| Name | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | ||
| UniProt ID | AAPK1_HUMAN | ||
| Gene Name | PRKAA1 | ||
| Gene ID | 5562 | ||
| Synonyms |
PRKAA1, AMPK, AMPK_alpha_1, AMPKa1
|
||
| Sequence |
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG SHTIEFFEMCANLIKILAQ |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa5562 | ||
| Pfam | PF00069; PF01636; PF03109; PF06293; PF07714; PF14531; PF16579; PF21147 | ||
| Pair Name | Artesunate, Fluorouracil | |||
| Phytochemical Name | Artesunate | |||
| Anticancer drug Name | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | Our findings point to the crucial treatment effect of Arte on inflammation, intestinal cell senescence, and CRC cell proliferation and offer a new option for CRC treatment. | |||
| Pair Name | alpha-Hydroxylinoleic acid, Paclitaxel | |||
| Phytochemical | alpha-Hydroxylinoleic acid | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | The safety profile of ABTL0812 and its good synergy with chemotherapy potentiate the therapeutic potential of current lines of treatment based on chemotherapy regimens, arising as a promising option for improving these patients therapeutic expectancy. | |||
| Pair Name | alpha-Mangostin, Gemcitabine | |||
| Phytochemical | alpha-Mangostin | |||
| Drug | Gemcitabine | |||
| Disease Info | [ICD-11: 2C13] | Gallbladder cancer | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | α-Mangostin suppresses the de novo lipogenesis and enhances the chemotherapeutic response to gemcitabine in gallbladder carcinoma cells via targeting the AMPK/SREBP1 cascades. | |||
| Pair Name | alpha-Mangostin, Sorafenib | |||
| Phytochemical | alpha-Mangostin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Expression | |
| Result | Our results highlight the synergistic effect of the combination of sorafenib and α-Mangostin, which indicates a potential treatment for advanced HCC for patients that are not sensitive to sorafenib therapy. | |||
| Pair Name | Apigenin, Gefitinib | |||
| Phytochemical | Apigenin | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Activity | |
| Result | Apigenin Combined With Gefitinib Blocks Autophagy Flux and Induces Apoptotic Cell Death Through Inhibition of HIF-1α, c-Myc, p-EGFR, and Glucose Metabolism in EGFR L858R+T790M-Mutated H1975 Cells | |||
| Pair Name | Artesunate, Metformin | |||
| Phytochemical | Artesunate | |||
| Drug | Metformin | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | The study findings suggest that MET used in combination with ART can induce autophagy-dependent apoptosis in GBM cells by activating the ROS-AMPK-mTOR pathway, providing a potential new treatment for GBM. | |||
| Pair Name | Beta-Elemene, Cisplatin | |||
| Phytochemical | Beta-Elemene | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C94] | Bladder cancer | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | The results of the present study suggested that β-ELE inhibited the proliferation of bladder cancer cells in vitro and enhanced cisplatin-induced mitochondria-dependent apoptosis via the ROS-AMPK signaling pathway. Combination therapy with β-ELE requires further investigation as a potential treatment of bladder cancer. | |||
| Pair Name | Capsaicin, Docetaxel | |||
| Phytochemical | Capsaicin | |||
| Drug | Docetaxel | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | We showed that the synergistic anti-proliferative effect may be attributed to two independent effects: Inhibition of the PI3K/Akt/mTOR signaling pathway by one side, and AMPK activation by the other. In vivo experiments confirmed the synergistic effects of docetaxel and capsaicin in reducing the tumor growth of PC3 cells. | |||
| Pair Name | Cordycepin, Cisplatin | |||
| Phytochemical | Cordycepin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | This study provides comprehensive evidence that cordycepin inhibits osteosarcoma cell growth and invasion and induces osteosarcoma cell apoptosis by activating AMPK and inhibiting the AKT/mTOR signaling pathway and enhances the sensitivity of osteosarcoma cells to cisplatin, suggesting that cordycepin is a promising treatment for osteosarcoma. | |||
| Pair Name | Cryptotanshinone, Arsenic Trioxid | |||
| Phytochemical | Cryptotanshinone | |||
| Drug | Arsenic Trioxid | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | The therapeutic potential of ACCS as a candidate option for anticancer drugs in restoring the balance of immunity and metabolism deserves further investigation. | |||
| Pair Name | Fisetin, Fluorouracil | |||
| Phytochemical | Fisetin | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer | |||
| Pair Name | Ginger extract, Doxorubicin | |||
| Phytochemical | Ginger extract | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | AMPK pathway and cyclin D1 gene expression could be a molecular therapeutic target for the anticancer effect of GE in mice bearing SEC. Combining GE and DOX revealed a greater efficacy as anticancer therapeutic regimen. | |||
| Pair Name | Isorhamnetin, Doxorubicin | |||
| Phytochemical | Isorhamnetin | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Expression | |
| Result | Isorhamnetin induces cell cycle arrest and apoptosis by triggering DNA damage and regulating the AMPK/mTOR/p70S6K signaling pathway in doxorubicin-resistant breast cancer | |||
| Pair Name | Menadione, Ascorbic Acid | |||
| Phytochemical | Menadione | |||
| Drug | Ascorbic Acid | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | These results suggest that AA+MD or MD treatment in combination with autophagy inducers could be further investigated as a novel approach for glioblastoma therapy. | |||
| Pair Name | Piperlongumine, Sorafenib | |||
| Phytochemical | Piperlongumine | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | Piperlongumine synergistically enhances the antitumour activity of sorafenib by mediating ROS-AMPK activation and targeting CPSF7 in liver cancer | |||
| Pair Name | Quercitrin, Insulin | |||
| Phytochemical | Quercitrin | |||
| Drug | Insulin | |||
| Disease Info | [ICD-11: 5A80] | Polycystic ovary syndrome | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | PM20D1 and PI3K/Akt were required for lipolysis and endocrine regulation in PCOS-IR to restore ovarian function and maintain normal endocrine metabolism. By upregulating the expression of PM20D1, quercitrin activated the PI3K/Akt signaling pathway, improved adipocyte catabolism, corrected reproductive and metabolic abnormalities, and had a therapeutic effect on PCOS-IR. | |||
| Pair Name | Rhein, Pemetrexed | |||
| Phytochemical | Rhein | |||
| Drug | Pemetrexed | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | Our findings demonstrated that the potential application of rhein as a candidate drug in combination with PTX is promising for treatment of the human lung cancer. | |||
| Pair Name | Tangeretin, Metformin | |||
| Phytochemical | Tangeretin | |||
| Drug | Metformin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | The current work underscores the importance of metformin as an ERMA in tackling breast cancer and as a novel approach to boost its anticancer activity via a synergistic combination with tangeretin. | |||
| Pair Name | Ursolic acid, Doxorubicin | |||
| Phytochemical | Ursolic acid | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | Ursolic acid augments the chemosensitivity of drug-resistant breast cancer cells to doxorubicin by AMPK-mediated mitochondrial dysfunction | |||
| Pair Name | Vitamin C, Erastin | |||
| Phytochemical | Vitamin C | |||
| Drug | Erastin | |||
| Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | The combination of erastin and vitamin C exerts a synergistic effect of classical and nonclassical modes to induce ferroptosis in PC cells, which may provide a promising therapeutic strategy for PC. | |||
| Pair Name | Cordycepin, Cisplatin | |||
| Phytochemical | Cordycepin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Phosphorylation | |
| Result | Our results suggested that Cor in combination with DDP could be an additional therapeutic option for the treatment of DDP-resistant NSCLC. | |||
| Pair Name | Epigallocatechin gallate, Osimertinib | |||
| Phytochemical | Epigallocatechin gallate | |||
| Drug | Osimertinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | Activity | |
| Result | The combined use of EGFR-TKIs and EGCG significantly reversed the Warburg effect by suppressing glycolysis while boosting mitochondrial respiration, which was accompanied by increased cellular ROS and decreased lactate secretion. The combination effectively activated the AMPK pathway while inhibited both ERK/MAPK and AKT/mTOR pathways, leading to cell cycle arrest and apoptosis, particularly in drug-resistant NSCLC cells. The in vivo results obtained from mouse tumor xenograft model confirmed that EGCG effectively overcame osimertinib resistance. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Artesunate alleviates 5-fluorouracil-induced intestinal damage by suppressing cellular senescence and enhances its antitumor activity. Discov Oncol. 2023 Jul 27;14(1):139. doi: 10.1007/s12672-023-00747-7. | Click |
| 2 | The novel proautophagy anticancer drug ABTL0812 potentiates chemotherapy in adenocarcinoma and squamous nonsmall cell lung cancer. Int J Cancer. 2020 Aug 15;147(4):1163-1179. doi: 10.1002/ijc.32865. | Click |
| 3 | α-Mangostin suppresses the de novo lipogenesis and enhances the chemotherapeutic response to gemcitabine in gallbladder carcinoma cells via targeting the AMPK/SREBP1 cascades. J Cell Mol Med. 2020 Jan;24(1):760-771. doi: 10.1111/jcmm.14785. | Click |
| 4 | Synergistic effects of α-Mangostin and sorafenib in hepatocellular carcinoma: New insights into α-mangostin cytotoxicity. Biochem Biophys Res Commun. 2021 Jun 18;558:14-21. doi: 10.1016/j.bbrc.2021.04.047. | Click |
| 5 | Apigenin Combined With Gefitinib Blocks Autophagy Flux and Induces Apoptotic Cell Death Through Inhibition of HIF-1α, c-Myc, p-EGFR, and Glucose Metabolism in EGFR L858R+T790M-Mutated H1975 Cells. Front Pharmacol. 2019 Mar 22;10:260. doi: 10.3389/fphar.2019.00260. | Click |
| 6 | Lower dose of metformin combined with artesunate induced autophagy-dependent apoptosis of glioblastoma by activating ROS-AMPK-mTOR axis. Exp Cell Res. 2023 Sep 1;430(1):113691. doi: 10.1016/j.yexcr.2023.113691. | Click |
| 7 | β-elemene enhances cisplatin-induced apoptosis in bladder cancer cells through the ROS-AMPK signaling pathway. Oncol Lett. 2020 Jan;19(1):291-300. doi: 10.3892/ol.2019.11103. | Click |
| 8 | Combination of the natural product capsaicin and docetaxel synergistically kills human prostate cancer cells through the metabolic regulator AMP-activated kinase. Cancer Cell Int. 2019;19:54. Published 2019 Mar 8. doi:10.1186/s12935-019-0769-2. | Click |
| 9 | Cordycepin augments the chemosensitivity of osteosarcoma to cisplatin by activating AMPK and suppressing the AKT signaling pathway. Cancer Cell Int. 2021 Dec 25;21(1):706. doi: 10.1186/s12935-021-02411-y. | Click |
| 10 | Arsenic Trioxide Cooperate Cryptotanshinone Exerts Antitumor Effect by Medicating Macrophage Polarization through Glycolysis. J Immunol Res. 2022 Feb 8;2022:2619781. doi: 10.1155/2022/2619781. | Click |
| 11 | Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer. Int J Cancer. 2019 Dec 1;145(11):3022-3032. doi: 10.1002/ijc.32367. | Click |
| 12 | Ginger extract adjuvant to doxorubicin in mammary carcinoma: study of some molecular mechanisms. Eur J Nutr. 2018 Apr;57(3):981-989. doi: 10.1007/s00394-017-1382-6. | Click |
| 13 | Isorhamnetin induces cell cycle arrest and apoptosis by triggering DNA damage and regulating the AMPK/mTOR/p70S6K signaling pathway in doxorubicin-resistant breast cancer. Phytomedicine. 2023 Jun;114:154780. doi: 10.1016/j.phymed.2023.154780. | Click |
| 14 | Combination of Ascorbic Acid and Menadione Induces Cytotoxic Autophagy in Human Glioblastoma Cells. Oxid Med Cell Longev. 2022 Mar 23;2022:2998132. doi: 10.1155/2022/2998132. | Click |
| 15 | Piperlongumine synergistically enhances the antitumour activity of sorafenib by mediating ROS-AMPK activation and targeting CPSF7 in liver cancer. Pharmacol Res. 2022 Mar;177:106140. doi: 10.1016/j.phrs.2022.106140. | Click |
| 16 | Quercitrin alleviates lipid metabolism disorder in polycystic ovary syndrome-insulin resistance by upregulating PM20D1 in the PI3K/Akt pathway. Phytomedicine. 2023 Aug;117:154908. doi: 10.1016/j.phymed.2023.154908. | Click |
| 17 | Organic anion transporters and PI3K-AKT-mTOR pathway mediate the synergistic anticancer effect of pemetrexed and rhein. J Cell Physiol. 2020 Apr;235(4):3309-3319. doi: 10.1002/jcp.29218. | Click |
| 18 | Tangeretin boosts the anticancer activity of metformin in breast cancer cells via curbing the energy production. Phytomedicine. 2021 Mar;83:153470. doi: 10.1016/j.phymed.2021.153470. | Click |
| 19 | Ursolic acid augments the chemosensitivity of drug-resistant breast cancer cells to doxorubicin by AMPK-mediated mitochondrial dysfunction. Biochem Pharmacol. 2022 Nov;205:115278. doi: 10.1016/j.bcp.2022.115278. | Click |
| 20 | Vitamin C Sensitizes Pancreatic Cancer Cells to Erastin-Induced Ferroptosis by Activating the AMPK/Nrf2/HMOX1 Pathway. Oxid Med Cell Longev. 2022 Jul 19;2022:5361241. doi: 10.1155/2022/5361241. | Click |
| 21 | Cordycepin Reverses Cisplatin Resistance in Non-small Cell Lung Cancer by Activating AMPK and Inhibiting AKT Signaling Pathway. Front Cell Dev Biol. 2021 Jan 15;8:609285. doi: 10.3389/fcell.2020.609285. | Click |
| 22 | Epigallocatechin gallate circumvents drug-induced resistance in non-small-cell lung cancer by modulating glucose metabolism and AMPK/AKT/MAPK axis. Phytother Res. 2023;37(12):5837-5853. doi:10.1002/ptr.7990 | Click |
