InterPAD - DETAILS

MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS

No.	Title	Href
1	Acteoside attenuates TSLP-induced mast cell proliferation via down-regulating MDM2. Int Immunopharmacol. 2015 May;26(1):23-9. doi: 10.1016/j.intimp.2015.03.003.	`Click`
2	Aloin alleviates doxorubicin-induced cardiotoxicity in rats by abrogating oxidative stress and pro-inflammatory cytokinesAloin alleviates doxorubicin-induced cardiotoxicity in rats by abrogating oxidative stress and pro-inflammatory cytokines. Cancer Chemother Pharmacol. 2020 Sep;86(3):419-426. doi: 10.1007/s00280-020-04125-w.	`Click`
3	Paeonol Protects Against Methotrexate-Induced Nephrotoxicity via Upregulation of P-gp Expression and Inhibition of TLR4/NF-κB Pathway. Front Pharmacol. 2022 Feb 4;13:774387. doi: 10.3389/fphar.2022.774387.	`Click`
4	Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest. Front Pharmacol. 2023;13:1068863. Published 2023 Jan 4. doi:10.3389/fphar.2022.1068863.	`Click`
5	Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004.	`Click`
6	Baicalin; a promising chemopreventive agent, enhances the antitumor effect of 5-FU against breast cancer and inhibits tumor growth and angiogenesis in Ehrlich solid tumor. Biomed Pharmacother. 2022 Feb;146:112599. doi: 10.1016/j.biopha.2021.112599.	`Click`
7	Codonopsis pilosula polysaccharide in synergy with dacarbazine inhibits mouse melanoma by repolarizing M2-like tumor-associated macrophages into M1-like tumor-associated macrophages. Biomed Pharmacother. 2021;142:112016. doi:10.1016/j.biopha.2021.112016	`Click`
8	Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178.	`Click`
9	Eugenol Exerts Apoptotic Effect and Modulates the Sensitivity of HeLa Cells to Cisplatin and Radiation. Molecules. 2019 Nov 3;24(21):3979. doi: 10.3390/molecules24213979.	`Click`
10	Eugenol enhances the chemotherapeutic potential of gemcitabine and induces anticarcinogenic and anti-inflammatory activity in human cervical cancer cells. Cancer Biother Radiopharm. 2011 Oct;26(5):519-27. doi: 10.1089/cbr.2010.0925.	`Click`
11	Galangin Enhances Anticancer Efficacy of 5-Fluorouracil in Esophageal Cancer Cells and Xenografts Through NLR Family Pyrin Domain Containing 3 (NLRP3) Downregulation. Med Sci Monit. 2021 Dec 17;27:e931630. doi: 10.12659/MSM.931630.	`Click`
12	Targeting MTA1/HIF-1α signaling by pterostilbene in combination with histone deacetylase inhibitor attenuates prostate cancer progression. Cancer Med. 2017 Nov;6(11):2673-2685. doi: 10.1002/cam4.1209.	`Click`
13	Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327.	`Click`
14	The Combination of Sulforaphane and Fernblock® XP Improves Individual Beneficial Effects in Normal and Neoplastic Human Skin Cell Lines. Nutrients. 2020 May 30;12(6):1608. doi: 10.3390/nu12061608.	`Click`

No.

Title

Href

Acteoside attenuates TSLP-induced mast cell proliferation via down-regulating MDM2. Int Immunopharmacol. 2015 May;26(1):23-9. doi: 10.1016/j.intimp.2015.03.003.

Click

Aloin alleviates doxorubicin-induced cardiotoxicity in rats by abrogating oxidative stress and pro-inflammatory cytokinesAloin alleviates doxorubicin-induced cardiotoxicity in rats by abrogating oxidative stress and pro-inflammatory cytokines. Cancer Chemother Pharmacol. 2020 Sep;86(3):419-426. doi: 10.1007/s00280-020-04125-w.

Click

Paeonol Protects Against Methotrexate-Induced Nephrotoxicity via Upregulation of P-gp Expression and Inhibition of TLR4/NF-κB Pathway. Front Pharmacol. 2022 Feb 4;13:774387. doi: 10.3389/fphar.2022.774387.

Click

Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest. Front Pharmacol. 2023;13:1068863. Published 2023 Jan 4. doi:10.3389/fphar.2022.1068863.

Click

Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004.

Click

Baicalin; a promising chemopreventive agent, enhances the antitumor effect of 5-FU against breast cancer and inhibits tumor growth and angiogenesis in Ehrlich solid tumor. Biomed Pharmacother. 2022 Feb;146:112599. doi: 10.1016/j.biopha.2021.112599.

Click

Codonopsis pilosula polysaccharide in synergy with dacarbazine inhibits mouse melanoma by repolarizing M2-like tumor-associated macrophages into M1-like tumor-associated macrophages. Biomed Pharmacother. 2021;142:112016. doi:10.1016/j.biopha.2021.112016

Click

Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178.

Click

Eugenol Exerts Apoptotic Effect and Modulates the Sensitivity of HeLa Cells to Cisplatin and Radiation. Molecules. 2019 Nov 3;24(21):3979. doi: 10.3390/molecules24213979.

Click

Eugenol enhances the chemotherapeutic potential of gemcitabine and induces anticarcinogenic and anti-inflammatory activity in human cervical cancer cells. Cancer Biother Radiopharm. 2011 Oct;26(5):519-27. doi: 10.1089/cbr.2010.0925.

Click

Galangin Enhances Anticancer Efficacy of 5-Fluorouracil in Esophageal Cancer Cells and Xenografts Through NLR Family Pyrin Domain Containing 3 (NLRP3) Downregulation. Med Sci Monit. 2021 Dec 17;27:e931630. doi: 10.12659/MSM.931630.

Click

Targeting MTA1/HIF-1α signaling by pterostilbene in combination with histone deacetylase inhibitor attenuates prostate cancer progression. Cancer Med. 2017 Nov;6(11):2673-2685. doi: 10.1002/cam4.1209.

Click

Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327.

Click

The Combination of Sulforaphane and Fernblock® XP Improves Individual Beneficial Effects in Normal and Neoplastic Human Skin Cell Lines. Nutrients. 2020 May 30;12(6):1608. doi: 10.3390/nu12061608.

Click

Name	Interleukin-1 beta
UniProt ID	IL1B_HUMAN
Gene Name	IL1B
Gene ID	3553
Synonyms	IL1B, IL-1, IL1-BETA, IL1F2, IL1beta
Sequence	MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTKGGQDITDFTMQFVSS
Pathway Map	`MAP LINK`
T.C. Number	1.A.109.1.2
KEGG ID	hsa3553
TTD ID	T42000
Pfam	PF00340; PF02394

Pair Name	Acteoside, Thymic stromal lymphopoietin
Phytochemical Name	Acteoside
Anticancer drug Name	Thymic stromal lymphopoietin
Disease Info	[ICD-11: 2B33.4]	Leukemia	Investigative
Regulate Info	Down-regulation	Interleukin-1 beta	Expression
Result	These results indicate that acteoside is a specific regulator of MDM2 activation in TSLP-stimulated mast cells, which indicates its potential use for the treatment of mast cell-mediated inflammatory diseases.

Pair Name	Aloin, Doxorubicin
Phytochemical Name	Aloin
Anticancer drug Name	Doxorubicin
Disease Info	[ICD-11: 2A00-2F9Z]	Solid tumour or cancer	Investigative
Regulate Info	Down-regulation	Interleukin-1 beta	Expression
Result	Our results highlight the necessity to further investigate the chemopreventive effects of aloin against other chemotherapeutic agents.

Pair Name	Paeonol, Methotrexate
Phytochemical Name	Paeonol
Anticancer drug Name	Methotrexate
Disease Info	[ICD-11: 2B90]	Colon cancer	Investigative
Regulate Info	Down-regulation	Interleukin-1 beta	Expression
Result	Paeonol protects against MTX-induced nephrotoxicity through antioxidant, anti-inflammatory, and antiapoptotic mechanisms and might potentiate MTX chemotherapeutic efficacy.

Pair Name	Resveratrol, Cisplatin
Phytochemical Name	Resveratrol
Anticancer drug Name	Cisplatin
Disease Info	[ICD-11: 2B72]	Gastric cancer	Investigative
Regulate Info	Down-regulation	Interleukin-1 beta	Expression
Result	Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest

Pair Name	Usnic acid, Bleomycin
Phytochemical Name	Usnic acid
Anticancer drug Name	Bleomycin
Disease Info	[ICD-11: 2F94]	Ascitic tumor	Investigative
Regulate Info	Up-regulation	Interleukin-1 beta	Expression
Result	Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin

Pair Name	Baicalin, Fluorouracil
Phytochemical	Baicalin
Drug	Fluorouracil
Disease Info	[ICD-11: 2A00-2F9Z]	Solid tumour or cancer	Investigative
Regulate Info	Down-regulation	Interleukin-1 beta	Expression
Result	BA is a promising preventive or adjuvant therapy in breast cancer treatment with 5-FU mainly via cooperative inhibition of inflammation, angiogenesis, and triggering apoptotic cell death.

Pair Name	Codonopsis pilosula polysaccharide, Dacarbazine
Phytochemical	Codonopsis pilosula polysaccharide
Drug	Dacarbazine
Disease Info	[ICD-11: 2C30]	Melanoma	Investigative
Regulate Info	Up-regulation	Interleukin-1 beta	Expression
Result	It could be deduced that GLCP, CPCP and dCPP hold great potential as safe therapeutic options for melanoma and an immune-modulator which may require further exploration.

Pair Name	Dihydroberberine, Sunitinib
Phytochemical	Dihydroberberine
Drug	Sunitinib
Disease Info	[ICD-11: 2C25]	Lung cancer	Investigative
Regulate Info	Down-regulation	Interleukin-1 beta	Expression
Result	DCS induced the expression of cell cycle signal molecules that are known to be affected by JNK and p38. The change of cell cycle, in turn, led to down-regulation of JNK and p38, and further reduced IL-1 secretion. Collectively, these findings highlight potential molecular mechanisms of DCS chemotherapeutic activity and suggest that DCS is an efficacious strategy in NSCLC therapy.

Pair Name	Eugenol, Cisplatin
Phytochemical	Eugenol
Drug	Cisplatin
Disease Info	[ICD-11: 2C77]	Cervical cancer	Investigative
Regulate Info	Down-regulation	Interleukin-1 beta	Expression
Result	Eugenol showed antiproliferative and cytotoxic effects via apoptosis and also synergism with cisplatin and ionizing radiation in the human cervical cancer cell line.

Pair Name	Eugenol, Gemcitabine
Phytochemical	Eugenol
Drug	Gemcitabine
Disease Info	[ICD-11: 2C77]	Cervical cancer	Investigative
Regulate Info	Down-regulation	Interleukin-1 beta	Expression
Result	The results suggest that eugenol exerts its anticancer activities via apoptosis induction and anti-inflammatory properties and also provide the first evidence demonstrating synergism between eugenol and gemcitabine, which may enhance The therapeutic index of prevention and/or treatment of cervical cancer.

Pair Name	Norizalpinin, Fluorouracil
Phytochemical	Norizalpinin
Drug	Fluorouracil
Disease Info	[ICD-11: 2B70]	Esophageal cancer	Investigative
Regulate Info	Down-regulation	Interleukin-1 beta	Expression
Result	Our results indicated that galangin played a synergistic anticancer role through NLRP3 inflammasome inhibition when paired with FU-5.

Pair Name	Pterostilbene, Vorinostat
Phytochemical	Pterostilbene
Drug	Vorinostat
Disease Info	[ICD-11: 2C82]	Prostate cancer	Investigative
Regulate Info	Down-regulation	Interleukin-1 beta	Expression
Result	Our study provides preclinical evidence that Pter/SAHA combination treatment inhibits MTA1/HIF-1α tumor-promoting signaling in PCa. The beneficial outcome of combinatorial strategy using a natural agent and an approved drug for higher efficacy and less toxicity supports further development of MTA1-targeted therapies in PCa.

Pair Name	Quercetin, Anti-PD-1 antibody
Phytochemical	Quercetin
Drug	Anti-PD-1 antibody
Disease Info	[ICD-11: 2C12]	Hepatocellular carcinoma	Investigative
Regulate Info	Down-regulation	Interleukin-1 beta	Expression
Result	Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity.

Pair Name	Sulforaphane, Fernblock® XP
Phytochemical	Sulforaphane
Drug	Fernblock® XP
Disease Info	[ICD-11: 2C30]	Melanoma	Investigative
Regulate Info	Down-regulation	Interleukin-1 beta	Expression
Result	SFN/FB was more efficient than SFN or FB alone in inhibiting MMP-1 and -3 production and IL-1β secretion in the presence of a pro-inflammatory stimulus such as TNF-α. The potential use of SFN/FB based supplements for the prevention of skin aging and as adjuvants in the treatment of advanced melanoma is suggested.