Name | Zinc finger protein SNAI1 | ||
UniProt ID | SNAI1_HUMAN | ||
Gene Name | SNAI1 | ||
Gene ID | 6615 | ||
Synonyms |
SNAI1, SLUGH2, SNA, SNAH, SNAIL, SNAIL1, dJ710H13.1
|
||
Sequence |
MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLI
WDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSS LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPC VCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQA CARTFSRMSLLHKHQESGCSGCPR |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa6615 | ||
Pfam | PF00096; PF01155; PF05129; PF05605; PF09723; PF12171; PF12874; PF13465; PF13894; PF13912; PF13913; PF16278 |
Pair Name | Corilagin, Paclitaxel | |||
Phytochemical Name | Corilagin | |||
Anticancer drug Name | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | Our observations indicate that corilagin sensitized epithelial ovarian cancer cells to paclitaxel and carboplatin treatment by primarily inhibiting Snail-glycolysis pathways. Corilagin is a herbal medicine with low toxic effects to normal cells, particularly hepatoprotective, and may be an ideal complimentary medicine when combined with highly toxic chemotherapeutic agents. |
Pair Name | Lupeol, Paclitaxel | |||
Phytochemical Name | Lupeol | |||
Anticancer drug Name | Paclitaxel | |||
Disease Info | [ICD-11: 2B66.0] | Oral squamous cell carcinoma | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | Our findings elucidated mechanistic underpinning of hypoxia induced Laminin-5γ2 driven VM formation highlighting that Lupeol-Paclitaxel combination may serve as novel therapeutic intervention in perturbation of VM in human OSCC. |
Pair Name | Apigenin, Doxorubicin | |||
Phytochemical | Apigenin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells |
Pair Name | Beta-Elemene, Cetuximab | |||
Phytochemical | Beta-Elemene | |||
Drug | Cetuximab | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | natural product β-elemene is a new ferroptosis inducer and combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant CRC cells by inducing ferroptosis and inhibiting EMT, which will hopefully provide a prospective strategy for CRC patients with RAS mutations. |
Pair Name | Beta-Elemene, Gefitinib | |||
Phytochemical | Beta-Elemene | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | The findings may have potential implications for treating aggressive and resistant lung cancers. |
Pair Name | Beta-Sitosterol, Gemcitabine | |||
Phytochemical | Beta-Sitosterol | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | β-Sitosterol and Gemcitabine Exhibit Synergistic Anti-pancreatic Cancer Activity by Modulating Apoptosis and Inhibiting Epithelial-Mesenchymal Transition by Deactivating Akt/GSK-3β Signaling |
Pair Name | Curcumol, Cisplatin | |||
Phytochemical | Curcumol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | The findings may offer new thoughts that curcumol in combination with cisplatin might be a useful strategy for GC management. |
Pair Name | Fisetin, Sorafenib | |||
Phytochemical | Fisetin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | Our findings demonstrate that fisetin potentiates the anti-invasive and anti-metastatic effects of sorafenib. Our data suggest that fisetin may be a worthy adjuvant chemotherapy for the management of melanoma. |
Pair Name | Garcinol, Paclitaxel | |||
Phytochemical | Garcinol | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model |
Pair Name | Lupeol, Fluorouracil | |||
Phytochemical | Lupeol | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | These data lay the foundation for the clinical validation of this combination therapy for TNBC patients. |
Pair Name | Neferine, Vitamin D3 | |||
Phytochemical | Neferine | |||
Drug | Vitamin D3 | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | These data suggest that neferine enhances the anticancer capability of VD3 and reduces the dose dependency of VD3. The combination of vitamin D with neferine appears to be a potential therapeutic strategy for CRC. |
Pair Name | Shogaol, Gefitinib | |||
Phytochemical | Shogaol | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C73] | Ovarian Cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | Our results suggest that 6-shogaol exerts a potential anti-cancer effect in ovarian cancer and combination treatment with 6-shogaol and gefitinib may provide a novel anti-tumor therapeutic strategy in gefitinib-resistant ovarian cancer. |
Pair Name | Sulforaphane, CB-5083 | |||
Phytochemical | Sulforaphane | |||
Drug | CB-5083 | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | The combination of Sulforaphane and CB-5083 may be a useful treatment strategy to combat CB-5083 resistance. |
Pair Name | Sulforaphane, Cisplatin | |||
Phytochemical | Sulforaphane | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | The results of the current study suggests that CIS when supplemented with SFN, inhibits metastasis and stemness potential of TNBC cells by down regulating SIRTs-mediated EMT cascade. Overall this study affirms that, this novel combination could be a promising strategy against SIRT-mediated TNBC metastasis and CIS-resistance. |
Pair Name | Toosendanin, Paclitaxel | |||
Phytochemical | Toosendanin | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | The results suggest that combination of TSN and PTX is superior to PTX alone, suggesting that it may be a promising alternative adjuvant chemotherapy strategy for patients with TNBC, especially those with metastatic TNBC. |
Pair Name | Isocorydine, Gemcitabine | |||
Phytochemical | Isocorydine | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | The synergistic treatment effect of the combination treatment of ICD and gemcitabine in pancreatic cancer cells was confirmed in established xenograft models. |
Pair Name | Sclareol, Cisplatin | |||
Phytochemical | Sclareol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | Sclareol has potential as an adjuvant for the treatment in NSCLC patients with cisplatin resistance. |
Pair Name | Triptolide, Gefitinib | |||
Phytochemical | Triptolide | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Zinc finger protein SNAI1 | Expression | |
Result | The present results indicated that the combination of TP and TKIs may be a promising therapeutic strategy to treat patients with NSCLCs harboring EGFR mutations. |
No. | Title | Href |
---|---|---|
1 | Corilagin sensitizes epithelial ovarian cancer to chemotherapy by inhibiting Snail‑glycolysis pathways. Oncol Rep. 2017 Oct;38(4):2464-2470. doi: 10.3892/or.2017.5886. | Click |
2 | Lupeol and Paclitaxel cooperate in hindering hypoxia induced vasculogenic mimicry via suppression of HIF-1α-EphA2-Laminin-5γ2 network in human oral cancer. J Cell Commun Signal. 2023 Sep;17(3):591-608. doi: 10.1007/s12079-022-00693-z. | Click |
3 | Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells. Exp Oncol. 2021 Jun;43(2):125-134. doi: 10.32471/exp-oncology.2312-8852.vol-43-no-2.16096. | Click |
4 | Combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant colorectal cancer cells by inducing ferroptosis and inhibiting epithelial-mesenchymal transformation. Theranostics. 2020;10(11):5107-5119. Published 2020 Apr 6. doi:10.7150/thno.44705 | Click |
5 | β-Elemene Synergizes With Gefitinib to Inhibit Stem-Like Phenotypes and Progression of Lung Cancer via Down-Regulating EZH2. Front Pharmacol. 2018 Nov 30;9:1413. doi: 10.3389/fphar.2018.01413. | Click |
6 | β-Sitosterol and Gemcitabine Exhibit Synergistic Anti-Pancreatic Cancer Activity by Modulating Apoptosis and Inhibiting Epithelial-Mesenchymal Transition by Deactivating Akt/GSK-3β Signaling. Front Pharmacol. 2020 Nov 20;11:565535. doi: 10.3389/fphar.2020.565535. | Click |
7 | Curcumol enhances cisplatin sensitivity of gastric cancer: involvement of microRNA-7 and the nuclear factor-kappa B/snail family transcriptional repressor 1 axis. Bioengineered. 2022 May;13(5):11668-11683. doi: 10.1080/21655979.2022.2070975. | Click |
8 | Fisetin, a dietary flavonoid, augments the anti-invasive and anti-metastatic potential of sorafenib in melanoma. Oncotarget. 2016 Jan 12;7(2):1227-41. doi: 10.18632/oncotarget.6237. | Click |
9 | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. | Click |
10 | Lupeol synergizes with 5-fluorouracil to combat c-MET/EphA2 mediated chemoresistance in triple negative breast cancer. iScience. 2023 Nov 4;26(12):108395. doi: 10.1016/j.isci.2023.108395. | Click |
11 | Combined effects of vitamin D and neferine on the progression and metastasis of colorectal cancer. J Cancer Res Clin Oncol. 2023 Aug;149(9):6203-6210. doi: 10.1007/s00432-022-04552-7. | Click |
12 | 6-Shogaol Overcomes Gefitinib Resistance via ER Stress in Ovarian Cancer Cells. Int J Mol Sci. 2023 Jan 30;24(3):2639. doi: 10.3390/ijms24032639. | Click |
13 | Sulforaphane is Synergistic with CB-5083 and Inhibits Colony Formation of CB-5083-Resistant HCT116 Cells. ChemMedChem. 2022 Jun 3;17(11):e202200030. doi: 10.1002/cmdc.202200030. | Click |
14 | Sulforaphane-cisplatin combination inhibits the stemness and metastatic potential of TNBCs via down regulation of sirtuins-mediated EMT signaling axis. Phytomedicine. 2021 Apr;84:153492. doi: 10.1016/j.phymed.2021.153492. | Click |
15 | Synergistic Anti-Tumor Effect of Toosendanin and Paclitaxel on Triple-Negative Breast Cancer via Regulating ADORA2A-EMT Related Signaling. Adv Biol (Weinh). 2023 Aug;7(8):e2300062. doi: 10.1002/adbi.202300062. | Click |
16 | Isocorydine decrease gemcitabine-resistance by inhibiting epithelial-mesenchymal transition via STAT3 in pancreatic cancer cells. Am J Transl Res. 2020 Jul 15;12(7):3702-3714. | Click |
17 | Sclareol ameliorated ERCC1-mediated cisplatin resistance in A549 human lung adenocarcinoma cells and a murine xenograft tumor model by suppressing AKT-GSK3β-AP1/Snail and JNK-AP1 pathways. Chem Biol Interact. 2020 Dec 1;332:109304. doi: 10.1016/j.cbi.2020.109304. | Click |
18 | Triptolide inhibits epithelial‑mesenchymal transition and induces apoptosis in gefitinib‑resistant lung cancer cells. Oncol Rep. 2020 May;43(5):1569-1579. doi: 10.3892/or.2020.7542. | Click |