, Cisplatin | |||
| Phytochemical | Resveratrol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | Resveratrol Enhances Cytotoxic Effects of Cisplatin by Inducing Cell Cycle Arrest and Apoptosis in Ovarian Adenocarcinoma SKOV-3 Cells through Activating the p38 MAPK and Suppressing AKT | |||
| Pair Name | Resveratrol, Temozolomide | |||
| Phytochemical | Resveratrol | |||
| Drug | Temozolomide | |||
| Disease Info | [ICD-11: 2F7Z] | Glioma | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | TMZ in combination with resveratrol remarkably increased reactive oxygen species (ROS) production, which serves as an upstream signal for AMP-activated protein kinase (AMPK) activation. Subsequently, activated AMPK inhibited mTOR signaling and downregulated antiapoptosis protein Bcl-2, which was contributed to the additive antiproliferation effects of combination treatment. In an orthotopic xenograft model of GBM, TMZ plus resveratrol treatment significantly reduced the volume of tumor, which was confirmed by decreased expression of Ki-67, a marker of proliferation index | |||
| Pair Name | Silibinin, Paclitaxel | |||
| Phytochemical | Silibinin | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines | |||
| Pair Name | Silibinin, Trichostatin A | |||
| Phytochemical | Silibinin | |||
| Drug | Trichostatin A | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | Combinations of TSA with silibinin synergistically augmented the cytotoxic effects of the single agent, which was associated with a dramatic increase in p21 (Cdkn1a) | |||
| Pair Name | Sulforaphane, Everolimus | |||
| Phytochemical | Sulforaphane | |||
| Drug | Everolimus | |||
| Disease Info | [ICD-11: 2C94] | Bladder cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | The addition of SFN to the long-term everolimus application inhibits resistance development in bladder cancer cells in vitro. Therefore, sulforaphane may hold potential for treating bladder carcinoma in patients with resistance to an mTOR inhibitor. | |||
| Pair Name | Sulforaphane, Fluorouracil | |||
| Phytochemical | Sulforaphane | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | Studies of the interaction mechanism have revealed that sulforaphane and 5-fluorouracil act synergistically in the MDA-MB-231 cells by inducing autophagic cell death and premature senescence. | |||
| Pair Name | Sulforaphane, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Sulforaphane | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | The ability of sulforaphane to inhibit tumor growth, metastasis, and angiogenesis and to enhance the therapeutic potential of TRAIL suggests that sulforaphane alone or in combination with TRAIL can be used for the management of prostate cancer. | |||
| Pair Name | Chrysin, Fluorouracil | |||
| Phytochemical | Chrysin | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | G2/mitotic-specific cyclin-B1 | Expression | |
| Result | Potentiating activities of chrysin in the therapeutic efficacy of 5-fluorouracil in gastric cancer cells | |||
| Pair Name | Raloxifene hydrochloride, Paclitaxel | |||
| Phytochemical | Raloxifene hydrochloride | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | G2/mitotic-specific cyclin-B1 | Phosphorylation | |
| Result | Reversal effects of Raloxifene on paclitaxel resistance in 2 MDR breast cancer cells | |||
| No. | Title | Href |
|---|---|---|
| 1 | Baicalein enhances the antitumor efficacy of docetaxel on nonsmall cell lung cancer in a β-catenin-dependent manner. Phytother Res. 2020 Jan;34(1):104-117. doi: 10.1002/ptr.6501. | Click |
| 2 | EGCG synergizes the therapeutic effect of irinotecan through enhanced DNA damage in human colorectal cancer cells. J Cell Mol Med. 2021 Aug;25(16):7913-7921. doi: 10.1111/jcmm.16718. | Click |
| 3 | Artesunate exhibits synergistic anti-cancer effects with cisplatin on lung cancer A549 cells by inhibiting MAPK pathway. Gene. 2021 Jan 15;766:145134. doi: 10.1016/j.gene.2020.145134. | Click |
| 4 | Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. | Click |
| 5 | Elemene sensitizes pancreatic cancer cells to bortezomib by enhancing proteasome inhibition via molecular patch mechanism. Signal Transduct Target Ther. 2023 Feb 27;8(1):87. doi: 10.1038/s41392-023-01373-z. | Click |
| 6 | Sensitization of lung cancer cells to cisplatin by β-elemene is mediated through blockade of cell cycle progression: antitumor efficacies of β-elemene and its synthetic analogs. Med Oncol. 2013 Mar;30(1):488. doi: 10.1007/s12032-013-0488-9. | Click |
| 7 | Capsaicin sensitizes malignant glioma cells to TRAIL-mediated apoptosis via DR5 upregulation and survivin downregulation. Carcinogenesis. 2010 Mar;31(3):367-75. doi: 10.1093/carcin/bgp298. | Click |
| 8 | Effects and mechanisms of trifluridine alone or in combination with cryptotanshinone in inhibiting malignant biological behavior of gastric cancer. Cell Cycle. 2023 Jun;22(12):1463-1477. doi: 10.1080/15384101.2023.2215678. | Click |
| 9 | Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178. | Click |
| 10 | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. | Click |
| 11 | Kurarinone Synergizes TRAIL-Induced Apoptosis in Gastric Cancer Cells. Cell Biochem Biophys. 2015 May;72(1):241-9. doi: 10.1007/s12013-014-0444-0. | Click |
| 12 | Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. | Click |
| 13 | Anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cell line. Mol Cell Biochem. 2008 Jun;313(1-2):125-32. doi: 10.1007/s11010-008-9749-x. | Click |
| 14 | Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis. Oncol Lett. 2022 Jan;23(1):16. doi: 10.3892/ol.2021.13134. | Click |
| 15 | Phenethyl isothiocyanate and dasatinib combination synergistically reduces hepatocellular carcinoma growth via cell cycle arrest and oxeiptosis. Front Pharmacol. 2023 Oct 4;14:1264032. doi: 10.3389/fphar.2023.1264032. | Click |
| 16 | Resveratrol synergizes with cisplatin in antineoplastic effects against AGS gastric cancer cells by inducing endoplasmic reticulum stress‑mediated apoptosis and G2/M phase arrest. Oncol Rep. 2020 Oct;44(4):1605-1615. doi: 10.3892/or.2020.7708. | Click |
| 17 | Resveratrol Enhances Cytotoxic Effects of Cisplatin by Inducing Cell Cycle Arrest and Apoptosis in Ovarian Adenocarcinoma SKOV-3 Cells through Activating the p38 MAPK and Suppressing AKT. Pharmaceuticals (Basel). 2023 May 17;16(5):755. doi: 10.3390/ph16050755. | Click |
| 18 | Resveratrol enhances the antitumor effects of temozolomide in glioblastoma via ROS-dependent AMPK-TSC-mTOR signaling pathway. CNS Neurosci Ther. 2012;18(7):536-546. doi:10.1111/j.1755-5949.2012.00319.x | Click |
| 19 | Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines. Mol Med Rep. 2018 Aug;18(2):1835-1841. doi: 10.3892/mmr.2018.9129. | Click |
| 20 | Epigenetic modifications and p21-cyclin B1 nexus in anticancer effect of histone deacetylase inhibitors in combination with silibinin on non-small cell lung cancer cells. Epigenetics. 2012 Oct;7(10):1161-72. doi: 10.4161/epi.22070. | Click |
| 21 | Chronic Sulforaphane Administration Inhibits Resistance to the mTOR-Inhibitor Everolimus in Bladder Cancer Cells. Int J Mol Sci. 2020 Jun 4;21(11):4026. doi: 10.3390/ijms21114026. | Click |
| 22 | Autophagic cell death and premature senescence: New mechanism of 5-fluorouracil and sulforaphane synergistic anticancer effect in MDA-MB-231 triple negative breast cancer cell line. Food Chem Toxicol. 2018 Jan;111:1-8. doi: 10.1016/j.fct.2017.10.056. | Click |
| 23 | Sulforaphane enhances the therapeutic potential of TRAIL in prostate cancer orthotopic model through regulation of apoptosis, metastasis, and angiogenesis. Clin Cancer Res. 2008 Nov 1;14(21):6855-66. doi: 10.1158/1078-0432.CCR-08-0903. | Click |
| 24 | Potentiating activities of chrysin in the therapeutic efficacy of 5-fluorouracil in gastric cancer cells. Oncol Lett. 2021 Jan;21(1):24. doi: 10.3892/ol.2020.12285. | Click |
| 25 | Reversal effects of Raloxifene on paclitaxel resistance in 2 MDR breast cancer cells. Cancer Biol Ther. 2015;16(12):1794-801. doi: 10.1080/15384047.2015.1095409. | Click |
