| Name | Eukaryotic translation initiation factor 2 subunit 1 | ||
| UniProt ID | IF2A_HUMAN | ||
| Gene Name | EIF2S1 | ||
| Gene ID | 1965 | ||
| Synonyms |
EIF2S1, EIF-2, EIF-2A, EIF-2alpha, EIF2, EIF2A
|
||
| Sequence |
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV DGDDDAEEMEAKAED |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 8.A.23.1.57; 8.A.23.1.65 | ||
| KEGG ID | hsa1965 | ||
| Pfam | PF00575; PF07541; PF14627 | ||
| Pair Name | alpha-Mangostin, Sorafenib | |||
| Phytochemical | alpha-Mangostin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Phosphorylation | |
| Result | These data demonstrate an unanticipated synergy between α-Mangostin and sorafenib, with mechanistic actions that convert a known safe natural product to a candidate combinatorial therapeutic agent. | |||
| Pair Name | Anacardic Acid, Bortezomib | |||
| Phytochemical | Anacardic Acid | |||
| Drug | Bortezomib | |||
| Disease Info | [ICD-11: 2A83] | Multiple myeloma | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Phosphorylation | |
| Result | The results of the present study suggest that AA/Bor combination may be a potential therapeutic strategy for MM treatment. | |||
| Pair Name | Casticin, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Casticin | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Phosphorylation | |
| Result | Casticin enhances TRAIL-induced apoptosis through the downregulation of cell survival proteins and the upregulation of DR5 receptors through actions on the ROS-ER stress-CHOP pathway. | |||
| Pair Name | Dihydroartemisinin, Oxaliplatin | |||
| Phytochemical | Dihydroartemisinin | |||
| Drug | Oxaliplatin | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Phosphorylation | |
| Result | We demonstrated an improved therapeutic strategy for CRC patients by combining DHA and oxaliplatin treatments. | |||
| Pair Name | Medicarpin, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Medicarpin | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2B33.1] | Myeloid leukemia | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Phosphorylation | |
| Result | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway | |||
| Pair Name | Phenethyl isothiocyanate, Gefitinib | |||
| Phytochemical | Phenethyl isothiocyanate | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Phosphorylation | |
| Result | We explored the prospect of PEITC in improving the efficacy of targeted drug therapy and demonstrated the synergistic effects and underlined mechanisms of PEITC combined with Gefitinib in NSCLC cells treatment. This study provided useful information for developing novel therapy strategies by combination treatment of PEITC with targeted drugs. | |||
| Pair Name | Phenethyl isothiocyanate, Irinotecan | |||
| Phytochemical | Phenethyl isothiocyanate | |||
| Drug | Irinotecan | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Expression | |
| Result | PEITC potentiates IRI anticancer activity by promoting cell apoptosis in the human colon HCT 116 cells. Thus, PEITC may be a potential enhancer for IRI in humans as an anticolon cancer drug in the future. | |||
| Pair Name | Pristimerin, Sorafenib | |||
| Phytochemical | Pristimerin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Phosphorylation | |
| Result | Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway | |||
| Pair Name | Resveratrol, Cisplatin | |||
| Phytochemical | Resveratrol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Phosphorylation | |
| Result | These results indicated that RES is a promising adjuvant for DDP during GC chemotherapy. | |||
| Pair Name | Shikonin, Osimertinib | |||
| Phytochemical | Shikonin | |||
| Drug | Osimertinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Phosphorylation | |
| Result | Shikonin increased the anticancer activity of AZD9291 in primary wtEGFR NSCLC cells through ROS-mediated ER stress | |||
| Pair Name | Shogaol, Gefitinib | |||
| Phytochemical | Shogaol | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2C73] | Ovarian Cancer | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Phosphorylation | |
| Result | Our results suggest that 6-shogaol exerts a potential anti-cancer effect in ovarian cancer and combination treatment with 6-shogaol and gefitinib may provide a novel anti-tumor therapeutic strategy in gefitinib-resistant ovarian cancer. | |||
| Pair Name | Tannic acid, Cisplatin | |||
| Phytochemical | Tannic acid | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Expression | |
| Result | The combination of TA and CDDP may produce synergistic antitumoral effects mediated by the PERK-ATF4-CHOP apoptotic axis, suggesting a novel adjuvant treatment for lung cancer. | |||
| Pair Name | Withaferin A, Fluorouracil | |||
| Phytochemical | Withaferin A | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Expression | |
| Result | Synergistic antitumor effect of 5-fluorouracil and withaferin-A induces endoplasmic reticulum stress-mediated autophagy and apoptosis in colorectal cancer cells | |||
| Pair Name | Zerumbone, Celecoxib | |||
| Phytochemical | Zerumbone | |||
| Drug | Celecoxib | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Phosphorylation | |
| Result | Our results provide novel insights into the role of ATF3 as an essential transcription factor for p53-independent DR5 induction upon both ZER and CCB treatment, and this may be a useful biomarker for TRAIL-based anticancer therapy. | |||
| Pair Name | Honokiol, Paclitaxel | |||
| Phytochemical | Honokiol | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Eukaryotic translation initiation factor 2 subunit 1 | Phosphorylation | |
| Result | Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction | |||
| No. | Title | Href |
|---|---|---|
| 1 | Inhibition of Cell Proliferation in an NRAS Mutant Melanoma Cell Line by Combining Sorafenib and α-Mangostin. PLoS One. 2016 May 6;11(5):e0155217. doi: 10.1371/journal.pone.0155217. | Click |
| 2 | Combined therapeutic effects of bortezomib and anacardic acid on multiple myeloma cells via activation of the endoplasmic reticulum stress response. Mol Med Rep. 2016 Sep;14(3):2679-84. doi: 10.3892/mmr.2016.5533. | Click |
| 3 | Casticin potentiates TRAIL-induced apoptosis of gastric cancer cells through endoplasmic reticulum stress. PLoS One. 2013;8(3):e58855. doi: 10.1371/journal.pone.0058855. | Click |
| 4 | Dihydroartemisinin enhances the anti-tumor activity of oxaliplatin in colorectal cancer cells by altering PRDX2-reactive oxygen species-mediated multiple signaling pathways. Phytomedicine. 2022 Apr;98:153932. doi: 10.1016/j.phymed.2022.153932. | Click |
| 5 | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. | Click |
| 6 | Phenethyl isothiocyanate synergistically induces apoptosis with Gefitinib in non-small cell lung cancer cells via endoplasmic reticulum stress-mediated degradation of Mcl-1. Mol Carcinog. 2020 Jun;59(6):590-603. doi: 10.1002/mc.23184. | Click |
| 7 | Phenethyl isothiocyanate and irinotecan synergistically induce cell apoptosis in colon cancer HCT 116 cells in vitro. Environ Toxicol. 2024 Jan;39(1):457-469. doi: 10.1002/tox.23993. | Click |
| 8 | Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway. Phytomedicine. 2021 Jun;86:153563. doi: 10.1016/j.phymed.2021.153563. | Click |
| 9 | Resveratrol synergizes with cisplatin in antineoplastic effects against AGS gastric cancer cells by inducing endoplasmic reticulum stress‑mediated apoptosis and G2/M phase arrest. Oncol Rep. 2020 Oct;44(4):1605-1615. doi: 10.3892/or.2020.7708. | Click |
| 10 | A natural anthraquinone derivative shikonin synergizes with AZD9291 against wtEGFR NSCLC cells through reactive oxygen species-mediated endoplasmic reticulum stress. Phytomedicine. 2020 Mar;68:153189. doi: 10.1016/j.phymed.2020.153189. | Click |
| 11 | 6-Shogaol Overcomes Gefitinib Resistance via ER Stress in Ovarian Cancer Cells. Int J Mol Sci. 2023 Jan 30;24(3):2639. doi: 10.3390/ijms24032639. | Click |
| 12 | Synergistic anticancer activity of cisplatin combined with tannic acid enhances apoptosis in lung cancer through the PERK-ATF4 pathway. Eur J Med Res. 2023 Oct 27;28(1):462. doi: 10.1186/s40001-023-01420-z. | Click |
| 13 | Synergistic antitumor effect of 5-fluorouracil and withaferin-A induces endoplasmic reticulum stress-mediated autophagy and apoptosis in colorectal cancer cells. Am J Cancer Res. 2020 Mar 1;10(3):799-815. | Click |
| 14 | Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib. J Biol Chem. 2014 Aug 1;289(31):21544-61. doi: 10.1074/jbc.M114.558890. | Click |
| 15 | Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction. Cell Oncol (Dordr). 2021 Feb;44(1):135-150. doi: 10.1007/s13402-020-00557-x. | Click |
