TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name NF-kappa-B inhibitor alpha
UniProt ID IKBA_HUMAN
Gene Name NFKBIA
Gene ID 4792
Synonyms
NFKBIA, EDAID2, IKBA, MAD-3, NFKBI
Sequence
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
DELPYDDCVFGGQRLTL
Pathway Map MAP LINK
KEGG ID hsa4792
TTD ID T51672
Pfam PF00023; PF12796; PF13606; PF13637; PF13857
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 975
Pair Name Quercetin, Anti-PD-1 antibody
Phytochemical Quercetin
Drug Anti-PD-1 antibody
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation NF-kappa-B inhibitor alpha Expression
Result Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity.
Combination Pair ID: 74
Pair Name Baicalein, Cisplatin
Phytochemical Baicalein
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation NF-kappa-B inhibitor alpha Phosphorylation
Result Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway
Combination Pair ID: 660
Pair Name Morin, MST312
Phytochemical Morin
Drug MST312
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation NF-kappa-B inhibitor alpha Phosphorylation
Result Our study suggests that novel targeted-therapy can be implemented by using flavonoid morin and telomerase inhibitor MST‑312 for improved cancer prognosis.
Combination Pair ID: 136
Pair Name Tectorigenin, Paclitaxel
Phytochemical Tectorigenin
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation NF-kappa-B inhibitor alpha Phosphorylation
Result These data suggest that tectorigenin could sensitize paclitaxel-resistant human ovarian cancer cells through inactivation of the Akt/IKK/IκB/NFκB signaling pathway, and promise a new intervention to chemosensitize paclitaxel-induced cytotoxicity in ovarian cancer.
Combination Pair ID: 175
Pair Name Parthenolide, Balsalazide
Phytochemical Parthenolide
Drug Balsalazide
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation NF-kappa-B inhibitor alpha Phosphorylation
Result These results demonstrate that parthenolide potentiates the efficacy of balsalazide through synergistic inhibition of NF-κB activation and the combination of dual agents prevents colon carcinogenesis from chronic inflammation.
Combination Pair ID: 185
Pair Name Astragaloside IV, Carboplatin
Phytochemical Astragaloside IV
Drug Carboplatin
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation NF-kappa-B inhibitor alpha Phosphorylation
Result Our results suggested that AgIV enhanced carboplatin sensitivity in prostate cancer cell lines by suppressing AKT/NF-κB signaling, thus suppressed epithelial-mesenchymal transition induced by carboplatin. Our findings provided a new mechanism for AgIV in overcoming drug resistance of platinum-based chemotherapy and suggested a potential combination therapy of AgIV and carboplatin in prostate cancer.
Combination Pair ID: 332
Pair Name Bergamottin, Simvastatin
Phytochemical Bergamottin
Drug Simvastatin
Disease Info [ICD-11: 2A20.1] Chronic myelogenous leukemia Investigative
Regulate Info Up-regulation NF-kappa-B inhibitor alpha Expression
Result Discussion and conclusion Our results provide novel insight into the role of SV and BGM in potentially preventing and treating cancer through modulation of NF-κB signalling pathway and its regulated gene products.
Combination Pair ID: 821
Pair Name Curcumin, Carfilzomib
Phytochemical Curcumin
Drug Carfilzomib
Disease Info [ICD-11: 2A83.1] Plasma cell myeloma Investigative
Regulate Info Down-regulation NF-kappa-B inhibitor alpha Phosphorylation
Result Curcumin significantly ameliorates CFZ cytotoxic effect. Induction of p53/p21 axis and G0/G1 cell cycle arrest were more pronounced for the CFZ-curcumin combination
Combination Pair ID: 435
Pair Name Garcinol, Paclitaxel
Phytochemical Garcinol
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation NF-kappa-B inhibitor alpha Phosphorylation
Result Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model
Combination Pair ID: 886
Pair Name Gambogic Acid, Doxorubicin
Phytochemical Gambogic Acid
Drug Doxorubicin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation NF-kappa-B inhibitor alpha Expression
Result These findings indicate that GA sensitizes lung cancer cells to ADM in vitro and in vivo, providing a rationale for the combined use of GA and ADM in lung cancer chemotherapy.
Combination Pair ID: 507
Pair Name Glucosinalbate, Doxorubicin
Phytochemical Glucosinalbate
Drug Doxorubicin
Disease Info [ICD-11: 2C90] Ehrlich ascites carcinoma Investigative
Regulate Info Up-regulation NF-kappa-B inhibitor alpha Expression
Result The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host.
Combination Pair ID: 522
Pair Name Myriocin, Cisplatin
Phytochemical Myriocin
Drug Cisplatin
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation NF-kappa-B inhibitor alpha Phosphorylation
Result We suggest that myriocin is a novel potent anti-cancer agent that dually targets both VEGFR2 in ECs and IκBα in cancer cells, and exerts more pronounced anti-tumor effects than with either kinase being inhibited alone.
Combination Pair ID: 545
Pair Name Sulforaphane, CB-5083
Phytochemical Sulforaphane
Drug CB-5083
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation NF-kappa-B inhibitor alpha Phosphorylation
Result The combination of Sulforaphane and CB-5083 may be a useful treatment strategy to combat CB-5083 resistance.
Combination Pair ID: 956
Pair Name Noscapine, Doxorubicin
Phytochemical Noscapine
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation NF-kappa-B inhibitor alpha Expression
Result Noscapine potentiated the anticancer activity of Doxorubicin in a synergistic manner against TNBC tumors via inactivation of NF-KB and anti-angiogenic pathways while stimulating apoptosis. These findings suggest potential benefit for use of oral Noscapine and Doxorubicin combination therapy for treatment of more aggressive TNBC.
Combination Pair ID: 617
Pair Name Beta-Elemene, Bortezomib
Phytochemical Beta-Elemene
Drug Bortezomib
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation NF-kappa-B inhibitor alpha Expression
Result Elemene sensitizes pancreatic cancer cells to bortezomib by enhancing proteasome inhibition via molecular patch mechanism
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 836
Pair Name Capsaicin, Cisplatin
Phytochemical Capsaicin
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation NF-kappa-B inhibitor alpha Phosphorylation
Result We propose that combined administration of cisplatin and capsaicin may provide a strategy for overcoming cisplatin resistance.
03. Reference
No. Title Href
1 Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. Click
2 Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway. Biochem Biophys Res Commun. 2020 Oct 20;531(3):320-327. doi: 10.1016/j.bbrc.2020.07.045. Click
3 Combination treatment with flavonoid morin and telomerase inhibitor MST‑312 reduces cancer stem cell traits by targeting STAT3 and telomerase. Int J Oncol. 2016 Aug;49(2):487-98. doi: 10.3892/ijo.2016.3546. Click
4 Tectorigenin sensitizes paclitaxel-resistant human ovarian cancer cells through downregulation of the Akt and NFκB pathway. Carcinogenesis. 2012 Dec;33(12):2488-98. doi: 10.1093/carcin/bgs302. Click
5 Combined Parthenolide and Balsalazide Have Enhanced Antitumor Efficacy Through Blockade of NF-κB Activation. Mol Cancer Res. 2017 Feb;15(2):141-151. doi: 10.1158/1541-7786.MCR-16-0101. Click
6 Astragaloside IV enhanced carboplatin sensitivity in prostate cancer by suppressing AKT/NF-κB signaling pathway. Biochem Cell Biol. 2021 Apr;99(2):214-222. doi: 10.1139/bcb-2020-0026. Click
7 Simvastatin in combination with bergamottin potentiates TNF-induced apoptosis through modulation of NF-κB signalling pathway in human chronic myelogenous leukaemia. Pharm Biol. 2016 Oct;54(10):2050-60. doi: 10.3109/13880209.2016.1141221. Click
8 Curcumin ameliorates the in vitro efficacy of carfilzomib in human multiple myeloma U266 cells targeting p53 and NF-κB pathways. Toxicol In Vitro. 2018 Mar;47:186-194. doi: 10.1016/j.tiv.2017.12.001. Click
9 Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. Click
10 Suppression of NF-κB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103. doi: 10.2174/1568009613666131113100634. Click
11 Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. Click
12 Dual anti-angiogenic and anti-metastatic activity of myriocin synergistically enhances the anti-tumor activity of cisplatin. Cell Oncol (Dordr). 2023 Feb;46(1):117-132. doi: 10.1007/s13402-022-00737-x. Click
13 Sulforaphane is Synergistic with CB-5083 and Inhibits Colony Formation of CB-5083-Resistant HCT116 Cells. ChemMedChem. 2022 Jun 3;17(11):e202200030. doi: 10.1002/cmdc.202200030. Click
14 Antitumor activity of Noscapine in combination with Doxorubicin in triple negative breast cancer. PLoS One. 2011 Mar 15;6(3):e17733. doi: 10.1371/journal.pone.0017733. Click
15 Elemene sensitizes pancreatic cancer cells to bortezomib by enhancing proteasome inhibition via molecular patch mechanism. Signal Transduct Target Ther. 2023 Feb 27;8(1):87. doi: 10.1038/s41392-023-01373-z. Click
16 Capsaicin induces apoptosis of cisplatin-resistant stomach cancer cells by causing degradation of cisplatin-inducible Aurora-A protein. Nutr Cancer. 2011;63(7):1095-1103. doi:10.1080/01635581.2011.607548. Click
It has been None visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP