| Name | Transcription factor Jun | ||
| UniProt ID | JUN_HUMAN | ||
| Gene Name | JUN | ||
| Gene ID | 3725 | ||
| Synonyms |
JUN, AP-1, AP1, c-Jun, cJUN, p39
|
||
| Sequence |
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.A.1.11.36; 1.A.10.1.8; 1.A.109.1.1; 1.A.112.2.3 | ||
| KEGG ID | hsa3725 | ||
| TTD ID | T69085 | ||
| Pfam | PF00170; PF03131; PF03153; PF03957; PF04012; PF05377; PF06005; PF07716; PF08702; PF11932; PF14775 | ||
| Pair Name | Mahanine, Cisplatin | |||
| Phytochemical Name | Mahanine | |||
| Anticancer drug Name | Cisplatin | |||
| Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
| Regulate Info | Down-regulation | Transcription factor Jun | Expression | |
| Result | Our results revealed that mahanine may be a prospective agent to reduce the concentration of cisplatin in adjunct for the treatment of cancer and thereby decreasing its toxicity. | |||
| Pair Name | Brassinolid, Doxorubicin | |||
| Phytochemical | Brassinolid | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Transcription factor Jun | Expression | |
| Result | These data indicate that EB, a natural product with widespread occurrence in plants, is pharmacologically active in both drug-sensitive and drug-resistant SCLC cells and acts through the Wnt signaling pathway. | |||
| Pair Name | Caffeic acid, Paclitaxel | |||
| Phytochemical | Caffeic acid | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Transcription factor Jun | Cleavage | |
| Result | Our results indicated that CA inhibited NSCLC H1299 cell growth by inducing apoptosis and CA and PTX combined produced a synergistic anti-cancer effect in H1299 cells. | |||
| Pair Name | Daidzein, Gefitinib | |||
| Phytochemical | Daidzein | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Transcription factor Jun | Activity | |
| Result | Daidzein Synergizes with Gefitinib to Induce ROS/JNK/c-Jun Activation and Inhibit EGFR-STAT/AKT/ERK Pathways to enhance Lung Adenocarcinoma cells chemosensitivity | |||
| Pair Name | Paeoniflorin, Talatizidine | |||
| Phytochemical | Paeoniflorin | |||
| Drug | Talatizidine | |||
| Disease Info | [ICD-11: FA20] | Rheumatoid arthritis | Investigative | |
| Regulate Info | Down-regulation | Transcription factor Jun | Expression | |
| Result | This study identified PAE and TLT as the main BACs of WTD in alleviating the severity of RA, and also developed a novel combination of PAE and TLT as a promising candidate drug for RA therapy. | |||
| Pair Name | Sanguinarium, Cisplatin | |||
| Phytochemical | Sanguinarium | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Down-regulation | Transcription factor Jun | Phosphorylation | |
| Result | Our findings demonstrate that SNG induces mitochondrial and caspase-dependent apoptosis, generates oxidative stress, and suppresses MM cell lines proliferation. In addition, co-treatment of MM cell lines with sub-toxic doses of SNG and BTZ potentiated the cytotoxic activity. These results would suggest that SNG could be developed into therapeutic agent either alone or in combination with other anticancer drugs in MM. | |||
| Pair Name | Sulforaphene, Carboplatin | |||
| Phytochemical | Sulforaphene | |||
| Drug | Carboplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Transcription factor Jun | Expression | |
| Result | This study demonstrates that the duel character of this combination therapy may be an effective replacement for conventional therapy alone against NSCLC. | |||
| Pair Name | Tectochrysin, Cetuximab | |||
| Phytochemical | Tectochrysin | |||
| Drug | Cetuximab | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Transcription factor Jun | Activity | |
| Result | Our results indicate that combined therapy with lower concentration of cetuximab and tectochrysin could significantly enhance the cancer cell growth inhibitory effect through the inhibition of EGFR signaling. | |||
| Pair Name | Cepharanthine, Cisplatin | |||
| Phytochemical | Cepharanthine | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B70] | Esophageal cancer | Investigative | |
| Regulate Info | Up-regulation | Transcription factor Jun | Phosphorylation | |
| Result | Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals | |||
| Pair Name | Mitocurcumin, Cytarabine | |||
| Phytochemical | Mitocurcumin | |||
| Drug | Cytarabine | |||
| Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
| Regulate Info | Up-regulation | Transcription factor Jun | Cleavage | |
| Result | The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis. | |||
| Pair Name | Sclareol, Cisplatin | |||
| Phytochemical | Sclareol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Transcription factor Jun | Expression | |
| Result | Sclareol has potential as an adjuvant for the treatment in NSCLC patients with cisplatin resistance. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Improved chemosensitivity in cervical cancer to cisplatin: synergistic activity of mahanine through STAT3 inhibition. Cancer Lett. 2014 Aug 28;351(1):81-90. doi: 10.1016/j.canlet.2014.05.005. | Click |
| 2 | The effect of brassinolide, a plant steroid hormone, on drug resistant small-cell lung carcinoma cells. Biochem Biophys Res Commun. 2017 Nov 4;493(1):783-787. doi: 10.1016/j.bbrc.2017.08.094. | Click |
| 3 | Synergistic Anticancer Activity of Combined Use of Caffeic Acid with Paclitaxel Enhances Apoptosis of Non-Small-Cell Lung Cancer H1299 Cells in Vivo and in Vitro. Cell Physiol Biochem. 2018;48(4):1433-1442. doi: 10.1159/000492253. | Click |
| 4 | Daidzein Synergizes with Gefitinib to Induce ROS/JNK/c-Jun Activation and Inhibit EGFR-STAT/AKT/ERK Pathways to enhance Lung Adenocarcinoma cells chemosensitivity. Int J Biol Sci. 2022 May 16;18(9):3636-3652. doi: 10.7150/ijbs.71870. | Click |
| 5 | Exploring and characterizing a novel combination of paeoniflorin and talatizidine for the treatment of rheumatoid arthritis. Pharmacol Res. 2020 Mar;153:104658. doi: 10.1016/j.phrs.2020.104658. | Click |
| 6 | Sanguinarine promotes ovarian cancer chemosensitivity to cisplatin by blocking the EGFR/erbB2 signaling pathway. Acta Medica Mediterranea. 2022 Oct 20;39:481-486. doi: 10.19193/0393-6384_2023_2_68. | Click |
| 7 | Sulforaphene-Carboplatin Combination Synergistically Enhances Apoptosis by Disruption of Mitochondrial Membrane Potential and Cell Cycle Arrest in Human Non-Small Cell Lung Carcinoma. J Med Food. 2016 Sep;19(9):860-9. doi: 10.1089/jmf.2016.3675. | Click |
| 8 | Synergistic inhibitory effect of cetuximab and tectochrysin on human colon cancer cell growth via inhibition of EGFR signal. Arch Pharm Res. 2016 May;39(5):721-9. doi: 10.1007/s12272-016-0735-7. | Click |
| 9 | Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals. Oncotarget. 2017 Nov 27;8(67):111144-111160. doi: 10.18632/oncotarget.22676. | Click |
| 10 | Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004 | Click |
| 11 | Sclareol ameliorated ERCC1-mediated cisplatin resistance in A549 human lung adenocarcinoma cells and a murine xenograft tumor model by suppressing AKT-GSK3β-AP1/Snail and JNK-AP1 pathways. Chem Biol Interact. 2020 Dec 1;332:109304. doi: 10.1016/j.cbi.2020.109304. | Click |
