| Name | Tumor necrosis factor | ||
| UniProt ID | TNFA_HUMAN | ||
| Gene Name | TNF | ||
| Gene ID | 7124 | ||
| Synonyms |
TNF, DIF, TNF-alpha, TNFA, TNFSF2, TNLG1F
|
||
| Sequence |
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.A.24.1.1; 1.C.111.1.13; 1.C.39.3.3; 1.C.81.2.3; 1.L.1.1.1 | ||
| KEGG ID | hsa7124 | ||
| TTD ID | T20178 | ||
| Pfam | PF00229 | ||
| Pair Name | Acteoside, Thymic stromal lymphopoietin | |||
| Phytochemical Name | Acteoside | |||
| Anticancer drug Name | Thymic stromal lymphopoietin | |||
| Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | These results indicate that acteoside is a specific regulator of MDM2 activation in TSLP-stimulated mast cells, which indicates its potential use for the treatment of mast cell-mediated inflammatory diseases. | |||
| Pair Name | Aloin, Doxorubicin | |||
| Phytochemical Name | Aloin | |||
| Anticancer drug Name | Doxorubicin | |||
| Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | Our results highlight the necessity to further investigate the chemopreventive effects of aloin against other chemotherapeutic agents. | |||
| Pair Name | Carvacrol, Sorafenib | |||
| Phytochemical Name | Carvacrol | |||
| Anticancer drug Name | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Tumor necrosis factor | Expression | |
| Result | CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC. | |||
| Pair Name | Curcumin, Temozolomide | |||
| Phytochemical Name | Curcumin | |||
| Anticancer drug Name | Temozolomide | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Up-regulation | Tumor necrosis factor | Expression | |
| Result | We showed for the first time that exosomes released from drug-treated U87 cells could be a new therapeutic approach in glioblastoma, and could reduce the side effects produced by drugs alone. This concept needs to be further examined in animal models before clinical trials could be considered. | |||
| Pair Name | Ilexgenin A, Sorafenib | |||
| Phytochemical Name | Ilexgenin A | |||
| Anticancer drug Name | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | The results described in the present study identifies Ilexgenin A as a promising therapeutic candidate that modulates inflammation, angiogenesis, and HCC growth. | |||
| Pair Name | Isovitexin, Cisplatin | |||
| Phytochemical Name | Isovitexin | |||
| Anticancer drug Name | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Tumor necrosis factor | Expression | |
| Result | IVT not only inhibited cell proliferation and glucose metabolism via downregulating the expression of PKM2 to enhance the antitumor activity of DDP against lung cancer cells, and improved DDP-induced immunotoxicity in mice. It also presented a novel strategy to enhance the anti-tumor effect of platinum-based chemotherapy against NSCLC. | |||
| Pair Name | Juglone, Indomethacin | |||
| Phytochemical Name | Juglone | |||
| Anticancer drug Name | Indomethacin | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | IND and JUG reduce the inflammatory activity and induce apoptotic cell death, while JUG effectively prevents IND induced gastric ulceration. These findings establish that a combination of IND + JUG may serve as a promising treatment regimen for colon cancer. | |||
| Pair Name | Resveratrol, Cisplatin | |||
| Phytochemical Name | Resveratrol | |||
| Anticancer drug Name | Cisplatin | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest | |||
| Pair Name | Usnic acid, Bleomycin | |||
| Phytochemical Name | Usnic acid | |||
| Anticancer drug Name | Bleomycin | |||
| Disease Info | [ICD-11: 2F94] | Ascitic tumor | Investigative | |
| Regulate Info | Up-regulation | Tumor necrosis factor | Expression | |
| Result | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin | |||
| Pair Name | All-trans retinoic acid, Anti-PD-L1 antibody | |||
| Phytochemical | All-trans-retinoic acid | |||
| Drug | Anti-PD-L1 antibody | |||
| Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
| Regulate Info | Up-regulation | Tumor necrosis factor | Expression | |
| Result | Inhibition of myeloid-derived suppressive cell function with all-trans retinoic acid enhanced anti-PD-L1 efficacy in cervical cancer. | |||
| Pair Name | Astaxanthin, Cytarabine | |||
| Phytochemical | Astaxanthin | |||
| Drug | Cytarabine | |||
| Disease Info | [ICD-11: 2B33.3] | Acute lymphoblastic leukemia | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | Co-treatment of ASX and Ara-C has synergism effects on apoptosis pathways, cell proliferation inhibition, and decreased inflammation. | |||
| Pair Name | Curcumin, Docetaxel | |||
| Phytochemical | Curcumin | |||
| Drug | Docetaxel | |||
| Disease Info | [ICD-11: 2C31.Z] | Head and neck squamous cell carcinoma | Investigative | |
| Regulate Info | Up-regulation | Tumor necrosis factor | Expression | |
| Result | Curcumin Enhances the Efficacy of Docetaxel by Promoting Anti-Tumor Immune Response in Head and Neck Squamous Cell Carcinoma | |||
| Pair Name | Harmine, Paclitaxel | |||
| Phytochemical | Harmine | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer | |||
| Pair Name | Juglone, Indomethacin | |||
| Phytochemical | Juglone | |||
| Drug | Indomethacin | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | A combination of both was shown to be more effective, suggesting that juglone may be considered for therapeutic intervention of colon cancer. | |||
| Pair Name | lambda-Carrageenan Oligosaccharides, Fluorouracil | |||
| Phytochemical | lambda-Carrageenan Oligosaccharides | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | Tumor necrosis factor | Expression | |
| Result | These findings suggested that λ-COS could be used as an immune-modulating agent for chemotherapy. | |||
| Pair Name | Piperlongumine, Doxorubicin | |||
| Phytochemical | Piperlongumine | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells | |||
| Pair Name | Quercetin, Anti-PD-1 antibody | |||
| Phytochemical | Quercetin | |||
| Drug | Anti-PD-1 antibody | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity. | |||
| Pair Name | Rosmarinic acid, Indoleamine 2,3-dioxygenase 1 | |||
| Phytochemical | Rosmarinic acid | |||
| Drug | Indoleamine 2,3-dioxygenase 1 | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | The mechanism might be related to regulating immune response and immunocytokines, as well as alleviating immunosuppression induced by Tregs in the tumor immune microenvironment. | |||
| Pair Name | Rosmarinic acid, Paclitaxel | |||
| Phytochemical | Rosmarinic acid | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | Rosmarinic acid exerted chemo-preventive and therapeutic potential alone or in combination with Paclitaxel. Moreover, rosmarinic acid targets numerous signaling pathways associated with breast cancer. | |||
| Pair Name | Thymoquinone, Bortezomib | |||
| Phytochemical | Thymoquinone | |||
| Drug | Bortezomib | |||
| Disease Info | [ICD-11: 2A85.5] | Mantle cell lymphoma | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor | Expression | |
| Result | Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-KappaB regulated gene products in multiple myeloma xenograft mouse model | |||
| No. | Title | Href |
|---|---|---|
| 1 | Acteoside attenuates TSLP-induced mast cell proliferation via down-regulating MDM2. Int Immunopharmacol. 2015 May;26(1):23-9. doi: 10.1016/j.intimp.2015.03.003. | Click |
| 2 | Aloin alleviates doxorubicin-induced cardiotoxicity in rats by abrogating oxidative stress and pro-inflammatory cytokinesAloin alleviates doxorubicin-induced cardiotoxicity in rats by abrogating oxidative stress and pro-inflammatory cytokines. Cancer Chemother Pharmacol. 2020 Sep;86(3):419-426. doi: 10.1007/s00280-020-04125-w. | Click |
| 3 | Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. | Click |
| 4 | Exosomes released from U87 glioma cells treated with curcumin and/or temozolomide produce apoptosis in naive U87 cells. Pathol Res Pract. 2023 May;245:154427. doi: 10.1016/j.prp.2023.154427. | Click |
| 5 | Ilexgenin A exerts anti-inflammation and anti-angiogenesis effects through inhibition of STAT3 and PI3K pathways and exhibits synergistic effects with Sorafenib on hepatoma growth. Toxicol Appl Pharmacol. 2017 Jan 15;315:90-101. doi: 10.1016/j.taap.2016.12.008. | Click |
| 6 | Isovitexin potentiated the antitumor activity of cisplatin by inhibiting the glucose metabolism of lung cancer cells and reduced cisplatin-induced immunotoxicity in mice. Int Immunopharmacol. 2021 May;94:107357. doi: 10.1016/j.intimp.2020.107357. | Click |
| 7 | Effects of combined treatment with Indomethacin and Juglone on AOM/DSS induced colon carcinogenesis in Balb/c mice: Roles of inflammation and apoptosis. Life Sci. 2021 Jan 1;264:118657. doi: 10.1016/j.lfs.2020.118657. | Click |
| 8 | Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest. Front Pharmacol. 2023;13:1068863. Published 2023 Jan 4. doi:10.3389/fphar.2022.1068863. | Click |
| 9 | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. | Click |
| 10 | Inhibition of myeloid-derived suppressive cell function with all-trans retinoic acid enhanced anti-PD-L1 efficacy in cervical cancer. Sci Rep. 2022 Jun 10;12(1):9619. doi: 10.1038/s41598-022-13855-1. | Click |
| 11 | Astaxanthin decreases the growth-inhibitory dose of cytarabine and inflammatory response in the acute lymphoblastic leukemia cell line NALM-6. Mol Biol Rep. 2022 Jul;49(7):6415-6422. doi: 10.1007/s11033-022-07452-8. | Click |
| 12 | Curcumin Enhances the Efficacy of Docetaxel by Promoting Anti-Tumor Immune Response in Head and Neck Squamous Cell Carcinoma. Cancer Invest. 2023 May;41(5):524-533. doi: 10.1080/07357907.2023.2194420. | Click |
| 13 | Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer. Oncol Lett. 2016 Aug;12(2):983-988. doi: 10.3892/ol.2016.4696. | Click |
| 14 | Indomethacin and juglone inhibit inflammatory molecules to induce apoptosis in colon cancer cells. J Biochem Mol Toxicol. 2020 Feb;34(2):e22433. doi: 10.1002/jbt.22433. | Click |
| 15 | The Antitumor Potential of λ-Carrageenan Oligosaccharides on Gastric Carcinoma by Immunomodulation. Nutrients. 2023 Apr 24;15(9):2044. doi: 10.3390/nu15092044. | Click |
| 16 | Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells. Chem Biol Interact. 2022 Feb 25;354:109832. doi: 10.1016/j.cbi.2022.109832. | Click |
| 17 | Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. | Click |
| 18 | Effects of gene silencing of indoleamine 2,3-dioxygenase 1 combined with rosmarinic acid on tumor immune microenvironment in H22 tumor-bearing mice. Int Immunopharmacol. 2023 Jun;119:110193. doi: 10.1016/j.intimp.2023.110193. | Click |
| 19 | Rosmarinic acid suppresses inflammation, angiogenesis, and improves paclitaxel induced apoptosis in a breast cancer model via NF3 κB-p53-caspase-3 pathways modulation. J Appl Biomed. 2021 Dec;19(4):202-209. doi: 10.32725/jab.2021.024. | Click |
| 20 | Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-κB regulated gene products in multiple myeloma xenograft mouse model. Oncotarget. 2014 Feb 15;5(3):634-48. doi: 10.18632/oncotarget.1596. | Click |
