TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name DNA damage-inducible transcript 3 protein
UniProt ID DDIT3_HUMAN
Gene Name DDIT3
Gene ID 1649
Synonyms
DDIT3, AltDDIT3, C/EBPzeta, CEBPZ, CHOP, CHOP-10, CHOP10, GADD153
Sequence
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASL
AWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRM
KEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
Pathway Map MAP LINK
KEGG ID hsa1649
Pfam PF00170; PF02724; PF03131; PF04189; PF04977; PF06459; PF07334; PF07716; PF08287; PF12709; PF13851; PF14303; PF15390; PF16214; PF16526; PF17015; PF18077
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 420
Pair Name Anacardic Acid, Bortezomib
Phytochemical Anacardic Acid
Drug Bortezomib
Disease Info [ICD-11: 2A83] Multiple myeloma Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result The results of the present study suggest that AA/Bor combination may be a potential therapeutic strategy for MM treatment.
Combination Pair ID: 678
Pair Name Betulinic Acid, Sorafenib
Phytochemical Betulinic Acid
Drug Sorafenib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result We showed that combination therapy with low concentrations of sorafenib and betulinic acid had the capacity to induce high levels of cell death and abolish clonogenic activity in some NSCLC cell lines regardless of KRAS mutations.
Combination Pair ID: 131
Pair Name Casticin, TNF-related apoptosis inducing ligand
Phytochemical Casticin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result Casticin enhances TRAIL-induced apoptosis through the downregulation of cell survival proteins and the upregulation of DR5 receptors through actions on the ROS-ER stress-CHOP pathway.
Combination Pair ID: 336
Pair Name Decursin, TNF-related apoptosis inducing ligand
Phytochemical Decursin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result ROS generation by decursin selectively activated the PERK/ATF4 axis of the endoplasmic reticulum stress signalling pathway, leading to enhanced TRAIL sensitivity in TRAIL-resistant NSCLC cell lines, partly via up-regulation of DR5.
Combination Pair ID: 39
Pair Name Fangchinoline, Everolimus
Phytochemical Fangchinoline
Drug Everolimus
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result Firstly link CHOP to Notch 3/c-MYC axis-dependent apoptosis and provide the Notch 3/c-MYC/CHOP activation as a promising strategy for mTOR-targeted combination therapy in lung cancer treatment.
Combination Pair ID: 129
Pair Name Licochalcone B, TNF-related apoptosis inducing ligand
Phytochemical Licochalcone B
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC.
Combination Pair ID: 497
Pair Name Medicarpin, TNF-related apoptosis inducing ligand
Phytochemical Medicarpin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B33.1] Myeloid leukemia Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway
Combination Pair ID: 605
Pair Name Phenethyl isothiocyanate, Gefitinib
Phytochemical Phenethyl isothiocyanate
Drug Gefitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation DNA damage-inducible transcript 3 protein Expression
Result We explored the prospect of PEITC in improving the efficacy of targeted drug therapy and demonstrated the synergistic effects and underlined mechanisms of PEITC combined with Gefitinib in NSCLC cells treatment. This study provided useful information for developing novel therapy strategies by combination treatment of PEITC with targeted drugs.
Combination Pair ID: 970
Pair Name Piperlongumine, Bortezomib
Phytochemical Piperlongumine
Drug Bortezomib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result Piperlongumine and bortezomib synergically inhibit cholangiocarcinoma via ER stress-induced cell death
Combination Pair ID: 969
Pair Name Piperlongumine, HSP90 inhibitors
Phytochemical Piperlongumine
Drug HSP90 inhibitors
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result Combination therapy with HSP90 inhibitors and piperlongumine promotes ROS-mediated ER stress in colon cancer cells
Combination Pair ID: 587
Pair Name Pristimerin, Sorafenib
Phytochemical Pristimerin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway
Combination Pair ID: 802
Pair Name Pterostilbene, TNF-related apoptosis inducing ligand
Phytochemical Pterostilbene
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Activity
Result Pterostilbene enhances TRAIL-induced apoptosis through the induction of death receptors and downregulation of cell survival proteins in TRAIL-resistance triple negative breast cancer cells
Combination Pair ID: 375
Pair Name Resveratrol, Cisplatin
Phytochemical Resveratrol
Drug Cisplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result These results indicated that RES is a promising adjuvant for DDP during GC chemotherapy.
Combination Pair ID: 461
Pair Name Shogaol, Gefitinib
Phytochemical Shogaol
Drug Gefitinib
Disease Info [ICD-11: 2C73] Ovarian Cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result Our results suggest that 6-shogaol exerts a potential anti-cancer effect in ovarian cancer and combination treatment with 6-shogaol and gefitinib may provide a novel anti-tumor therapeutic strategy in gefitinib-resistant ovarian cancer.
Combination Pair ID: 545
Pair Name Sulforaphane, CB-5083
Phytochemical Sulforaphane
Drug CB-5083
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result The combination of Sulforaphane and CB-5083 may be a useful treatment strategy to combat CB-5083 resistance.
Combination Pair ID: 576
Pair Name Sulforaphene, Photodynamic therapy
Phytochemical Sulforaphene
Drug Photodynamic therapy
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result This study could be useful in the improvement of therapies for human cervical and other types of cancers.
Combination Pair ID: 894
Pair Name Tannic acid, Cisplatin
Phytochemical Tannic acid
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result The combination of TA and CDDP may produce synergistic antitumoral effects mediated by the PERK-ATF4-CHOP apoptotic axis, suggesting a novel adjuvant treatment for lung cancer.
Combination Pair ID: 349
Pair Name Ursodiol, Bortezomib
Phytochemical Ursodiol
Drug Bortezomib
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result Ursodeoxycholic Acid Inhibits Glioblastoma Progression via Endoplasmic Reticulum Stress Related Apoptosis and Synergizes with the Proteasome Inhibitor Bortezomib
Combination Pair ID: 355
Pair Name Withaferin A, Fluorouracil
Phytochemical Withaferin A
Drug Fluorouracil
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result Synergistic antitumor effect of 5-fluorouracil and withaferin-A induces endoplasmic reticulum stress-mediated autophagy and apoptosis in colorectal cancer cells
Combination Pair ID: 569
Pair Name Zerumbone, Celecoxib
Phytochemical Zerumbone
Drug Celecoxib
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result Our results provide novel insights into the role of ATF3 as an essential transcription factor for p53-independent DR5 induction upon both ZER and CCB treatment, and this may be a useful biomarker for TRAIL-based anticancer therapy.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 316
Pair Name Honokiol, Paclitaxel
Phytochemical Honokiol
Drug Paclitaxel
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation DNA damage-inducible transcript 3 protein Expression
Result Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction
03. Reference
No. Title Href
1 Combined therapeutic effects of bortezomib and anacardic acid on multiple myeloma cells via activation of the endoplasmic reticulum stress response. Mol Med Rep. 2016 Sep;14(3):2679-84. doi: 10.3892/mmr.2016.5533. Click
2 Synergistic activity of sorafenib and betulinic acid against clonogenic activity of non-small cell lung cancer cells. Cancer Sci. 2017 Nov;108(11):2265-2272. doi: 10.1111/cas.13386. Click
3 Casticin potentiates TRAIL-induced apoptosis of gastric cancer cells through endoplasmic reticulum stress. PLoS One. 2013;8(3):e58855. doi: 10.1371/journal.pone.0058855. Click
4 Decursin enhances TRAIL-induced apoptosis through oxidative stress mediated- endoplasmic reticulum stress signalling in non-small cell lung cancers. Br J Pharmacol. 2016 Mar;173(6):1033-44. doi: 10.1111/bph.13408. Click
5 Activation of notch 3/c-MYC/CHOP axis regulates apoptosis and promotes sensitivity of lung cancer cells to mTOR inhibitor everolimus. Biochem Pharmacol. 2020 May;175:113921. doi: 10.1016/j.bcp.2020.113921. Click
6 Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. Click
7 Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. Click
8 Phenethyl isothiocyanate synergistically induces apoptosis with Gefitinib in non-small cell lung cancer cells via endoplasmic reticulum stress-mediated degradation of Mcl-1. Mol Carcinog. 2020 Jun;59(6):590-603. doi: 10.1002/mc.23184. Click
9 Piperlongumine and bortezomib synergically inhibit cholangiocarcinoma via ER stress-induced cell death. Naunyn Schmiedebergs Arch Pharmacol. 2023 Jan;396(1):109-120. doi: 10.1007/s00210-022-02305-4. Click
10 Combination therapy with HSP90 inhibitors and piperlongumine promotes ROS-mediated ER stress in colon cancer cells. Cell Death Discov. 2023 Oct 13;9(1):375. doi: 10.1038/s41420-023-01672-y. Click
11 Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway. Phytomedicine. 2021 Jun;86:153563. doi: 10.1016/j.phymed.2021.153563. Click
12 Pterostilbene Enhances TRAIL-Induced Apoptosis through the Induction of Death Receptors and Downregulation of Cell Survival Proteins in TRAIL-Resistance Triple Negative Breast Cancer Cells. J Agric Food Chem. 2017 Dec 27;65(51):11179-11191. doi: 10.1021/acs.jafc.7b02358. Click
13 Resveratrol synergizes with cisplatin in antineoplastic effects against AGS gastric cancer cells by inducing endoplasmic reticulum stress‑mediated apoptosis and G2/M phase arrest. Oncol Rep. 2020 Oct;44(4):1605-1615. doi: 10.3892/or.2020.7708. Click
14 6-Shogaol Overcomes Gefitinib Resistance via ER Stress in Ovarian Cancer Cells. Int J Mol Sci. 2023 Jan 30;24(3):2639. doi: 10.3390/ijms24032639. Click
15 Sulforaphane is Synergistic with CB-5083 and Inhibits Colony Formation of CB-5083-Resistant HCT116 Cells. ChemMedChem. 2022 Jun 3;17(11):e202200030. doi: 10.1002/cmdc.202200030. Click
16 Evaluation of synergistic effects of sulforaphene with photodynamic therapy in human cervical cancer cell line. Lasers Med Sci. 2016 Nov;31(8):1675-1682. doi: 10.1007/s10103-016-2037-1. Click
17 Synergistic anticancer activity of cisplatin combined with tannic acid enhances apoptosis in lung cancer through the PERK-ATF4 pathway. Eur J Med Res. 2023 Oct 27;28(1):462. doi: 10.1186/s40001-023-01420-z. Click
18 Ursodeoxycholic Acid Inhibits Glioblastoma Progression via Endoplasmic Reticulum Stress Related Apoptosis and Synergizes with the Proteasome Inhibitor Bortezomib. ACS Chem Neurosci. 2020 May 6;11(9):1337-1346. doi: 10.1021/acschemneuro.0c00095. Click
19 Synergistic antitumor effect of 5-fluorouracil and withaferin-A induces endoplasmic reticulum stress-mediated autophagy and apoptosis in colorectal cancer cells. Am J Cancer Res. 2020 Mar 1;10(3):799-815. Click
20 Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib. J Biol Chem. 2014 Aug 1;289(31):21544-61. doi: 10.1074/jbc.M114.558890. Click
21 Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction. Cell Oncol (Dordr). 2021 Feb;44(1):135-150. doi: 10.1007/s13402-020-00557-x. Click
It has been 58636 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP