Name | NF-kappa-B inhibitor alpha | ||
UniProt ID | IKBA_HUMAN | ||
Gene Name | NFKBIA | ||
Gene ID | 4792 | ||
Synonyms |
NFKBIA, EDAID2, IKBA, MAD-3, NFKBI
|
||
Sequence |
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE DELPYDDCVFGGQRLTL |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa4792 | ||
TTD ID | T51672 | ||
Pfam | PF00023; PF12796; PF13606; PF13637; PF13857 |
Pair Name | Astragaloside IV, Carboplatin | |||
Phytochemical | Astragaloside IV | |||
Drug | Carboplatin | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Up-regulation | NF-kappa-B inhibitor alpha | Phosphorylation | |
Result | Our results suggested that AgIV enhanced carboplatin sensitivity in prostate cancer cell lines by suppressing AKT/NF-κB signaling, thus suppressed epithelial-mesenchymal transition induced by carboplatin. Our findings provided a new mechanism for AgIV in overcoming drug resistance of platinum-based chemotherapy and suggested a potential combination therapy of AgIV and carboplatin in prostate cancer. |
Pair Name | Baicalein, Cisplatin | |||
Phytochemical | Baicalein | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | NF-kappa-B inhibitor alpha | Phosphorylation | |
Result | Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway |
Pair Name | Bergamottin, Simvastatin | |||
Phytochemical | Bergamottin | |||
Drug | Simvastatin | |||
Disease Info | [ICD-11: 2A20.1] | Chronic myelogenous leukemia | Investigative | |
Regulate Info | Up-regulation | NF-kappa-B inhibitor alpha | Expression | |
Result | Discussion and conclusion Our results provide novel insight into the role of SV and BGM in potentially preventing and treating cancer through modulation of NF-κB signalling pathway and its regulated gene products. |
Pair Name | Beta-Elemene, Bortezomib | |||
Phytochemical | Beta-Elemene | |||
Drug | Bortezomib | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | NF-kappa-B inhibitor alpha | Expression | |
Result | Elemene sensitizes pancreatic cancer cells to bortezomib by enhancing proteasome inhibition via molecular patch mechanism |
Pair Name | Curcumin, Carfilzomib | |||
Phytochemical | Curcumin | |||
Drug | Carfilzomib | |||
Disease Info | [ICD-11: 2A83.1] | Plasma cell myeloma | Investigative | |
Regulate Info | Down-regulation | NF-kappa-B inhibitor alpha | Phosphorylation | |
Result | Curcumin significantly ameliorates CFZ cytotoxic effect. Induction of p53/p21 axis and G0/G1 cell cycle arrest were more pronounced for the CFZ-curcumin combination |
Pair Name | Gambogic Acid, Doxorubicin | |||
Phytochemical | Gambogic Acid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | NF-kappa-B inhibitor alpha | Expression | |
Result | These findings indicate that GA sensitizes lung cancer cells to ADM in vitro and in vivo, providing a rationale for the combined use of GA and ADM in lung cancer chemotherapy. |
Pair Name | Garcinol, Paclitaxel | |||
Phytochemical | Garcinol | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | NF-kappa-B inhibitor alpha | Phosphorylation | |
Result | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model |
Pair Name | Glucosinalbate, Doxorubicin | |||
Phytochemical | Glucosinalbate | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C90] | Ehrlich ascites carcinoma | Investigative | |
Regulate Info | Up-regulation | NF-kappa-B inhibitor alpha | Expression | |
Result | The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host. |
Pair Name | Morin, MST312 | |||
Phytochemical | Morin | |||
Drug | MST312 | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | NF-kappa-B inhibitor alpha | Phosphorylation | |
Result | Our study suggests that novel targeted-therapy can be implemented by using flavonoid morin and telomerase inhibitor MST‑312 for improved cancer prognosis. |
Pair Name | Myriocin, Cisplatin | |||
Phytochemical | Myriocin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | NF-kappa-B inhibitor alpha | Phosphorylation | |
Result | We suggest that myriocin is a novel potent anti-cancer agent that dually targets both VEGFR2 in ECs and IκBα in cancer cells, and exerts more pronounced anti-tumor effects than with either kinase being inhibited alone. |
Pair Name | Noscapine, Doxorubicin | |||
Phytochemical | Noscapine | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | NF-kappa-B inhibitor alpha | Expression | |
Result | Noscapine potentiated the anticancer activity of Doxorubicin in a synergistic manner against TNBC tumors via inactivation of NF-KB and anti-angiogenic pathways while stimulating apoptosis. These findings suggest potential benefit for use of oral Noscapine and Doxorubicin combination therapy for treatment of more aggressive TNBC. |
Pair Name | Parthenolide, Balsalazide | |||
Phytochemical | Parthenolide | |||
Drug | Balsalazide | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | NF-kappa-B inhibitor alpha | Phosphorylation | |
Result | These results demonstrate that parthenolide potentiates the efficacy of balsalazide through synergistic inhibition of NF-κB activation and the combination of dual agents prevents colon carcinogenesis from chronic inflammation. |
Pair Name | Quercetin, Anti-PD-1 antibody | |||
Phytochemical | Quercetin | |||
Drug | Anti-PD-1 antibody | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | NF-kappa-B inhibitor alpha | Expression | |
Result | Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity. |
Pair Name | Sulforaphane, CB-5083 | |||
Phytochemical | Sulforaphane | |||
Drug | CB-5083 | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | NF-kappa-B inhibitor alpha | Phosphorylation | |
Result | The combination of Sulforaphane and CB-5083 may be a useful treatment strategy to combat CB-5083 resistance. |
Pair Name | Tectorigenin, Paclitaxel | |||
Phytochemical | Tectorigenin | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | NF-kappa-B inhibitor alpha | Phosphorylation | |
Result | These data suggest that tectorigenin could sensitize paclitaxel-resistant human ovarian cancer cells through inactivation of the Akt/IKK/IκB/NFκB signaling pathway, and promise a new intervention to chemosensitize paclitaxel-induced cytotoxicity in ovarian cancer. |
Pair Name | Capsaicin, Cisplatin | |||
Phytochemical | Capsaicin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | NF-kappa-B inhibitor alpha | Phosphorylation | |
Result | We propose that combined administration of cisplatin and capsaicin may provide a strategy for overcoming cisplatin resistance. |
No. | Title | Href |
---|---|---|
1 | Astragaloside IV enhanced carboplatin sensitivity in prostate cancer by suppressing AKT/NF-κB signaling pathway. Biochem Cell Biol. 2021 Apr;99(2):214-222. doi: 10.1139/bcb-2020-0026. | Click |
2 | Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway. Biochem Biophys Res Commun. 2020 Oct 20;531(3):320-327. doi: 10.1016/j.bbrc.2020.07.045. | Click |
3 | Simvastatin in combination with bergamottin potentiates TNF-induced apoptosis through modulation of NF-κB signalling pathway in human chronic myelogenous leukaemia. Pharm Biol. 2016 Oct;54(10):2050-60. doi: 10.3109/13880209.2016.1141221. | Click |
4 | Elemene sensitizes pancreatic cancer cells to bortezomib by enhancing proteasome inhibition via molecular patch mechanism. Signal Transduct Target Ther. 2023 Feb 27;8(1):87. doi: 10.1038/s41392-023-01373-z. | Click |
5 | Curcumin ameliorates the in vitro efficacy of carfilzomib in human multiple myeloma U266 cells targeting p53 and NF-κB pathways. Toxicol In Vitro. 2018 Mar;47:186-194. doi: 10.1016/j.tiv.2017.12.001. | Click |
6 | Suppression of NF-κB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103. doi: 10.2174/1568009613666131113100634. | Click |
7 | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. | Click |
8 | Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. | Click |
9 | Combination treatment with flavonoid morin and telomerase inhibitor MST‑312 reduces cancer stem cell traits by targeting STAT3 and telomerase. Int J Oncol. 2016 Aug;49(2):487-98. doi: 10.3892/ijo.2016.3546. | Click |
10 | Dual anti-angiogenic and anti-metastatic activity of myriocin synergistically enhances the anti-tumor activity of cisplatin. Cell Oncol (Dordr). 2023 Feb;46(1):117-132. doi: 10.1007/s13402-022-00737-x. | Click |
11 | Antitumor activity of Noscapine in combination with Doxorubicin in triple negative breast cancer. PLoS One. 2011 Mar 15;6(3):e17733. doi: 10.1371/journal.pone.0017733. | Click |
12 | Combined Parthenolide and Balsalazide Have Enhanced Antitumor Efficacy Through Blockade of NF-κB Activation. Mol Cancer Res. 2017 Feb;15(2):141-151. doi: 10.1158/1541-7786.MCR-16-0101. | Click |
13 | Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. | Click |
14 | Sulforaphane is Synergistic with CB-5083 and Inhibits Colony Formation of CB-5083-Resistant HCT116 Cells. ChemMedChem. 2022 Jun 3;17(11):e202200030. doi: 10.1002/cmdc.202200030. | Click |
15 | Tectorigenin sensitizes paclitaxel-resistant human ovarian cancer cells through downregulation of the Akt and NFκB pathway. Carcinogenesis. 2012 Dec;33(12):2488-98. doi: 10.1093/carcin/bgs302. | Click |
16 | Capsaicin induces apoptosis of cisplatin-resistant stomach cancer cells by causing degradation of cisplatin-inducible Aurora-A protein. Nutr Cancer. 2011;63(7):1095-1103. doi:10.1080/01635581.2011.607548. | Click |