InterPAD - DETAILS

MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGV
GGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQR
TQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAH
ERLSYAFSVWRMEGAWSMSASH

No.	Title	Href
1	Lupeol and Paclitaxel cooperate in hindering hypoxia induced vasculogenic mimicry via suppression of HIF-1α-EphA2-Laminin-5γ2 network in human oral cancer. J Cell Commun Signal. 2023 Sep;17(3):591-608. doi: 10.1007/s12079-022-00693-z.	`Click`
2	Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells. Exp Oncol. 2021 Jun;43(2):125-134. doi: 10.32471/exp-oncology.2312-8852.vol-43-no-2.16096.	`Click`
3	β-Elemene Synergizes With Gefitinib to Inhibit Stem-Like Phenotypes and Progression of Lung Cancer via Down-Regulating EZH2. Front Pharmacol. 2018 Nov 30;9:1413. doi: 10.3389/fphar.2018.01413.	`Click`
4	Bisdemethoxycurcumin Promotes Apoptosis and Inhibits the Epithelial-Mesenchymal Transition through the Inhibition of the G-Protein-Coupled Receptor 161/Mammalian Target of Rapamycin Signaling Pathway in Triple Negative Breast Cancer Cells. J Agric Food Chem. 2021 Dec 8;69(48):14557-14567. doi: 10.1021/acs.jafc.1c05585.	`Click`
5	Cordycepin improves sensitivity to temozolomide in glioblastoma cells by down-regulating MYC. J Cancer Res Clin Oncol. 2023 Nov;149(17):16055-16067. doi: 10.1007/s00432-023-05347-0.	`Click`
6	Fisetin, a dietary flavonoid, augments the anti-invasive and anti-metastatic potential of sorafenib in melanoma. Oncotarget. 2016 Jan 12;7(2):1227-41. doi: 10.18632/oncotarget.6237.	`Click`
7	Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c.	`Click`
8	Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer. Oncol Lett. 2016 Aug;12(2):983-988. doi: 10.3892/ol.2016.4696.	`Click`
9	Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation. Biomed Pharmacother. 2017 Sep;93:948-960. doi: 10.1016/j.biopha.2017.06.095.	`Click`
10	Lupeol synergizes with 5-fluorouracil to combat c-MET/EphA2 mediated chemoresistance in triple negative breast cancer. iScience. 2023 Nov 4;26(12):108395. doi: 10.1016/j.isci.2023.108395.	`Click`
11	Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells. Chem Biol Interact. 2022 Feb 25;354:109832. doi: 10.1016/j.cbi.2022.109832.	`Click`
12	Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells. Biomed Pharmacother. 2020 Aug;128:110243. doi: 10.1016/j.biopha.2020.110243.	`Click`
13	Sclareolide enhances gemcitabine‑induced cell death through mediating the NICD and Gli1 pathways in gemcitabine‑resistant human pancreatic cancer. Mol Med Rep. 2017 Apr;15(4):1461-1470. doi: 10.3892/mmr.2017.6182.	`Click`
14	Sulforaphane is Synergistic with CB-5083 and Inhibits Colony Formation of CB-5083-Resistant HCT116 Cells. ChemMedChem. 2022 Jun 3;17(11):e202200030. doi: 10.1002/cmdc.202200030.	`Click`
15	Synergistic Anti-Tumor Effect of Toosendanin and Paclitaxel on Triple-Negative Breast Cancer via Regulating ADORA2A-EMT Related Signaling. Adv Biol (Weinh). 2023 Aug;7(8):e2300062. doi: 10.1002/adbi.202300062.	`Click`
16	Zerumbone Sensitizes the Anti-Cancer Efficacy of Cisplatin in Hepatocellular Carcinoma Cells. Anticancer Agents Med Chem. 2022 Aug 4;22(16):2885-2895. doi: 10.2174/1871520622666220324090801.	`Click`
17	Isocorydine decrease gemcitabine-resistance by inhibiting epithelial-mesenchymal transition via STAT3 in pancreatic cancer cells. Am J Transl Res. 2020 Jul 15;12(7):3702-3714.	`Click`

No.

Title

Href

Lupeol and Paclitaxel cooperate in hindering hypoxia induced vasculogenic mimicry via suppression of HIF-1α-EphA2-Laminin-5γ2 network in human oral cancer. J Cell Commun Signal. 2023 Sep;17(3):591-608. doi: 10.1007/s12079-022-00693-z.

Click

Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells. Exp Oncol. 2021 Jun;43(2):125-134. doi: 10.32471/exp-oncology.2312-8852.vol-43-no-2.16096.

Click

β-Elemene Synergizes With Gefitinib to Inhibit Stem-Like Phenotypes and Progression of Lung Cancer via Down-Regulating EZH2. Front Pharmacol. 2018 Nov 30;9:1413. doi: 10.3389/fphar.2018.01413.

Click

Bisdemethoxycurcumin Promotes Apoptosis and Inhibits the Epithelial-Mesenchymal Transition through the Inhibition of the G-Protein-Coupled Receptor 161/Mammalian Target of Rapamycin Signaling Pathway in Triple Negative Breast Cancer Cells. J Agric Food Chem. 2021 Dec 8;69(48):14557-14567. doi: 10.1021/acs.jafc.1c05585.

Click

Cordycepin improves sensitivity to temozolomide in glioblastoma cells by down-regulating MYC. J Cancer Res Clin Oncol. 2023 Nov;149(17):16055-16067. doi: 10.1007/s00432-023-05347-0.

Click

Fisetin, a dietary flavonoid, augments the anti-invasive and anti-metastatic potential of sorafenib in melanoma. Oncotarget. 2016 Jan 12;7(2):1227-41. doi: 10.18632/oncotarget.6237.

Click

Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c.

Click

Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer. Oncol Lett. 2016 Aug;12(2):983-988. doi: 10.3892/ol.2016.4696.

Click

Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation. Biomed Pharmacother. 2017 Sep;93:948-960. doi: 10.1016/j.biopha.2017.06.095.

Click

Lupeol synergizes with 5-fluorouracil to combat c-MET/EphA2 mediated chemoresistance in triple negative breast cancer. iScience. 2023 Nov 4;26(12):108395. doi: 10.1016/j.isci.2023.108395.

Click

Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells. Chem Biol Interact. 2022 Feb 25;354:109832. doi: 10.1016/j.cbi.2022.109832.

Click

Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells. Biomed Pharmacother. 2020 Aug;128:110243. doi: 10.1016/j.biopha.2020.110243.

Click

Sclareolide enhances gemcitabine‑induced cell death through mediating the NICD and Gli1 pathways in gemcitabine‑resistant human pancreatic cancer. Mol Med Rep. 2017 Apr;15(4):1461-1470. doi: 10.3892/mmr.2017.6182.

Click

Sulforaphane is Synergistic with CB-5083 and Inhibits Colony Formation of CB-5083-Resistant HCT116 Cells. ChemMedChem. 2022 Jun 3;17(11):e202200030. doi: 10.1002/cmdc.202200030.

Click

Synergistic Anti-Tumor Effect of Toosendanin and Paclitaxel on Triple-Negative Breast Cancer via Regulating ADORA2A-EMT Related Signaling. Adv Biol (Weinh). 2023 Aug;7(8):e2300062. doi: 10.1002/adbi.202300062.

Click

Zerumbone Sensitizes the Anti-Cancer Efficacy of Cisplatin in Hepatocellular Carcinoma Cells. Anticancer Agents Med Chem. 2022 Aug 4;22(16):2885-2895. doi: 10.2174/1871520622666220324090801. 

Click

Isocorydine decrease gemcitabine-resistance by inhibiting epithelial-mesenchymal transition via STAT3 in pancreatic cancer cells. Am J Transl Res. 2020 Jul 15;12(7):3702-3714.

Click

Name	Twist-related protein 1
UniProt ID	TWST1_HUMAN
Gene Name	TWIST1
Gene ID	7291
Synonyms	TWIST1, ACS3, BPES2, BPES3, CRS, CRS1, CSO, SCS, SWCOS, TWIST, bHLHa38
Sequence	MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGV GGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQR TQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAH ERLSYAFSVWRMEGAWSMSASH
Pathway Map	`MAP LINK`
KEGG ID	hsa7291
TTD ID	T95660
Pfam	PF00010; PF05600; PF18558

Pair Name	Lupeol, Paclitaxel
Phytochemical Name	Lupeol
Anticancer drug Name	Paclitaxel
Disease Info	[ICD-11: 2B66.0]	Oral squamous cell carcinoma	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	Our findings elucidated mechanistic underpinning of hypoxia induced Laminin-5γ2 driven VM formation highlighting that Lupeol-Paclitaxel combination may serve as novel therapeutic intervention in perturbation of VM in human OSCC.

Pair Name	Apigenin, Doxorubicin
Phytochemical	Apigenin
Drug	Doxorubicin
Disease Info	[ICD-11: 2C82]	Prostate cancer	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells

Pair Name	Beta-Elemene, Gefitinib
Phytochemical	Beta-Elemene
Drug	Gefitinib
Disease Info	[ICD-11: 2C25]	Lung cancer	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	The findings may have potential implications for treating aggressive and resistant lung cancers.

Pair Name	Bisdemethoxycucurmin, Rapamycin
Phytochemical	Bisdemethoxycucurmin
Drug	Rapamycin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	Bisdemethoxycurcumin Promotes Apoptosis and Inhibits the Epithelial-Mesenchymal Transition through the Inhibition of the G-Protein-Coupled Receptor 161/Mammalian Target of Rapamycin Signaling Pathway in Triple Negative Breast Cancer Cells.

Pair Name	Cordycepin, Temozolomide
Phytochemical	Cordycepin
Drug	Temozolomide
Disease Info	[ICD-11: 2A00]	Glioblastoma multiforme	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	Cordycepin combined with temozolomide may down-regulate MYC through "MicroRNA in cancer, Proteoglycans in cancer, Pathways in cancer and PI3K-AKT signaling pathway", which in turn regulate the expression of MCL1, CTNNB1, MMP9, PDCD4, thus regulating cell proliferation, migration and apoptosis in glioblastoma.

Pair Name	Fisetin, Sorafenib
Phytochemical	Fisetin
Drug	Sorafenib
Disease Info	[ICD-11: 2C30]	Melanoma	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	Our findings demonstrate that fisetin potentiates the anti-invasive and anti-metastatic effects of sorafenib. Our data suggest that fisetin may be a worthy adjuvant chemotherapy for the management of melanoma.

Pair Name	Garcinol, Paclitaxel
Phytochemical	Garcinol
Drug	Paclitaxel
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model

Pair Name	Harmine, Paclitaxel
Phytochemical	Harmine
Drug	Paclitaxel
Disease Info	[ICD-11: 2B72]	Gastric cancer	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer

Pair Name	Liquiritin, TNF-related apoptosis inducing ligand
Phytochemical	Liquiritin
Drug	TNF-related apoptosis inducing ligand
Disease Info	[ICD-11: 2B72]	Gastric cancer	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation

Pair Name	Lupeol, Fluorouracil
Phytochemical	Lupeol
Drug	Fluorouracil
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	These data lay the foundation for the clinical validation of this combination therapy for TNBC patients.

Pair Name	Piperlongumine, Doxorubicin
Phytochemical	Piperlongumine
Drug	Doxorubicin
Disease Info	[ICD-11: 2B51]	Osteosarcoma	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells

Pair Name	Piperlongumine, Paclitaxel
Phytochemical	Piperlongumine
Drug	Paclitaxel
Disease Info	[ICD-11: 2B90]	Colon cancer	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells

Pair Name	Sclareolide, Gemcitabine
Phytochemical	Sclareolide
Drug	Gemcitabine
Disease Info	[ICD-11: 2C10]	Pancreatic cancer	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	Sclareolide enhances gemcitabine‑induced cell death through mediating the NICD and Gli1 pathways in gemcitabine‑resistant human pancreatic cancer

Pair Name	Sulforaphane, CB-5083
Phytochemical	Sulforaphane
Drug	CB-5083
Disease Info	[ICD-11: 2B90]	Colon cancer	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	The combination of Sulforaphane and CB-5083 may be a useful treatment strategy to combat CB-5083 resistance.

Pair Name	Toosendanin, Paclitaxel
Phytochemical	Toosendanin
Drug	Paclitaxel
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	The results suggest that combination of TSN and PTX is superior to PTX alone, suggesting that it may be a promising alternative adjuvant chemotherapy strategy for patients with TNBC, especially those with metastatic TNBC.

Pair Name	Zerumbone, Cisplatin
Phytochemical	Zerumbone
Drug	Cisplatin
Disease Info	[ICD-11: 2C12]	Hepatocellular carcinoma	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	The current study indicates that the treatment of 4.62 μM of ZER combined with 1.93 μM of CIS in human liver cancer cells exerts synergistic effects on cell growth inhibition, apoptosis induction, angiogenesis, and invasion by modulating gene expression.

Pair Name	Isocorydine, Gemcitabine
Phytochemical	Isocorydine
Drug	Gemcitabine
Disease Info	[ICD-11: 2C10]	Pancreatic cancer	Investigative
Regulate Info	Down-regulation	Twist-related protein 1	Expression
Result	The synergistic treatment effect of the combination treatment of ICD and gemcitabine in pancreatic cancer cells was confirmed in established xenograft models.