TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Cyclin-A2
UniProt ID CCNA2_HUMAN
Gene Name CCNA2
Gene ID 890
Synonyms
CCNA2, CCN1, CCNA
Sequence
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRG
LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKI
EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNL
Pathway Map MAP LINK
KEGG ID hsa890
TTD ID T58470
Pfam PF00134; PF02984; PF16500
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 272
Pair Name Deoxyelephantopin, Cisplatin
Phytochemical Name Deoxyelephantopin
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result The CP and DET combination may be an effective intervention for melanoma with reduced side effects.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 432
Pair Name [6]-Gingerol, Cisplatin
Phytochemical [6]-Gingerol
Drug Cisplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result [6]-Gingerol enhances the cisplatin sensitivity of gastric cancer cells through inhibition of proliferation and invasion via PI3K/AKT signaling pathway
Combination Pair ID: 567
Pair Name 2,3,5,6-Tetramethylpyrazine, Doxorubicin
Phytochemical 2,3,5,6-Tetramethylpyrazine
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result DLJ14 and Adr combination treatment may inhibit proliferation of Adr-resistant human breast cancer cells through inhibition of the EGFR/PI3K/Akt survival pathway and induction of apoptosis via the mitochondrial-mediated apoptosis pathway.
Combination Pair ID: 232
Pair Name AKBA, Cisplatin
Phytochemical AKBA
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result Acetyl-11-keto-beta-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway
Combination Pair ID: 31
Pair Name Berbamine, Arcyriaflavin A
Phytochemical Berbamine
Drug Arcyriaflavin A
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells.
Combination Pair ID: 435
Pair Name Garcinol, Paclitaxel
Phytochemical Garcinol
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model
Combination Pair ID: 133
Pair Name Kurarinone, TNF-related apoptosis inducing ligand
Phytochemical Kurarinone
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result Kurarinone Synergizes TRAIL-Induced Apoptosis in Gastric Cancer Cells
Combination Pair ID: 64
Pair Name Luteolin, Oxaliplatin
Phytochemical Luteolin
Drug Oxaliplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis
Combination Pair ID: 367
Pair Name Polydatin, Paclitaxel
Phytochemical Polydatin
Drug Paclitaxel
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result Polydatin may enhance the chemosensitivity of osteosarcoma cells to paclitaxel.
Combination Pair ID: 813
Pair Name Resveratrol, Cisplatin
Phytochemical Resveratrol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result Resveratrol Enhances Cytotoxic Effects of Cisplatin by Inducing Cell Cycle Arrest and Apoptosis in Ovarian Adenocarcinoma SKOV-3 Cells through Activating the p38 MAPK and Suppressing AKT
Combination Pair ID: 460
Pair Name Shogaol, Fluorouracil
Phytochemical Shogaol
Drug Fluorouracil
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result Influence of 6-shogaol potentiated on 5-fluorouracil treatment of liver cancer by promoting apoptosis and cell cycle arrest by regulating AKT/mTOR/MRP1 signalling
Combination Pair ID: 654
Pair Name Silibinin, Trichostatin A
Phytochemical Silibinin
Drug Trichostatin A
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result Combination of HDAC inhibitor TSA and silibinin induces cell cycle arrest and apoptosis by targeting survivin and cyclinB1/Cdk1 in pancreatic cancer cells
Combination Pair ID: 549
Pair Name Sulforaphane, Everolimus
Phytochemical Sulforaphane
Drug Everolimus
Disease Info [ICD-11: 2C94] Bladder cancer Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result The addition of SFN to the long-term everolimus application inhibits resistance development in bladder cancer cells in vitro. Therefore, sulforaphane may hold potential for treating bladder carcinoma in patients with resistance to an mTOR inhibitor.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 106
Pair Name Liquiritin, Cisplatin
Phytochemical Liquiritin
Drug Cisplatin
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Down-regulation Cyclin-A2 Expression
Result Liquiritin induces apoptosis and autophagy in cisplatin (DDP)-resistant gastric cancer cells in vitro and xenograft nude mice in vivo
03. Reference
No. Title Href
1 Phyto-sesquiterpene lactone deoxyelephantopin and cisplatin synergistically suppress lung metastasis of B16 melanoma in mice with reduced nephrotoxicity. Phytomedicine. 2019 Mar 15;56:194-206. doi: 10.1016/j.phymed.2018.11.005. Click
2 [6]-Gingerol enhances the cisplatin sensitivity of gastric cancer cells through inhibition of proliferation and invasion via PI3K/AKT signaling pathway. Phytother Res. 2019 May;33(5):1353-1362. doi: 10.1002/ptr.6325. Click
3 Combination treatment of ligustrazine piperazine derivate DLJ14 and adriamycin inhibits progression of resistant breast cancer through inhibition of the EGFR/PI3K/Akt survival pathway and induction of apoptosis. Drug Discov Ther. 2014 Feb;8(1):33-41. doi: 10.5582/ddt.8.33. Click
4 Acetyl-11-keto-β-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway. Cell Biol Toxicol. 2021 Apr;37(2):209-228. doi: 10.1007/s10565-020-09541-5. Click
5 Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. Click
6 Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. Click
7 Kurarinone Synergizes TRAIL-Induced Apoptosis in Gastric Cancer Cells. Cell Biochem Biophys. 2015 May;72(1):241-9. doi: 10.1007/s12013-014-0444-0. Click
8 Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis. Oncol Lett. 2022 Jan;23(1):16. doi: 10.3892/ol.2021.13134. Click
9 Polydatin enhances the chemosensitivity of osteosarcoma cells to paclitaxel. J Cell Biochem. 2019 Oct;120(10):17481-17490. doi: 10.1002/jcb.29012. Click
10 Resveratrol Enhances Cytotoxic Effects of Cisplatin by Inducing Cell Cycle Arrest and Apoptosis in Ovarian Adenocarcinoma SKOV-3 Cells through Activating the p38 MAPK and Suppressing AKT. Pharmaceuticals (Basel). 2023 May 17;16(5):755. doi: 10.3390/ph16050755. Click
11 Influence of 6-shogaol potentiated on 5-fluorouracil treatment of liver cancer by promoting apoptosis and cell cycle arrest by regulating AKT/mTOR/MRP1 signalling. Chin J Nat Med. 2022 May;20(5):352-363. doi: 10.1016/S1875-5364(22)60174-2. Click
12 Combination of HDAC inhibitor TSA and silibinin induces cell cycle arrest and apoptosis by targeting survivin and cyclinB1/Cdk1 in pancreatic cancer cells. Biomed Pharmacother. 2015 Aug;74:257-64. doi: 10.1016/j.biopha.2015.08.017. Click
13 Chronic Sulforaphane Administration Inhibits Resistance to the mTOR-Inhibitor Everolimus in Bladder Cancer Cells. Int J Mol Sci. 2020 Jun 4;21(11):4026. doi: 10.3390/ijms21114026. Click
14 Liquiritin induces apoptosis and autophagy in cisplatin (DDP)-resistant gastric cancer cells in vitro and xenograft nude mice in vivo. Int J Oncol. 2017 Nov;51(5):1383-1394. doi: 10.3892/ijo.2017.4134. Click
It has been 168176 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP