TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Zinc finger protein SNAI1
UniProt ID SNAI1_HUMAN
Gene Name SNAI1
Gene ID 6615
Synonyms
SNAI1, SLUGH2, SNA, SNAH, SNAIL, SNAIL1, dJ710H13.1
Sequence
MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLI
WDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSS
LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPC
VCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQA
CARTFSRMSLLHKHQESGCSGCPR
Pathway Map MAP LINK
KEGG ID hsa6615
Pfam PF00096; PF01155; PF05129; PF05605; PF09723; PF12171; PF12874; PF13465; PF13894; PF13912; PF13913; PF16278
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 446
Pair Name Corilagin, Paclitaxel
Phytochemical Name Corilagin
Anticancer drug Name Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result Our observations indicate that corilagin sensitized epithelial ovarian cancer cells to paclitaxel and carboplatin treatment by primarily inhibiting Snail-glycolysis pathways. Corilagin is a herbal medicine with low toxic effects to normal cells, particularly hepatoprotective, and may be an ideal complimentary medicine when combined with highly toxic chemotherapeutic agents.
Combination Pair ID: 1025
Pair Name Lupeol, Paclitaxel
Phytochemical Name Lupeol
Anticancer drug Name Paclitaxel
Disease Info [ICD-11: 2B66.0] Oral squamous cell carcinoma Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result Our findings elucidated mechanistic underpinning of hypoxia induced Laminin-5γ2 driven VM formation highlighting that Lupeol-Paclitaxel combination may serve as novel therapeutic intervention in perturbation of VM in human OSCC.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 76
Pair Name Apigenin, Doxorubicin
Phytochemical Apigenin
Drug Doxorubicin
Disease Info [ICD-11: 2C82] Prostate cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells
Combination Pair ID: 585
Pair Name Beta-Elemene, Cetuximab
Phytochemical Beta-Elemene
Drug Cetuximab
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result natural product β-elemene is a new ferroptosis inducer and combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant CRC cells by inducing ferroptosis and inhibiting EMT, which will hopefully provide a prospective strategy for CRC patients with RAS mutations.
Combination Pair ID: 708
Pair Name Beta-Elemene, Gefitinib
Phytochemical Beta-Elemene
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result The findings may have potential implications for treating aggressive and resistant lung cancers.
Combination Pair ID: 348
Pair Name Beta-Sitosterol, Gemcitabine
Phytochemical Beta-Sitosterol
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result β-Sitosterol and Gemcitabine Exhibit Synergistic Anti-pancreatic Cancer Activity by Modulating Apoptosis and Inhibiting Epithelial-Mesenchymal Transition by Deactivating Akt/GSK-3β Signaling
Combination Pair ID: 226
Pair Name Curcumol, Cisplatin
Phytochemical Curcumol
Drug Cisplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result The findings may offer new thoughts that curcumol in combination with cisplatin might be a useful strategy for GC management.
Combination Pair ID: 632
Pair Name Fisetin, Sorafenib
Phytochemical Fisetin
Drug Sorafenib
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result Our findings demonstrate that fisetin potentiates the anti-invasive and anti-metastatic effects of sorafenib. Our data suggest that fisetin may be a worthy adjuvant chemotherapy for the management of melanoma.
Combination Pair ID: 435
Pair Name Garcinol, Paclitaxel
Phytochemical Garcinol
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model
Combination Pair ID: 1027
Pair Name Lupeol, Fluorouracil
Phytochemical Lupeol
Drug Fluorouracil
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result These data lay the foundation for the clinical validation of this combination therapy for TNBC patients.
Combination Pair ID: 457
Pair Name Neferine, Vitamin D3
Phytochemical Neferine
Drug Vitamin D3
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result These data suggest that neferine enhances the anticancer capability of VD3 and reduces the dose dependency of VD3. The combination of vitamin D with neferine appears to be a potential therapeutic strategy for CRC.
Combination Pair ID: 461
Pair Name Shogaol, Gefitinib
Phytochemical Shogaol
Drug Gefitinib
Disease Info [ICD-11: 2C73] Ovarian Cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result Our results suggest that 6-shogaol exerts a potential anti-cancer effect in ovarian cancer and combination treatment with 6-shogaol and gefitinib may provide a novel anti-tumor therapeutic strategy in gefitinib-resistant ovarian cancer.
Combination Pair ID: 545
Pair Name Sulforaphane, CB-5083
Phytochemical Sulforaphane
Drug CB-5083
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result The combination of Sulforaphane and CB-5083 may be a useful treatment strategy to combat CB-5083 resistance.
Combination Pair ID: 541
Pair Name Sulforaphane, Cisplatin
Phytochemical Sulforaphane
Drug Cisplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result The results of the current study suggests that CIS when supplemented with SFN, inhibits metastasis and stemness potential of TNBC cells by down regulating SIRTs-mediated EMT cascade. Overall this study affirms that, this novel combination could be a promising strategy against SIRT-mediated TNBC metastasis and CIS-resistance.
Combination Pair ID: 1024
Pair Name Toosendanin, Paclitaxel
Phytochemical Toosendanin
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result The results suggest that combination of TSN and PTX is superior to PTX alone, suggesting that it may be a promising alternative adjuvant chemotherapy strategy for patients with TNBC, especially those with metastatic TNBC.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 498
Pair Name Isocorydine, Gemcitabine
Phytochemical Isocorydine
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result The synergistic treatment effect of the combination treatment of ICD and gemcitabine in pancreatic cancer cells was confirmed in established xenograft models.
Combination Pair ID: 259
Pair Name Sclareol, Cisplatin
Phytochemical Sclareol
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result Sclareol has potential as an adjuvant for the treatment in NSCLC patients with cisplatin resistance.
Combination Pair ID: 153
Pair Name Triptolide, Gefitinib
Phytochemical Triptolide
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Zinc finger protein SNAI1 Expression
Result The present results indicated that the combination of TP and TKIs may be a promising therapeutic strategy to treat patients with NSCLCs harboring EGFR mutations.
03. Reference
No. Title Href
1 Corilagin sensitizes epithelial ovarian cancer to chemotherapy by inhibiting Snail‑glycolysis pathways. Oncol Rep. 2017 Oct;38(4):2464-2470. doi: 10.3892/or.2017.5886. Click
2 Lupeol and Paclitaxel cooperate in hindering hypoxia induced vasculogenic mimicry via suppression of HIF-1α-EphA2-Laminin-5γ2 network in human oral cancer. J Cell Commun Signal. 2023 Sep;17(3):591-608. doi: 10.1007/s12079-022-00693-z. Click
3 Co-administration of apigenin with doxorubicin enhances anti-migration and antiproliferative effects via PI3K/PTEN/AKT pathway in prostate cancer cells. Exp Oncol. 2021 Jun;43(2):125-134. doi: 10.32471/exp-oncology.2312-8852.vol-43-no-2.16096. Click
4 Combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant colorectal cancer cells by inducing ferroptosis and inhibiting epithelial-mesenchymal transformation. Theranostics. 2020;10(11):5107-5119. Published 2020 Apr 6. doi:10.7150/thno.44705 Click
5 β-Elemene Synergizes With Gefitinib to Inhibit Stem-Like Phenotypes and Progression of Lung Cancer via Down-Regulating EZH2. Front Pharmacol. 2018 Nov 30;9:1413. doi: 10.3389/fphar.2018.01413. Click
6 β-Sitosterol and Gemcitabine Exhibit Synergistic Anti-Pancreatic Cancer Activity by Modulating Apoptosis and Inhibiting Epithelial-Mesenchymal Transition by Deactivating Akt/GSK-3β Signaling. Front Pharmacol. 2020 Nov 20;11:565535. doi: 10.3389/fphar.2020.565535. Click
7 Curcumol enhances cisplatin sensitivity of gastric cancer: involvement of microRNA-7 and the nuclear factor-kappa B/snail family transcriptional repressor 1 axis. Bioengineered. 2022 May;13(5):11668-11683. doi: 10.1080/21655979.2022.2070975. Click
8 Fisetin, a dietary flavonoid, augments the anti-invasive and anti-metastatic potential of sorafenib in melanoma. Oncotarget. 2016 Jan 12;7(2):1227-41. doi: 10.18632/oncotarget.6237. Click
9 Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. Click
10 Lupeol synergizes with 5-fluorouracil to combat c-MET/EphA2 mediated chemoresistance in triple negative breast cancer. iScience. 2023 Nov 4;26(12):108395. doi: 10.1016/j.isci.2023.108395. Click
11 Combined effects of vitamin D and neferine on the progression and metastasis of colorectal cancer. J Cancer Res Clin Oncol. 2023 Aug;149(9):6203-6210. doi: 10.1007/s00432-022-04552-7. Click
12 6-Shogaol Overcomes Gefitinib Resistance via ER Stress in Ovarian Cancer Cells. Int J Mol Sci. 2023 Jan 30;24(3):2639. doi: 10.3390/ijms24032639. Click
13 Sulforaphane is Synergistic with CB-5083 and Inhibits Colony Formation of CB-5083-Resistant HCT116 Cells. ChemMedChem. 2022 Jun 3;17(11):e202200030. doi: 10.1002/cmdc.202200030. Click
14 Sulforaphane-cisplatin combination inhibits the stemness and metastatic potential of TNBCs via down regulation of sirtuins-mediated EMT signaling axis. Phytomedicine. 2021 Apr;84:153492. doi: 10.1016/j.phymed.2021.153492. Click
15 Synergistic Anti-Tumor Effect of Toosendanin and Paclitaxel on Triple-Negative Breast Cancer via Regulating ADORA2A-EMT Related Signaling. Adv Biol (Weinh). 2023 Aug;7(8):e2300062. doi: 10.1002/adbi.202300062. Click
16 Isocorydine decrease gemcitabine-resistance by inhibiting epithelial-mesenchymal transition via STAT3 in pancreatic cancer cells. Am J Transl Res. 2020 Jul 15;12(7):3702-3714. Click
17 Sclareol ameliorated ERCC1-mediated cisplatin resistance in A549 human lung adenocarcinoma cells and a murine xenograft tumor model by suppressing AKT-GSK3β-AP1/Snail and JNK-AP1 pathways. Chem Biol Interact. 2020 Dec 1;332:109304. doi: 10.1016/j.cbi.2020.109304. Click
18 Triptolide inhibits epithelial‑mesenchymal transition and induces apoptosis in gefitinib‑resistant lung cancer cells. Oncol Rep. 2020 May;43(5):1569-1579. doi: 10.3892/or.2020.7542. Click
It has been 58746 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP