| Name | Ribosomal protein S6 kinase beta-1 | ||
| UniProt ID | KS6B1_HUMAN | ||
| Gene Name | RPS6KB1 | ||
| Gene ID | 6198 | ||
| Synonyms |
RPS6KB1, PS6K, S6K, S6K-beta-1, S6K1, STK14A, p70_S6KA, p70(S6K)-alpha, p70-S6K, p70-alpha
|
||
| Sequence |
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa6198 | ||
| TTD ID | T94479 | ||
| Pfam | PF00069; PF00433; PF03109; PF06245; PF07714; PF14531 | ||
| Pair Name | Biochanin A, SB590885 | |||
| Phytochemical Name | Biochanin A | |||
| Anticancer drug Name | SB590885 | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | The results identify an effective combination therapy for the most aggressive form of HCC and provide the possibility of therapeutic improvement for patients with advanced HCC. | |||
| Pair Name | Bisdemethoxycucurmin, Rapamycin | |||
| Phytochemical | Bisdemethoxycucurmin | |||
| Drug | Rapamycin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Activity | |
| Result | Bisdemethoxycurcumin Promotes Apoptosis and Inhibits the Epithelial-Mesenchymal Transition through the Inhibition of the G-Protein-Coupled Receptor 161/Mammalian Target of Rapamycin Signaling Pathway in Triple Negative Breast Cancer Cells. | |||
| Pair Name | Brusatol, Cabergoline | |||
| Phytochemical | Brusatol | |||
| Drug | Cabergoline | |||
| Disease Info | [ICD-11: 2F37] | Pituitary adenomas | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | Combined use of CAB and BT may increase the clinical effectiveness of treatment for human pituitary adenomas. | |||
| Pair Name | Capsaicin, Fluorouracil | |||
| Phytochemical | Capsaicin | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2C17] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | These results demonstrate that capsaicin may be a useful adjunct therapy to improve chemosensitivity in CCA. This effect likely occurs via PI3K/AKT/mTOR pathway activation, suggesting a promising strategy for the development of combination drugs for CCA. | |||
| Pair Name | Cordycepin, Cisplatin | |||
| Phytochemical | Cordycepin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | This study provides comprehensive evidence that cordycepin inhibits osteosarcoma cell growth and invasion and induces osteosarcoma cell apoptosis by activating AMPK and inhibiting the AKT/mTOR signaling pathway and enhances the sensitivity of osteosarcoma cells to cisplatin, suggesting that cordycepin is a promising treatment for osteosarcoma. | |||
| Pair Name | Decursin, Doxorubicin | |||
| Phytochemical | Decursin | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2A83] | Multiple myeloma | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | The combination treatment of decursin and doxorubicin can enhance apoptotic activity via mTOR and/or STAT3 signaling pathway in multiple myeloma cells. | |||
| Pair Name | Emodin, Cytarabine | |||
| Phytochemical | Emodin | |||
| Drug | Cytarabine | |||
| Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | Emodin and its combination with Ara-C may be considered a promising therapeutic approach in AML and worthy of further investigation. | |||
| Pair Name | Fisetin, Fluorouracil | |||
| Phytochemical | Fisetin | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer | |||
| Pair Name | Gossypol, Fluorouracil | |||
| Phytochemical | Gossypol | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | These findings suggest that gossypol-mediated down-regulation of TS, cyclin D1, and the mTOR/p70S6K1 signaling pathways enhances the anti-tumor effect of 5-FU. Ultimately, our data exposed a new action for gossypol as an enhancer of 5-FU-induced cell growth suppression. | |||
| Pair Name | Isorhamnetin, Doxorubicin | |||
| Phytochemical | Isorhamnetin | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Expression | |
| Result | Isorhamnetin induces cell cycle arrest and apoptosis by triggering DNA damage and regulating the AMPK/mTOR/p70S6K signaling pathway in doxorubicin-resistant breast cancer | |||
| Pair Name | Licochalcone B, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Licochalcone B | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC. | |||
| Pair Name | Magnolin, B-RAF Inhibitors | |||
| Phytochemical | Magnolin | |||
| Drug | B-RAF Inhibitors | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway | |||
| Pair Name | Resveratrol, Rapamycin | |||
| Phytochemical | Resveratrol | |||
| Drug | Rapamycin | |||
| Disease Info | [ICD-11: 2D10.1] | Papillary thyroid cancer | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | The present study suggests that the combination of rapamycin and resveratrol may be a promising strategy for the treatment of papillary thyroid cancer. | |||
| Pair Name | Resveratrol, Sorafenib | |||
| Phytochemical | Resveratrol | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C90.0] | Renal cell carcinoma | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | PEGylated resveratrol combined with sorafenib can achieve synergistic anti-RCC activity, and the mechanism may be related to the inhibition of Akt/mTOR/p70S6k-4EBP-1 and c-Raf7MEK/ERK signaling pathways. | |||
| Pair Name | Shikonin, BEZ235 | |||
| Phytochemical | Shikonin | |||
| Drug | BEZ235 | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | We found that low doses shikonin and dual PI3K-mTOR inhibitor (BEZ235) have a synergistic effect that inhibits the spheroid formation from chemoresistant lung cancer sublines. Inhibiting the proliferation of lung cancer stem cells is believed to reduce the recurrence of lung cancer; therefore, shikonin's anti-drug resistance and anti-cancer stem cell activities make it a highly interesting molecule for future combined lung cancer therapy. | |||
| Pair Name | Sulforaphane, PP242 | |||
| Phytochemical | Sulforaphane | |||
| Drug | PP242 | |||
| Disease Info | [ICD-11: 2B70] | Esophageal cancer | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | Our findings demonstrate that PP242 enhances the anti-tumor activity of SFN by blocking SFN-induced activation of Akt/mTOR pathway in ESCC, which provides a rationale for treating ESCC using SFN combined with Akt/mTOR pathway inhibitors. | |||
| Pair Name | Cordycepin, Cisplatin | |||
| Phytochemical | Cordycepin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | Our results suggested that Cor in combination with DDP could be an additional therapeutic option for the treatment of DDP-resistant NSCLC. | |||
| Pair Name | Honokiol, Metformin | |||
| Phytochemical | Honokiol | |||
| Drug | Metformin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Ribosomal protein S6 kinase beta-1 | Phosphorylation | |
| Result | The combination of honokiol with metformin is considered an effective approach to induce death in hormone-resistant cells. Honokiol is of interest as a natural compound with antiproliferative activity against breast cancers, including resistant tumors. | |||
| No. | Title | Href |
|---|---|---|
| 1 | The combination of Biochanin A and SB590885 potentiates the inhibition of tumour progression in hepatocellular carcinoma. Cancer Cell Int. 2020 Aug 5;20:371. doi: 10.1186/s12935-020-01463-w. | Click |
| 2 | Bisdemethoxycurcumin Promotes Apoptosis and Inhibits the Epithelial-Mesenchymal Transition through the Inhibition of the G-Protein-Coupled Receptor 161/Mammalian Target of Rapamycin Signaling Pathway in Triple Negative Breast Cancer Cells. J Agric Food Chem. 2021 Dec 8;69(48):14557-14567. doi: 10.1021/acs.jafc.1c05585. | Click |
| 3 | Brusatol Inhibits Tumor Growth and Increases the Efficacy of Cabergoline against Pituitary Adenomas. Oxid Med Cell Longev. 2021 Jun 16;2021:6696015. doi: 10.1155/2021/6696015. | Click |
| 4 | Capsaicin Enhances the Drug Sensitivity of Cholangiocarcinoma through the Inhibition of Chemotherapeutic-Induced Autophagy. PLoS One. 2015 May 1;10(5):e0121538. doi: 10.1371/journal.pone.0121538. | Click |
| 5 | Cordycepin augments the chemosensitivity of osteosarcoma to cisplatin by activating AMPK and suppressing the AKT signaling pathway. Cancer Cell Int. 2021 Dec 25;21(1):706. doi: 10.1186/s12935-021-02411-y. | Click |
| 6 | Decursin and Doxorubicin Are in Synergy for the Induction of Apoptosis via STAT3 and/or mTOR Pathways in Human Multiple Myeloma Cells. Evid Based Complement Alternat Med. 2013;2013:506324. doi: 10.1155/2013/506324. | Click |
| 7 | Emodin and Its Combination with Cytarabine Induce Apoptosis in Resistant Acute Myeloid Leukemia Cells in Vitro and in Vivo. Cell Physiol Biochem. 2018;48(5):2061-2073. doi: 10.1159/000492544. | Click |
| 8 | Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer. Int J Cancer. 2019 Dec 1;145(11):3022-3032. doi: 10.1002/ijc.32367. | Click |
| 9 | Gossypol sensitizes the antitumor activity of 5-FU through down-regulation of thymidylate synthase in human colon carcinoma cells. Cancer Chemother Pharmacol. 2015 Sep;76(3):575-86. doi: 10.1007/s00280-015-2749-0. | Click |
| 10 | Isorhamnetin induces cell cycle arrest and apoptosis by triggering DNA damage and regulating the AMPK/mTOR/p70S6K signaling pathway in doxorubicin-resistant breast cancer. Phytomedicine. 2023 Jun;114:154780. doi: 10.1016/j.phymed.2023.154780. | Click |
| 11 | Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. | Click |
| 12 | Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway. Am J Transl Res. 2019 Jun 15;11(6):3816-3824. | Click |
| 13 | Resveratrol potentiates the anti-tumor effects of rapamycin in papillary thyroid cancer: PI3K/AKT/mTOR pathway involved. Arch Biochem Biophys. 2020 Aug 15;689:108461. doi: 10.1016/j.abb.2020.108461. | Click |
| 14 | Synergistic anti-tumour activity of sorafenib in combination with pegylated resveratrol is mediated by Akt/mTOR/p70S6k-4EBP-1 and c-Raf7MEK/ERK signaling pathways. Heliyon. 2023 Aug 19;9(8):e19154. doi: 10.1016/j.heliyon.2023.e19154. | Click |
| 15 | Attenuation of PI3K-Akt-mTOR Pathway to Reduce Cancer Stemness on Chemoresistant Lung Cancer Cells by Shikonin and Synergy with BEZ235 Inhibitor. Int J Mol Sci. 2024 Jan 3;25(1):616. doi: 10.3390/ijms25010616. | Click |
| 16 | mTOR inhibitor PP242 increases antitumor activity of sulforaphane by blocking Akt/mTOR pathway in esophageal squamous cell carcinoma. Mol Biol Rep. 2022 Jan;49(1):451-461. doi: 10.1007/s11033-021-06895-9. | Click |
| 17 | Cordycepin Reverses Cisplatin Resistance in Non-small Cell Lung Cancer by Activating AMPK and Inhibiting AKT Signaling Pathway. Front Cell Dev Biol. 2021 Jan 15;8:609285. doi: 10.3389/fcell.2020.609285. | Click |
| 18 | Honokiol inhibits the growth of hormone-resistant breast cancer cells: its promising effect in combination with metformin. Res Pharm Sci. 2023 Aug 20;18(5):580-591. doi: 10.4103/1735-5362.383712. | Click |
