TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name 5'-AMP-activated protein kinase catalytic subunit alpha-1
UniProt ID AAPK1_HUMAN
Gene Name PRKAA1
Gene ID 5562
Synonyms
PRKAA1, AMPK, AMPK_alpha_1, AMPKa1
Sequence
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
Pathway Map MAP LINK
KEGG ID hsa5562
Pfam PF00069; PF01636; PF03109; PF06293; PF07714; PF14531; PF16579; PF21147
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 1004
Pair Name Artesunate, Fluorouracil
Phytochemical Name Artesunate
Anticancer drug Name Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result Our findings point to the crucial treatment effect of Arte on inflammation, intestinal cell senescence, and CRC cell proliferation and offer a new option for CRC treatment.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 12
Pair Name Piperlongumine, Sorafenib
Phytochemical Piperlongumine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result Piperlongumine synergistically enhances the antitumour activity of sorafenib by mediating ROS-AMPK activation and targeting CPSF7 in liver cancer
Combination Pair ID: 73
Pair Name Fisetin, Fluorouracil
Phytochemical Fisetin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer
Combination Pair ID: 77
Pair Name Apigenin, Gefitinib
Phytochemical Apigenin
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Activity
Result Apigenin Combined With Gefitinib Blocks Autophagy Flux and Induces Apoptotic Cell Death Through Inhibition of HIF-1α, c-Myc, p-EGFR, and Glucose Metabolism in EGFR L858R+T790M-Mutated H1975 Cells
Combination Pair ID: 86
Pair Name Tangeretin, Metformin
Phytochemical Tangeretin
Drug Metformin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result The current work underscores the importance of metformin as an ERMA in tackling breast cancer and as a novel approach to boost its anticancer activity via a synergistic combination with tangeretin.
Combination Pair ID: 92
Pair Name Isorhamnetin, Doxorubicin
Phytochemical Isorhamnetin
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Expression
Result Isorhamnetin induces cell cycle arrest and apoptosis by triggering DNA damage and regulating the AMPK/mTOR/p70S6K signaling pathway in doxorubicin-resistant breast cancer
Combination Pair ID: 1008
Pair Name Artesunate, Metformin
Phytochemical Artesunate
Drug Metformin
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result The study findings suggest that MET used in combination with ART can induce autophagy-dependent apoptosis in GBM cells by activating the ROS-AMPK-mTOR pathway, providing a potential new treatment for GBM.
Combination Pair ID: 191
Pair Name Ursolic acid, Doxorubicin
Phytochemical Ursolic acid
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result Ursolic acid augments the chemosensitivity of drug-resistant breast cancer cells to doxorubicin by AMPK-mediated mitochondrial dysfunction
Combination Pair ID: 699
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result The results of the present study suggested that β-ELE inhibited the proliferation of bladder cancer cells in vitro and enhanced cisplatin-induced mitochondria-dependent apoptosis via the ROS-AMPK signaling pathway. Combination therapy with β-ELE requires further investigation as a potential treatment of bladder cancer.
Combination Pair ID: 288
Pair Name Menadione, Ascorbic Acid
Phytochemical Menadione
Drug Ascorbic Acid
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result These results suggest that AA+MD or MD treatment in combination with autophagy inducers could be further investigated as a novel approach for glioblastoma therapy.
Combination Pair ID: 293
Pair Name Cryptotanshinone, Arsenic Trioxid
Phytochemical Cryptotanshinone
Drug Arsenic Trioxid
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result The therapeutic potential of ACCS as a candidate option for anticancer drugs in restoring the balance of immunity and metabolism deserves further investigation.
Combination Pair ID: 300
Pair Name Rhein, Pemetrexed
Phytochemical Rhein
Drug Pemetrexed
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result Our findings demonstrated that the potential application of rhein as a candidate drug in combination with PTX is promising for treatment of the human lung cancer.
Combination Pair ID: 405
Pair Name Capsaicin, Docetaxel
Phytochemical Capsaicin
Drug Docetaxel
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result We showed that the synergistic anti-proliferative effect may be attributed to two independent effects: Inhibition of the PI3K/Akt/mTOR signaling pathway by one side, and AMPK activation by the other. In vivo experiments confirmed the synergistic effects of docetaxel and capsaicin in reducing the tumor growth of PC3 cells.
Combination Pair ID: 439
Pair Name alpha-Mangostin, Sorafenib
Phytochemical alpha-Mangostin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Expression
Result Our results highlight the synergistic effect of the combination of sorafenib and α-Mangostin, which indicates a potential treatment for advanced HCC for patients that are not sensitive to sorafenib therapy.
Combination Pair ID: 440
Pair Name alpha-Mangostin, Gemcitabine
Phytochemical alpha-Mangostin
Drug Gemcitabine
Disease Info [ICD-11: 2C13] Gallbladder cancer Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result α-Mangostin suppresses the de novo lipogenesis and enhances the chemotherapeutic response to gemcitabine in gallbladder carcinoma cells via targeting the AMPK/SREBP1 cascades.
Combination Pair ID: 459
Pair Name Quercitrin, Insulin
Phytochemical Quercitrin
Drug Insulin
Disease Info [ICD-11: 5A80] Polycystic ovary syndrome Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result PM20D1 and PI3K/Akt were required for lipolysis and endocrine regulation in PCOS-IR to restore ovarian function and maintain normal endocrine metabolism. By upregulating the expression of PM20D1, quercitrin activated the PI3K/Akt signaling pathway, improved adipocyte catabolism, corrected reproductive and metabolic abnormalities, and had a therapeutic effect on PCOS-IR.
Combination Pair ID: 526
Pair Name alpha-Hydroxylinoleic acid, Paclitaxel
Phytochemical alpha-Hydroxylinoleic acid
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result The safety profile of ABTL0812 and its good synergy with chemotherapy potentiate the therapeutic potential of current lines of treatment based on chemotherapy regimens, arising as a promising option for improving these patients therapeutic expectancy.
Combination Pair ID: 533
Pair Name Vitamin C, Erastin
Phytochemical Vitamin C
Drug Erastin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result The combination of erastin and vitamin C exerts a synergistic effect of classical and nonclassical modes to induce ferroptosis in PC cells, which may provide a promising therapeutic strategy for PC.
Combination Pair ID: 583
Pair Name Ginger extract, Doxorubicin
Phytochemical Ginger extract
Drug Doxorubicin
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result AMPK pathway and cyclin D1 gene expression could be a molecular therapeutic target for the anticancer effect of GE in mice bearing SEC. Combining GE and DOX revealed a greater efficacy as anticancer therapeutic regimen.
Combination Pair ID: 597
Pair Name Cordycepin, Cisplatin
Phytochemical Cordycepin
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result This study provides comprehensive evidence that cordycepin inhibits osteosarcoma cell growth and invasion and induces osteosarcoma cell apoptosis by activating AMPK and inhibiting the AKT/mTOR signaling pathway and enhances the sensitivity of osteosarcoma cells to cisplatin, suggesting that cordycepin is a promising treatment for osteosarcoma.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 711
Pair Name Epigallocatechin gallate, Osimertinib
Phytochemical Epigallocatechin gallate
Drug Osimertinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Activity
Result The combined use of EGFR-TKIs and EGCG significantly reversed the Warburg effect by suppressing glycolysis while boosting mitochondrial respiration, which was accompanied by increased cellular ROS and decreased lactate secretion. The combination effectively activated the AMPK pathway while inhibited both ERK/MAPK and AKT/mTOR pathways, leading to cell cycle arrest and apoptosis, particularly in drug-resistant NSCLC cells. The in vivo results obtained from mouse tumor xenograft model confirmed that EGCG effectively overcame osimertinib resistance.
Combination Pair ID: 596
Pair Name Cordycepin, Cisplatin
Phytochemical Cordycepin
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation 5'-AMP-activated protein kinase catalytic subunit alpha-1 Phosphorylation
Result Our results suggested that Cor in combination with DDP could be an additional therapeutic option for the treatment of DDP-resistant NSCLC.
03. Reference
No. Title Href
1 Artesunate alleviates 5-fluorouracil-induced intestinal damage by suppressing cellular senescence and enhances its antitumor activity. Discov Oncol. 2023 Jul 27;14(1):139. doi: 10.1007/s12672-023-00747-7. Click
2 Piperlongumine synergistically enhances the antitumour activity of sorafenib by mediating ROS-AMPK activation and targeting CPSF7 in liver cancer. Pharmacol Res. 2022 Mar;177:106140. doi: 10.1016/j.phrs.2022.106140. Click
3 Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer. Int J Cancer. 2019 Dec 1;145(11):3022-3032. doi: 10.1002/ijc.32367. Click
4 Apigenin Combined With Gefitinib Blocks Autophagy Flux and Induces Apoptotic Cell Death Through Inhibition of HIF-1α, c-Myc, p-EGFR, and Glucose Metabolism in EGFR L858R+T790M-Mutated H1975 Cells. Front Pharmacol. 2019 Mar 22;10:260. doi: 10.3389/fphar.2019.00260. Click
5 Tangeretin boosts the anticancer activity of metformin in breast cancer cells via curbing the energy production. Phytomedicine. 2021 Mar;83:153470. doi: 10.1016/j.phymed.2021.153470. Click
6 Isorhamnetin induces cell cycle arrest and apoptosis by triggering DNA damage and regulating the AMPK/mTOR/p70S6K signaling pathway in doxorubicin-resistant breast cancer. Phytomedicine. 2023 Jun;114:154780. doi: 10.1016/j.phymed.2023.154780. Click
7 Lower dose of metformin combined with artesunate induced autophagy-dependent apoptosis of glioblastoma by activating ROS-AMPK-mTOR axis. Exp Cell Res. 2023 Sep 1;430(1):113691. doi: 10.1016/j.yexcr.2023.113691. Click
8 Ursolic acid augments the chemosensitivity of drug-resistant breast cancer cells to doxorubicin by AMPK-mediated mitochondrial dysfunction. Biochem Pharmacol. 2022 Nov;205:115278. doi: 10.1016/j.bcp.2022.115278. Click
9 β-elemene enhances cisplatin-induced apoptosis in bladder cancer cells through the ROS-AMPK signaling pathway. Oncol Lett. 2020 Jan;19(1):291-300. doi: 10.3892/ol.2019.11103. Click
10 Combination of Ascorbic Acid and Menadione Induces Cytotoxic Autophagy in Human Glioblastoma Cells. Oxid Med Cell Longev. 2022 Mar 23;2022:2998132. doi: 10.1155/2022/2998132. Click
11 Arsenic Trioxide Cooperate Cryptotanshinone Exerts Antitumor Effect by Medicating Macrophage Polarization through Glycolysis. J Immunol Res. 2022 Feb 8;2022:2619781. doi: 10.1155/2022/2619781. Click
12 Organic anion transporters and PI3K-AKT-mTOR pathway mediate the synergistic anticancer effect of pemetrexed and rhein. J Cell Physiol. 2020 Apr;235(4):3309-3319. doi: 10.1002/jcp.29218. Click
13 Combination of the natural product capsaicin and docetaxel synergistically kills human prostate cancer cells through the metabolic regulator AMP-activated kinase. Cancer Cell Int. 2019;19:54. Published 2019 Mar 8. doi:10.1186/s12935-019-0769-2. Click
14 Synergistic effects of α-Mangostin and sorafenib in hepatocellular carcinoma: New insights into α-mangostin cytotoxicity. Biochem Biophys Res Commun. 2021 Jun 18;558:14-21. doi: 10.1016/j.bbrc.2021.04.047. Click
15 α-Mangostin suppresses the de novo lipogenesis and enhances the chemotherapeutic response to gemcitabine in gallbladder carcinoma cells via targeting the AMPK/SREBP1 cascades. J Cell Mol Med. 2020 Jan;24(1):760-771. doi: 10.1111/jcmm.14785. Click
16 Quercitrin alleviates lipid metabolism disorder in polycystic ovary syndrome-insulin resistance by upregulating PM20D1 in the PI3K/Akt pathway. Phytomedicine. 2023 Aug;117:154908. doi: 10.1016/j.phymed.2023.154908. Click
17 The novel proautophagy anticancer drug ABTL0812 potentiates chemotherapy in adenocarcinoma and squamous nonsmall cell lung cancer. Int J Cancer. 2020 Aug 15;147(4):1163-1179. doi: 10.1002/ijc.32865. Click
18 Vitamin C Sensitizes Pancreatic Cancer Cells to Erastin-Induced Ferroptosis by Activating the AMPK/Nrf2/HMOX1 Pathway. Oxid Med Cell Longev. 2022 Jul 19;2022:5361241. doi: 10.1155/2022/5361241. Click
19 Ginger extract adjuvant to doxorubicin in mammary carcinoma: study of some molecular mechanisms. Eur J Nutr. 2018 Apr;57(3):981-989. doi: 10.1007/s00394-017-1382-6. Click
20 Cordycepin augments the chemosensitivity of osteosarcoma to cisplatin by activating AMPK and suppressing the AKT signaling pathway. Cancer Cell Int. 2021 Dec 25;21(1):706. doi: 10.1186/s12935-021-02411-y. Click
21 Epigallocatechin gallate circumvents drug-induced resistance in non-small-cell lung cancer by modulating glucose metabolism and AMPK/AKT/MAPK axis. Phytother Res. 2023;37(12):5837-5853. doi:10.1002/ptr.7990 Click
22 Cordycepin Reverses Cisplatin Resistance in Non-small Cell Lung Cancer by Activating AMPK and Inhibiting AKT Signaling Pathway. Front Cell Dev Biol. 2021 Jan 15;8:609285. doi: 10.3389/fcell.2020.609285. Click
It has been None visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP