TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Tumor necrosis factor receptor superfamily member 10A
UniProt ID TR10A_HUMAN
Gene Name TNFRSF10A
Gene ID 8797
Synonyms
TNFRSF10A, APO2, CD261, DR4, TRAILR-1, TRAILR1
Sequence
MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMG
QHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGT
QQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPC
TTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNI
WVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEIL
SNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADP
TETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTG
RNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE
Pathway Map MAP LINK
KEGG ID hsa8797
TTD ID T77645
Pfam PF00020; PF00531; PF20481
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 68
Pair Name Kaempferol, TNF-related apoptosis inducing ligand
Phytochemical Kaempferol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A20.1] Chronic myelogenous leukemia Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result It is reasonable to conclude that sensitization of chronic leukemia cells to TRAIL by kaempferol in vitro should be considered as a way of focusing clinical attention on leukemia therapy.
Combination Pair ID: 102
Pair Name Isoquercitrin, TNF-related apoptosis inducing ligand
Phytochemical Isoquercitrin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result We found that isoquercitrin enhances the mRNA expression of TRAIL-Rs, but the percentage of apoptosis was meager, possibly due to the influence of other anti-apoptotic proteins.
Combination Pair ID: 107
Pair Name Liquiritin, TNF-related apoptosis inducing ligand
Phytochemical Liquiritin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation
Combination Pair ID: 113
Pair Name Butein, TNF-related apoptosis inducing ligand
Phytochemical Butein
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result Our data suggests that combined treatment with butein and TRAIL may provide a safe and effective strategy for treating cancer.
Combination Pair ID: 116
Pair Name Morin, Auranofin
Phytochemical Morin
Drug Auranofin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result This study provides evidence that morin can enhance the anticancer activity of AF in Hep3B human hepatocellular carcinoma cells, indicating that its combination could be an alternative treatment strategy for the hepatocellular carcinoma.
Combination Pair ID: 664
Pair Name Epigallocatechin gallate, TNF-related apoptosis inducing ligand
Phytochemical Epigallocatechin gallate
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result EGCG enhances TRAIL-mediated apoptosis in human melanoma A375 cell line
Combination Pair ID: 129
Pair Name Licochalcone B, TNF-related apoptosis inducing ligand
Phytochemical Licochalcone B
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC.
Combination Pair ID: 296
Pair Name Tanshinone IIA, TNF-related apoptosis inducing ligand
Phytochemical Tanshinone IIA
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result T-IIA increases TRAIL-induced apoptosis by downregulating STAT3 and upregulating DR4 and DR5, indicating T-IIA therapy as a novel treatment strategy for TRAIL-resistant GBM.
Combination Pair ID: 305
Pair Name Thymoquinone, TNF-related apoptosis inducing ligand
Phytochemical Thymoquinone
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result The synergistic influence between TQ which induced the DR5 and TRAIL, facilitating the connection between TRAIL and its receptors on the cancerous cell membrane. Hence, the proposed combination therapy induced the ROS-mediated apoptotic stimulus.
Combination Pair ID: 345
Pair Name Gomisin N, TNF-related apoptosis inducing ligand
Phytochemical Gomisin N
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result Our results indicated that gomisin N was able to potentiate TRAIL-induced apoptosis through ROS-mediated up-regulation of DR4 and DR5.
Combination Pair ID: 788
Pair Name Bufalin, TNF-related apoptosis inducing ligand
Phytochemical Bufalin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result Bufalin enhanced TRAIL-induced apoptosis by up-regulating the expression of DR4 and DR5. Bufalin-induced down-regulation of Cbl-b contributed to the up-regulation of DR4 and DR5, which might be partially mediated by the activation of ERK, JNK and p38 MAPK.
Combination Pair ID: 802
Pair Name Pterostilbene, TNF-related apoptosis inducing ligand
Phytochemical Pterostilbene
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result Pterostilbene enhances TRAIL-induced apoptosis through the induction of death receptors and downregulation of cell survival proteins in TRAIL-resistance triple negative breast cancer cells
Combination Pair ID: 856
Pair Name Kaempferol, TNF-related apoptosis inducing ligand
Phytochemical Kaempferol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result The co-treatment induced no apoptosis in normal human peripheral blood mononuclear cells and little apoptosis in normal human hepatocytes. These results suggest that kaempferol is useful for TRAIL-based treatments for cancer.
Combination Pair ID: 450
Pair Name Naringenin, AMG-951
Phytochemical Naringenin
Drug AMG-951
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result The present study provides a novel therapeutic strategy for glioma by potentiating APO2L-induced apoptosis via the combination with NG in glioma tumor cells.
Combination Pair ID: 479
Pair Name Bakuchiol, TNF-related apoptosis inducing ligand
Phytochemical Bakuchiol
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result The collective results suggest that bakuchiol facilitates TRAIL-induced apoptosis in colon cancer cells through up-regulation of the TRAIL receptors; DR4 and DR5 via ROS/JNK pathway signals.
Combination Pair ID: 611
Pair Name Periplocin, TNF-related apoptosis inducing ligand
Phytochemical Periplocin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway
Combination Pair ID: 960
Pair Name Periplocin, TNF-related apoptosis inducing ligand
Phytochemical Periplocin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B70.1] Esophageal squamous cell carcinoma Investigative
Regulate Info Up-regulation Tumor necrosis factor receptor superfamily member 10A Expression
Result Our data suggest that CPP and TRAIL could be further explored as potential therapeutic approach for esophageal cancer.
03. Reference
No. Title Href
1 Kaempferol sensitizes tumor necrosis factor-related apoptosis-inducing ligand-resistance chronic myelogenous leukemia cells to apoptosis. Mol Biol Rep. 2022 Jan;49(1):19-29. doi: 10.1007/s11033-021-06778-z. Click
2 Effects of A.marina-Derived Isoquercitrin on TNF-Related Apoptosis-Inducing Ligand Receptor (TRAIL-R) Expression and Apoptosis Induction in Cervical Cancer Cells. Appl Biochem Biotechnol. 2017 Jun;182(2):697-707. doi: 10.1007/s12010-016-2355-6. Click
3 Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation. Biomed Pharmacother. 2017 Sep;93:948-960. doi: 10.1016/j.biopha.2017.06.095. Click
4 Butein sensitizes human leukemia cells to apoptosis induced by tumor necrosis factor-related apoptosis inducing ligand (TRAIL). Arch Pharm Res. 2008 Sep;31(9):1179-86. doi: 10.1007/s12272-001-1286-2. Click
5 Morin enhances auranofin anticancer activity by up-regulation of DR4 and DR5 and modulation of Bcl-2 through reactive oxygen species generation in Hep3B human hepatocellular carcinoma cells. Phytother Res. 2019 May;33(5):1384-1393. doi: 10.1002/ptr.6329. Click
6 EGCG enhances TRAIL-mediated apoptosis in human melanoma A375 cell line. J Huazhong Univ Sci Technolog Med Sci. 2009 Dec;29(6):771-5. doi: 10.1007/s11596-009-0620-4. Click
7 Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. Click
8 Tanshinone IIA sensitizes TRAIL-induced apoptosis in glioblastoma through inducing the expression of death receptors (and suppressing STAT3 activation). Brain Res. 2021 Sep 1;1766:147515. doi: 10.1016/j.brainres.2021.147515. Click
9 Thymoquinone Crosstalks with DR5 to Sensitize TRAIL Resistance and Stimulate ROS-Mediated Cancer Apoptosis. Asian Pac J Cancer Prev. 2021 Sep 1;22(9):2855-2865. doi: 10.31557/APJCP.2021.22.9.2855. Click
10 Gomisin N enhances TRAIL-induced apoptosis via reactive oxygen species-mediated up-regulation of death receptors 4 and 5. Int J Oncol. 2012 Apr;40(4):1058-65. doi: 10.3892/ijo.2011.1299. Click
11 Down-regulation of Cbl-b by bufalin results in up-regulation of DR4/DR5 and sensitization of TRAIL-induced apoptosis in breast cancer cells. J Cancer Res Clin Oncol. 2012 Aug;138(8):1279-89. doi: 10.1007/s00432-012-1204-4. Click
12 Pterostilbene Enhances TRAIL-Induced Apoptosis through the Induction of Death Receptors and Downregulation of Cell Survival Proteins in TRAIL-Resistance Triple Negative Breast Cancer Cells. J Agric Food Chem. 2017 Dec 27;65(51):11179-11191. doi: 10.1021/acs.jafc.7b02358. Click
13 Kaempferol sensitizes colon cancer cells to TRAIL-induced apoptosis. Biochem Biophys Res Commun. 2008 Oct 10;375(1):129-33. doi: 10.1016/j.bbrc.2008.07.131. Click
14 Glioma progression is suppressed by Naringenin and APO2L combination therapy via the activation of apoptosis in vitro and in vivo. Invest New Drugs. 2020 Dec;38(6):1743-1754. doi: 10.1007/s10637-020-00979-2. Click
15 Bakuchiol sensitizes cancer cells to TRAIL through ROS- and JNK-mediated upregulation of death receptors and downregulation of survival proteins. Biochem Biophys Res Commun. 2016 Apr 29;473(2):586-92. doi: 10.1016/j.bbrc.2016.03.127. Click
16 Antitumor Effect of Periplocin in TRAIL-Resistant gastric cancer cells via upregulation of death receptor through activating ERK1/2-EGR1 pathway. Mol Carcinog. 2019 Jun;58(6):1033-1045. doi: 10.1002/mc.22991. Click
17 Combination of the natural compound Periplocin and TRAIL induce esophageal squamous cell carcinoma apoptosis in vitro and in vivo: Implication in anticancer therapy. J Exp Clin Cancer Res. 2019 Dec 21;38(1):501. doi: 10.1186/s13046-019-1498-z. Click
It has been 549371 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP