TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Endoplasmic reticulum chaperone BiP
UniProt ID BIP_HUMAN
Gene Name HSPA5
Gene ID 3309
Synonyms
HSPA5, BIP, GRP78, HEL-S-89n
Sequence
MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNR
ITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVV
EKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQ
RQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNG
VFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALS
SQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIV
LVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLG
TFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIER
MVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEE
KIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL
Pathway Map MAP LINK
T.C. Number 1.A.33.1.5
KEGG ID hsa3309
TTD ID T77594
Pfam PF00012; PF01968; PF02782; PF05318; PF06723; PF08841; PF14450; PF21523
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 969
Pair Name Piperlongumine, HSP90 inhibitors
Phytochemical Piperlongumine
Drug HSP90 inhibitors
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result Combination therapy with HSP90 inhibitors and piperlongumine promotes ROS-mediated ER stress in colon cancer cells
Combination Pair ID: 630
Pair Name Kaempferol, Cisplatin
Phytochemical Kaempferol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result Kaempferol Induces cell death in A2780 ovarian cancer cells and increases their sensitivity to cisplatin by activation of cytotoxic endoplasmic reticulum-mediated autophagy and inhibition of protein kinase B
Combination Pair ID: 124
Pair Name Epigallocatechin gallate, Fluorouracil
Phytochemical Epigallocatechin gallate
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Endoplasmic reticulum chaperone BiP Expression
Result Our data show that EGCG may be act as a novel chemo-sensitizer, and the GRP78/NF-κB/miR-155-5p/MDR1 pathway plays a vital role in EGCG enhancing the sensitivity of colorectal cancer to 5-FU.
Combination Pair ID: 129
Pair Name Licochalcone B, TNF-related apoptosis inducing ligand
Phytochemical Licochalcone B
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC.
Combination Pair ID: 131
Pair Name Casticin, TNF-related apoptosis inducing ligand
Phytochemical Casticin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result Casticin enhances TRAIL-induced apoptosis through the downregulation of cell survival proteins and the upregulation of DR5 receptors through actions on the ROS-ER stress-CHOP pathway.
Combination Pair ID: 355
Pair Name Withaferin A, Fluorouracil
Phytochemical Withaferin A
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result Synergistic antitumor effect of 5-fluorouracil and withaferin-A induces endoplasmic reticulum stress-mediated autophagy and apoptosis in colorectal cancer cells
Combination Pair ID: 375
Pair Name Resveratrol, Cisplatin
Phytochemical Resveratrol
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result These results indicated that RES is a promising adjuvant for DDP during GC chemotherapy.
Combination Pair ID: 815
Pair Name Curcumin, Fenretinide
Phytochemical Curcumin
Drug Fenretinide
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Endoplasmic reticulum chaperone BiP Expression
Result Our findings suggest that the 2 small molecules, when used in combination, can potentially be effective therapeutic agents for treating NSCLC, at least in part, by regulating endoplasmic reticulum (ER) chaperone protein GRP78.
Combination Pair ID: 420
Pair Name Anacardic Acid, Bortezomib
Phytochemical Anacardic Acid
Drug Bortezomib
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result The results of the present study suggest that AA/Bor combination may be a potential therapeutic strategy for MM treatment.
Combination Pair ID: 865
Pair Name Corilagin, Fluorouracil
Phytochemical Corilagin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Endoplasmic reticulum chaperone BiP Expression
Result Our results indicate that Corilagin acts as a potentiator of 5-fluorouracil and may have therapeutic potential for patients with CRC.
Combination Pair ID: 461
Pair Name Shogaol, Gefitinib
Phytochemical Shogaol
Drug Gefitinib
Disease Info [ICD-11: 2C73] Ovarian Cancer Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result Our results suggest that 6-shogaol exerts a potential anti-cancer effect in ovarian cancer and combination treatment with 6-shogaol and gefitinib may provide a novel anti-tumor therapeutic strategy in gefitinib-resistant ovarian cancer.
Combination Pair ID: 497
Pair Name Medicarpin, TNF-related apoptosis inducing ligand
Phytochemical Medicarpin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B33.1] Myeloid leukemia Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway
Combination Pair ID: 894
Pair Name Tannic acid, Cisplatin
Phytochemical Tannic acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result The combination of TA and CDDP may produce synergistic antitumoral effects mediated by the PERK-ATF4-CHOP apoptotic axis, suggesting a novel adjuvant treatment for lung cancer.
Combination Pair ID: 569
Pair Name Zerumbone, Celecoxib
Phytochemical Zerumbone
Drug Celecoxib
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result Our results provide novel insights into the role of ATF3 as an essential transcription factor for p53-independent DR5 induction upon both ZER and CCB treatment, and this may be a useful biomarker for TRAIL-based anticancer therapy.
Combination Pair ID: 587
Pair Name Pristimerin, Sorafenib
Phytochemical Pristimerin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway
Combination Pair ID: 949
Pair Name Phenethyl isothiocyanate, Irinotecan
Phytochemical Phenethyl isothiocyanate
Drug Irinotecan
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result PEITC potentiates IRI anticancer activity by promoting cell apoptosis in the human colon HCT 116 cells. Thus, PEITC may be a potential enhancer for IRI in humans as an anticolon cancer drug in the future.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 316
Pair Name Honokiol, Paclitaxel
Phytochemical Honokiol
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Endoplasmic reticulum chaperone BiP Expression
Result Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction
03. Reference
No. Title Href
1 Combination therapy with HSP90 inhibitors and piperlongumine promotes ROS-mediated ER stress in colon cancer cells. Cell Death Discov. 2023 Oct 13;9(1):375. doi: 10.1038/s41420-023-01672-y. Click
2 Kaempferol Induces Cell Death in A2780 Ovarian Cancer Cells and Increases Their Sensitivity to Cisplatin by Activation of Cytotoxic Endoplasmic Reticulum-Mediated Autophagy and Inhibition of Protein Kinase B. Folia Biol (Praha). 2020;66(1):36-46. Click
3 (-)-Epigallocatechin Gallate (EGCG) Enhances the Sensitivity of Colorectal Cancer Cells to 5-FU by Inhibiting GRP78/NF-κB/miR-155-5p/MDR1 Pathway. J Agric Food Chem. 2019 Mar 6;67(9):2510-2518. doi: 10.1021/acs.jafc.8b06665. Click
4 Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. Click
5 Casticin potentiates TRAIL-induced apoptosis of gastric cancer cells through endoplasmic reticulum stress. PLoS One. 2013;8(3):e58855. doi: 10.1371/journal.pone.0058855. Click
6 Synergistic antitumor effect of 5-fluorouracil and withaferin-A induces endoplasmic reticulum stress-mediated autophagy and apoptosis in colorectal cancer cells. Am J Cancer Res. 2020 Mar 1;10(3):799-815. Click
7 Resveratrol synergizes with cisplatin in antineoplastic effects against AGS gastric cancer cells by inducing endoplasmic reticulum stress‑mediated apoptosis and G2/M phase arrest. Oncol Rep. 2020 Oct;44(4):1605-1615. doi: 10.3892/or.2020.7708. Click
8 Synergistic effect of fenretinide and curcumin for treatment of non-small cell lung cancer. Cancer Biol Ther. 2016 Oct 2;17(10):1022-1029. doi: 10.1080/15384047.2016.1219810. Click
9 Combined therapeutic effects of bortezomib and anacardic acid on multiple myeloma cells via activation of the endoplasmic reticulum stress response. Mol Med Rep. 2016 Sep;14(3):2679-84. doi: 10.3892/mmr.2016.5533. Click
10 Corilagin enhances the anti-tumor activity of 5-FU by downregulating the expression of GRP 78. Sci Rep. 2023 Dec 19;13(1):22661. doi: 10.1038/s41598-023-49604-1. Click
11 6-Shogaol Overcomes Gefitinib Resistance via ER Stress in Ovarian Cancer Cells. Int J Mol Sci. 2023 Jan 30;24(3):2639. doi: 10.3390/ijms24032639. Click
12 Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429. Click
13 Synergistic anticancer activity of cisplatin combined with tannic acid enhances apoptosis in lung cancer through the PERK-ATF4 pathway. Eur J Med Res. 2023 Oct 27;28(1):462. doi: 10.1186/s40001-023-01420-z. Click
14 Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib. J Biol Chem. 2014 Aug 1;289(31):21544-61. doi: 10.1074/jbc.M114.558890. Click
15 Pristimerin synergistically sensitizes conditionally reprogrammed patient derived-primary hepatocellular carcinoma cells to sorafenib through endoplasmic reticulum stress and ROS generation by modulating Akt/FoxO1/p27kip1 signaling pathway. Phytomedicine. 2021 Jun;86:153563. doi: 10.1016/j.phymed.2021.153563. Click
16 Phenethyl isothiocyanate and irinotecan synergistically induce cell apoptosis in colon cancer HCT 116 cells in vitro. Environ Toxicol. 2024 Jan;39(1):457-469. doi: 10.1002/tox.23993. Click
17 Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction. Cell Oncol (Dordr). 2021 Feb;44(1):135-150. doi: 10.1007/s13402-020-00557-x. Click
It has been None visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP