Name | CASP8 and FADD-like apoptosis regulator | ||
UniProt ID | CFLAR_HUMAN | ||
Gene Name | CFLAR | ||
Gene ID | 8837 | ||
Synonyms |
CFLAR, CASH, CASP8AP1, CLARP, Casper, FLAME, FLAME-1, FLAME1, FLIP, I-FLICE, MRIT, c-FLIP, c-FLIPL, c-FLIPR, c-FLIPS, cFLIP
|
||
Sequence |
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLY
RVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYM GRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGT SYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIP EERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP EHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNY VVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa8837 | ||
TTD ID | T14306 | ||
Pfam | PF00656; PF01335 |
Pair Name | Lupeol, Enzalutamide | |||
Phytochemical Name | Lupeol | |||
Anticancer drug Name | Enzalutamide | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | Lupeol enhances the pharmacological efficacy of Enzalutamide and reduces the adverse effects. Thus, Lupeol could be a promising adjuvant for improving Enzalutamide-based treatment outcomes and warrant further research. |
Pair Name | Amentoflavone, Sorafenib | |||
Phytochemical | Amentoflavone | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | Amentoflavone may sensitize OS to sorafenib treatment by inducing intrinsic and extrinsic apoptosis and inhibiting ERK/NF-κB signaling transduction. |
Pair Name | Amentoflavone, Sorafenib | |||
Phytochemical | Amentoflavone | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | Our results demonstrated that amentoflavone significantly enhanced sorafenib-inhibited tumor growth and expression of ERK/AKT phosphorylation and anti-apoptotic proteins compared to single-agent treatment. Additionally, amentoflavone also triggered sorafenib-induced apoptosis through extrinsic and intrinsic apoptotic pathways. |
Pair Name | Angelicin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Angelicin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C90.Z] | Renal carcinoma | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | This study provides evidence that angelicin might be a TRAIL sensitizer. |
Pair Name | Apigenin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Apigenin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A90] | Anaplastic large cell lymphoma | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | Apigenin breaks TRAIL resistance in HTLV-1-associated ATL by transcriptional down-regulation of c-FLIP, a key inhibitor of death receptor signaling, and by up-regulation of TRAIL receptor 2 (TRAIL-R2) |
Pair Name | Bakuchiol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Bakuchiol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | The collective results suggest that bakuchiol facilitates TRAIL-induced apoptosis in colon cancer cells through up-regulation of the TRAIL receptors; DR4 and DR5 via ROS/JNK pathway signals. |
Pair Name | Cantharidin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Cantharidin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | The results of the present study revealed that cantharidin effectively sensitized cells to TRAIL‑mediated apoptosis and its effects are likely to be mediated by autophagy, the downregulation of c‑FLIP and the upregulation of DR‑5. |
Pair Name | Casticin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Casticin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | Casticin enhances TRAIL-induced apoptosis through the downregulation of cell survival proteins and the upregulation of DR5 receptors through actions on the ROS-ER stress-CHOP pathway. |
Pair Name | Chrysin, Cisplatin | |||
Phytochemical | Chrysin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | The combination of Chrysin and Cisplatin Induces Apoptosis in HepG2 through Down-regulation of cFLIP and Activity of Caspase. |
Pair Name | Delta-Tocotrienol, Docetaxel | |||
Phytochemical | Delta-Tocotrienol | |||
Drug | Docetaxel | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | The ability of δ-TT to induce necroptotic cell death may represent a promising therapeutical approach to overcome DTX chemoresistance in PCa. |
Pair Name | Epigallocatechin gallate, TNF-related apoptosis inducing ligand | |||
Phytochemical | Epigallocatechin gallate | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B6B] | Nasopharyngeal carcinoma | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | EGCG sensitizes NPC cells to TRAIL-mediated apoptosis via modulation of extrinsic and intrinsic apoptotic pathways and inhibition of NF-κB activation. |
Pair Name | Icaritin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Icaritin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | These data suggest that icaritin sensitizes TRAIL-induced tumor cell apoptosis via suppression of NF-κB-dependent c-FLIP expression, providing in vitro evidence supporting the notion that icaritin is a potential sensitizer of TRAIL in anticancer therapy against human GBM. |
Pair Name | Irigenin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Irigenin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | Our present study gave new insights into the effects of Iri on potentiating TRAIL-sensitivity, and suggested that Iri could be a potential candidate for sensitizer of TRAIL-resistant cancer cell treatment. |
Pair Name | Kaempferol, TNF-related apoptosis inducing ligand | |||
Phytochemical | Kaempferol | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A20.1] | Chronic myelogenous leukemia | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | It is reasonable to conclude that sensitization of chronic leukemia cells to TRAIL by kaempferol in vitro should be considered as a way of focusing clinical attention on leukemia therapy. |
Pair Name | Kurarinone, TNF-related apoptosis inducing ligand | |||
Phytochemical | Kurarinone | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | Kurarinone Synergizes TRAIL-Induced Apoptosis in Gastric Cancer Cells |
Pair Name | Medicarpin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Medicarpin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2B33.1] | Myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway |
Pair Name | Parthenolide, Balsalazide | |||
Phytochemical | Parthenolide | |||
Drug | Balsalazide | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | These results demonstrate that parthenolide potentiates the efficacy of balsalazide through synergistic inhibition of NF-κB activation and the combination of dual agents prevents colon carcinogenesis from chronic inflammation. |
Pair Name | Plumbagin, rsTRAIL | |||
Phytochemical | Plumbagin | |||
Drug | rsTRAIL | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | Our results suggest that both plumbagin and rsTRAIL could be used as a single agent or synergistical agents to induce apoptosis of leukemic Kasumi‑1 cells in vitro and in vivo. |
Pair Name | Shikonin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Shikonin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | The results indicated that shikonin sensitized resistant cancer cells to TRAIL-induced cytotoxicity via the modulation of the JNK, STAT3 and AKT pathways, the downregulation of antiapoptotic proteins and the upregulation of proapoptotic proteins. |
Pair Name | Tectorigenin, Paclitaxel | |||
Phytochemical | Tectorigenin | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | These data suggest that tectorigenin could sensitize paclitaxel-resistant human ovarian cancer cells through inactivation of the Akt/IKK/IκB/NFκB signaling pathway, and promise a new intervention to chemosensitize paclitaxel-induced cytotoxicity in ovarian cancer. |
Pair Name | Tubeimoside I, TNF-related apoptosis inducing ligand | |||
Phytochemical | Tubeimoside I | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | Our study revealed that STAMBPL1 is essential for c-FLIP stabilization, and that STAMBPL1 depletion enhances TRAIL-mediated apoptosis via c-FLIP downregulation. |
Pair Name | Amentoflavone, Sorafenib | |||
Phytochemical | Amentoflavone | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | CASP8 and FADD-like apoptosis regulator | Expression | |
Result | Amentoflavone not only reversed sorafenib-induced anti-apoptotic protein levels but also enhanced sorafenib-induced pro-apoptotic protein expression in SK-Hep1R cells. In conclusion, amentoflavone may be used as a sorafenib sensitizer to enhance sorafenib-induced cytotoxicity and trigger sorafenib-induced apoptosis through extrinsic and intrinsic pathways in SK-Hep1R cells. |
No. | Title | Href |
---|---|---|
1 | Lupeol, an androgen receptor inhibitor, enhances the chemosensitivity of prostate cancer stem cells to antiandrogen enzalutamide-based therapy. Toxicol Appl Pharmacol. 2023 Nov 1;478:116699. doi: 10.1016/j.taap.2023.116699. | Click |
2 | Reinforcement of Sorafenib Anti-osteosarcoma Effect by Amentoflavone Is Associated With the Induction of Apoptosis and Inactivation of ERK/NF-κB. In Vivo. 2022 May-Jun;36(3):1136-1143. doi: 10.21873/invivo.12812. | Click |
3 | Amentoflavone Enhances the Therapeutic Efficacy of Sorafenib by Inhibiting Anti-apoptotic Potential and Potentiating Apoptosis in Hepatocellular Carcinoma In Vivo. Anticancer Res. 2018 Apr;38(4):2119-2125. doi: 10.21873/anticanres.12452. | Click |
4 | Angelicin potentiates TRAIL-induced apoptosis in renal carcinoma Caki cells through activation of caspase 3 and down-regulation of c-FLIP expression. Drug Dev Res. 2018 Feb;79(1):3-10. doi: 10.1002/ddr.21414. | Click |
5 | Wogonin and related natural flavones overcome tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) protein resistance of tumors by down-regulation of c-FLIP protein and up-regulation of TRAIL receptor 2 expression. J Biol Chem. 2012 Jan 2;287(1):641-649. doi: 10.1074/jbc.M111.286526. | Click |
6 | Bakuchiol sensitizes cancer cells to TRAIL through ROS- and JNK-mediated upregulation of death receptors and downregulation of survival proteins. Biochem Biophys Res Commun. 2016 Apr 29;473(2):586-92. doi: 10.1016/j.bbrc.2016.03.127. | Click |
7 | Downregulation of c‑FLIP and upregulation of DR‑5 by cantharidin sensitizes TRAIL‑mediated apoptosis in prostate cancer cells via autophagy flux. Int J Mol Med. 2020 Jul;46(1):280-288. doi: 10.3892/ijmm.2020.4566. | Click |
8 | Casticin potentiates TRAIL-induced apoptosis of gastric cancer cells through endoplasmic reticulum stress. PLoS One. 2013;8(3):e58855. doi: 10.1371/journal.pone.0058855. | Click |
9 | The Combination of Chrysin and Cisplatin Induces Apoptosis in HepG2 through Down-regulation of cFLIP and Activity of Caspase. Anticancer Agents Med Chem. 2023;23(4):432-439. doi: 10.2174/1871520622666220615121525. | Click |
10 | Necroptosis Induced by Delta-Tocotrienol Overcomes Docetaxel Chemoresistance in Prostate Cancer Cells. Int J Mol Sci. 2023 Mar 3;24(5):4923. doi: 10.3390/ijms24054923. | Click |
11 | EGCG sensitizes human nasopharyngeal carcinoma cells to TRAIL-mediated apoptosis by activation NF-κB. Neoplasma. 2017;64(1):74-80. doi: 10.4149/neo_2017_109. | Click |
12 | Icaritin Sensitizes Human Glioblastoma Cells to TRAIL-Induced Apoptosis. Cell Biochem Biophys. 2015 Jun;72(2):533-42. doi: 10.1007/s12013-014-0499-y. | Click |
13 | Irigenin sensitizes TRAIL-induced apoptosis via enhancing pro-apoptotic molecules in gastric cancer cells. Biochem Biophys Res Commun. 2018 Feb 12;496(3):998-1005. doi: 10.1016/j.bbrc.2018.01.003. | Click |
14 | Kaempferol sensitizes tumor necrosis factor-related apoptosis-inducing ligand-resistance chronic myelogenous leukemia cells to apoptosis. Mol Biol Rep. 2022 Jan;49(1):19-29. doi: 10.1007/s11033-021-06778-z. | Click |
15 | Kurarinone Synergizes TRAIL-Induced Apoptosis in Gastric Cancer Cells. Cell Biochem Biophys. 2015 May;72(1):241-9. doi: 10.1007/s12013-014-0444-0. | Click |
16 | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. | Click |
17 | Combined Parthenolide and Balsalazide Have Enhanced Antitumor Efficacy Through Blockade of NF-κB Activation. Mol Cancer Res. 2017 Feb;15(2):141-151. doi: 10.1158/1541-7786.MCR-16-0101. | Click |
18 | Plumbagin enhances TRAIL-induced apoptosis of human leukemic Kasumi‑1 cells through upregulation of TRAIL death receptor expression, activation of caspase-8 and inhibition of cFLIP. Oncol Rep. 2017;37(6):3423-3432. doi:10.3892/or.2017.5627 | Click |
19 | Shikonin sensitizes A549 cells to TRAIL-induced apoptosis through the JNK, STAT3 and AKT pathways. BMC Cell Biol. 2018 Dec 29;19(1):29. doi: 10.1186/s12860-018-0179-7. | Click |
20 | Tectorigenin sensitizes paclitaxel-resistant human ovarian cancer cells through downregulation of the Akt and NFκB pathway. Carcinogenesis. 2012 Dec;33(12):2488-98. doi: 10.1093/carcin/bgs302. | Click |
21 | Tubeimoside-1 Enhances TRAIL-Induced Apoptotic Cell Death through STAMBPL1-Mediated c-FLIP Downregulation. Int J Mol Sci. 2023 Jul 24;24(14):11840. doi: 10.3390/ijms241411840. | Click |
22 | Amentoflavone enhances sorafenib-induced apoptosis through extrinsic and intrinsic pathways in sorafenib-resistant hepatocellular carcinoma SK-Hep1 cells in vitro. Oncol Lett. 2017 Sep;14(3):3229-3234. doi: 10.3892/ol.2017.6540. | Click |