
| Name | Endoplasmic reticulum chaperone BiP | ||
| UniProt ID | BIP_HUMAN | ||
| Gene Name | HSPA5 | ||
| Gene ID | 3309 | ||
| Synonyms |
HSPA5, BIP, GRP78, HEL-S-89n
|
||
| Sequence |
MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNR
ITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVV EKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQ RQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNG VFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALS SQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIV LVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLG TFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIER MVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEE KIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.A.33.1.5 | ||
| KEGG ID | hsa3309 | ||
| TTD ID | T77594 | ||
| Pfam | PF00012; PF01968; PF02782; PF05318; PF06723; PF08841; PF14450; PF21523 | ||
| Pair Name | Piperlongumine, HSP90 inhibitors | |||
| Phytochemical | Piperlongumine | |||
| Drug | HSP90 inhibitors | |||
| Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | Combination therapy with HSP90 inhibitors and piperlongumine promotes ROS-mediated ER stress in colon cancer cells | |||
| Pair Name | Kaempferol, Cisplatin | |||
| Phytochemical | Kaempferol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | Kaempferol Induces cell death in A2780 ovarian cancer cells and increases their sensitivity to cisplatin by activation of cytotoxic endoplasmic reticulum-mediated autophagy and inhibition of protein kinase B | |||
| Pair Name | Epigallocatechin gallate, Fluorouracil | |||
| Phytochemical | Epigallocatechin gallate | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | Our data show that EGCG may be act as a novel chemo-sensitizer, and the GRP78/NF-κB/miR-155-5p/MDR1 pathway plays a vital role in EGCG enhancing the sensitivity of colorectal cancer to 5-FU. | |||
| Pair Name | Licochalcone B, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Licochalcone B | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC. | |||
| Pair Name | Casticin, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Casticin | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | Casticin enhances TRAIL-induced apoptosis through the downregulation of cell survival proteins and the upregulation of DR5 receptors through actions on the ROS-ER stress-CHOP pathway. | |||
| Pair Name | Withaferin A, Fluorouracil | |||
| Phytochemical | Withaferin A | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | Synergistic antitumor effect of 5-fluorouracil and withaferin-A induces endoplasmic reticulum stress-mediated autophagy and apoptosis in colorectal cancer cells | |||
| Pair Name | Resveratrol, Cisplatin | |||
| Phytochemical | Resveratrol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | These results indicated that RES is a promising adjuvant for DDP during GC chemotherapy. | |||
| Pair Name | Curcumin, Fenretinide | |||
| Phytochemical | Curcumin | |||
| Drug | Fenretinide | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | Our findings suggest that the 2 small molecules, when used in combination, can potentially be effective therapeutic agents for treating NSCLC, at least in part, by regulating endoplasmic reticulum (ER) chaperone protein GRP78. | |||
| Pair Name | Anacardic Acid, Bortezomib | |||
| Phytochemical | Anacardic Acid | |||
| Drug | Bortezomib | |||
| Disease Info | [ICD-11: 2A83.1] | Multiple myeloma | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | The results of the present study suggest that AA/Bor combination may be a potential therapeutic strategy for MM treatment. | |||
| Pair Name | Corilagin, Fluorouracil | |||
| Phytochemical | Corilagin | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | Our results indicate that Corilagin acts as a potentiator of 5-fluorouracil and may have therapeutic potential for patients with CRC. | |||
| Pair Name | Shogaol, Gefitinib | |||
| Phytochemical | Shogaol | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2C73] | Ovarian Cancer | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | Our results suggest that 6-shogaol exerts a potential anti-cancer effect in ovarian cancer and combination treatment with 6-shogaol and gefitinib may provide a novel anti-tumor therapeutic strategy in gefitinib-resistant ovarian cancer. | |||
| Pair Name | Medicarpin, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Medicarpin | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2B33.1] | Myeloid leukemia | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway | |||
| Pair Name | Tannic acid, Cisplatin | |||
| Phytochemical | Tannic acid | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | The combination of TA and CDDP may produce synergistic antitumoral effects mediated by the PERK-ATF4-CHOP apoptotic axis, suggesting a novel adjuvant treatment for lung cancer. | |||
| Pair Name | Zerumbone, Celecoxib | |||
| Phytochemical | Zerumbone | |||
| Drug | Celecoxib | |||
| Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | Our results provide novel insights into the role of ATF3 as an essential transcription factor for p53-independent DR5 induction upon both ZER and CCB treatment, and this may be a useful biomarker for TRAIL-based anticancer therapy. | |||
| Pair Name | Pristimerin, Sorafenib | |||
| Phytochemical | Pristimerin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway | |||
| Pair Name | Phenethyl isothiocyanate, Irinotecan | |||
| Phytochemical | Phenethyl isothiocyanate | |||
| Drug | Irinotecan | |||
| Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | PEITC potentiates IRI anticancer activity by promoting cell apoptosis in the human colon HCT 116 cells. Thus, PEITC may be a potential enhancer for IRI in humans as an anticolon cancer drug in the future. | |||
| Pair Name | Honokiol, Paclitaxel | |||
| Phytochemical | Honokiol | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Endoplasmic reticulum chaperone BiP | Expression | |
| Result | Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction | |||
| No. | Title | Href |
|---|---|---|
| 1 | Combination therapy with HSP90 inhibitors and piperlongumine promotes ROS-mediated ER stress in colon cancer cells. Cell Death Discov. 2023 Oct 13;9(1):375. doi: 10.1038/s41420-023-01672-y. | Click |
| 2 | Kaempferol Induces Cell Death in A2780 Ovarian Cancer Cells and Increases Their Sensitivity to Cisplatin by Activation of Cytotoxic Endoplasmic Reticulum-Mediated Autophagy and Inhibition of Protein Kinase B. Folia Biol (Praha). 2020;66(1):36-46. | Click |
| 3 | (-)-Epigallocatechin Gallate (EGCG) Enhances the Sensitivity of Colorectal Cancer Cells to 5-FU by Inhibiting GRP78/NF-κB/miR-155-5p/MDR1 Pathway. J Agric Food Chem. 2019 Mar 6;67(9):2510-2518. doi: 10.1021/acs.jafc.8b06665. | Click |
| 4 | Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. | Click |
| 5 | Casticin potentiates TRAIL-induced apoptosis of gastric cancer cells through endoplasmic reticulum stress. PLoS One. 2013;8(3):e58855. doi: 10.1371/journal.pone.0058855. | Click |
| 6 | Synergistic antitumor effect of 5-fluorouracil and withaferin-A induces endoplasmic reticulum stress-mediated autophagy and apoptosis in colorectal cancer cells. Am J Cancer Res. 2020 Mar 1;10(3):799-815. | Click |
| 7 | Resveratrol synergizes with cisplatin in antineoplastic effects against AGS gastric cancer cells by inducing endoplasmic reticulum stress‑mediated apoptosis and G2/M phase arrest. Oncol Rep. 2020 Oct;44(4):1605-1615. doi: 10.3892/or.2020.7708. | Click |
| 8 | Synergistic effect of fenretinide and curcumin for treatment of non-small cell lung cancer. Cancer Biol Ther. 2016 Oct 2;17(10):1022-1029. doi: 10.1080/15384047.2016.1219810. | Click |
| 9 | Combined therapeutic effects of bortezomib and anacardic acid on multiple myeloma cells via activation of the endoplasmic reticulum stress response. Mol Med Rep. 2016 Sep;14(3):2679-84. doi: 10.3892/mmr.2016.5533. | Click |
| 10 | Corilagin enhances the anti-tumor activity of 5-FU by downregulating the expression of GRP 78. Sci Rep. 2023 Dec 19;13(1):22661. doi: 10.1038/s41598-023-49604-1. | Click |
| 11 | 6-Shogaol Overcomes Gefitinib Resistance via ER Stress in Ovarian Cancer Cells. Int J Mol Sci. 2023 Jan 30;24(3):2639. doi: 10.3390/ijms24032639. | Click |
| 12 | Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. | Click |
| 13 | Synergistic anticancer activity of cisplatin combined with tannic acid enhances apoptosis in lung cancer through the PERK-ATF4 pathway. Eur J Med Res. 2023 Oct 27;28(1):462. doi: 10.1186/s40001-023-01420-z. | Click |
| 14 | Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib. J Biol Chem. 2014 Aug 1;289(31):21544-61. doi: 10.1074/jbc.M114.558890. | Click |
| 15 | Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway. Phytomedicine. 2021 Jun;86:153563. doi: 10.1016/j.phymed.2021.153563. | Click |
| 16 | Phenethyl isothiocyanate and irinotecan synergistically induce cell apoptosis in colon cancer HCT 116 cells in vitro. Environ Toxicol. 2024 Jan;39(1):457-469. doi: 10.1002/tox.23993. | Click |
| 17 | Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction. Cell Oncol (Dordr). 2021 Feb;44(1):135-150. doi: 10.1007/s13402-020-00557-x. | Click |