| Name | Zinc finger protein SNAI2 | ||
| UniProt ID | SNAI2_HUMAN | ||
| Gene Name | SNAI2 | ||
| Gene ID | 6591 | ||
| Synonyms |
SNAI2, SLUG, SLUGH, SLUGH1, SNAIL2, WS2D
|
||
| Sequence |
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT
TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK YQCKNCSKTFSRMSLLHKHEESGCCVAH |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa6591 | ||
| Pfam | PF00096; PF02892; PF04606; PF05605; PF09723; PF12171; PF12874; PF13465; PF13894; PF13912; PF13913; PF15961; PF16278 | ||
| Pair Name | Beta-Elemene, Cetuximab | |||
| Phytochemical | Beta-Elemene | |||
| Drug | Cetuximab | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Zinc finger protein SNAI2 | Expression | |
| Result | natural product β-elemene is a new ferroptosis inducer and combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant CRC cells by inducing ferroptosis and inhibiting EMT, which will hopefully provide a prospective strategy for CRC patients with RAS mutations. | |||
| Pair Name | Fisetin, Sorafenib | |||
| Phytochemical | Fisetin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
| Regulate Info | Down-regulation | Zinc finger protein SNAI2 | Expression | |
| Result | Our findings demonstrate that fisetin potentiates the anti-invasive and anti-metastatic effects of sorafenib. Our data suggest that fisetin may be a worthy adjuvant chemotherapy for the management of melanoma. | |||
| Pair Name | Lupeol, Fluorouracil | |||
| Phytochemical | Lupeol | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Zinc finger protein SNAI2 | Expression | |
| Result | These data lay the foundation for the clinical validation of this combination therapy for TNBC patients. | |||
| Pair Name | Neferine, Vitamin D3 | |||
| Phytochemical | Neferine | |||
| Drug | Vitamin D3 | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Zinc finger protein SNAI2 | Expression | |
| Result | These data suggest that neferine enhances the anticancer capability of VD3 and reduces the dose dependency of VD3. The combination of vitamin D with neferine appears to be a potential therapeutic strategy for CRC. | |||
| Pair Name | Sclareolide, Gemcitabine | |||
| Phytochemical | Sclareolide | |||
| Drug | Gemcitabine | |||
| Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
| Regulate Info | Down-regulation | Zinc finger protein SNAI2 | Expression | |
| Result | Sclareolide enhances gemcitabine‑induced cell death through mediating the NICD and Gli1 pathways in gemcitabine‑resistant human pancreatic cancer | |||
| Pair Name | Shikonin, Temozolomide | |||
| Phytochemical | Shikonin | |||
| Drug | Temozolomide | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | Zinc finger protein SNAI2 | Expression | |
| Result | From our results we conclude that dual treatment with SHK and TMZ may constitute a powerful new tool for GBM treatment by reducing therapy resistance and tumor recurrence. | |||
| Pair Name | Shogaol, Gefitinib | |||
| Phytochemical | Shogaol | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2C73] | Ovarian Cancer | Investigative | |
| Regulate Info | Down-regulation | Zinc finger protein SNAI2 | Expression | |
| Result | Our results suggest that 6-shogaol exerts a potential anti-cancer effect in ovarian cancer and combination treatment with 6-shogaol and gefitinib may provide a novel anti-tumor therapeutic strategy in gefitinib-resistant ovarian cancer. | |||
| Pair Name | Sulforaphane, Cisplatin | |||
| Phytochemical | Sulforaphane | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Zinc finger protein SNAI2 | Expression | |
| Result | The results of the current study suggests that CIS when supplemented with SFN, inhibits metastasis and stemness potential of TNBC cells by down regulating SIRTs-mediated EMT cascade. Overall this study affirms that, this novel combination could be a promising strategy against SIRT-mediated TNBC metastasis and CIS-resistance. | |||
| Pair Name | Oxymatrine, Fluorouracil | |||
| Phytochemical | Oxymatrine | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Zinc finger protein SNAI2 | Expression | |
| Result | Oxymatrine reverses 5-fluorouracil resistance by inhibition of colon cancer cell epithelial-mesenchymal transition and NF-kappa B signaling in vitro | |||
| No. | Title | Href |
|---|---|---|
| 1 | Combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant colorectal cancer cells by inducing ferroptosis and inhibiting epithelial-mesenchymal transformation. Theranostics. 2020;10(11):5107-5119. Published 2020 Apr 6. doi:10.7150/thno.44705 | Click |
| 2 | Fisetin, a dietary flavonoid, augments the anti-invasive and anti-metastatic potential of sorafenib in melanoma. Oncotarget. 2016 Jan 12;7(2):1227-41. doi: 10.18632/oncotarget.6237. | Click |
| 3 | Lupeol synergizes with 5-fluorouracil to combat c-MET/EphA2 mediated chemoresistance in triple negative breast cancer. iScience. 2023 Nov 4;26(12):108395. doi: 10.1016/j.isci.2023.108395. | Click |
| 4 | Combined effects of vitamin D and neferine on the progression and metastasis of colorectal cancer. J Cancer Res Clin Oncol. 2023 Aug;149(9):6203-6210. doi: 10.1007/s00432-022-04552-7. | Click |
| 5 | Sclareolide enhances gemcitabine‑induced cell death through mediating the NICD and Gli1 pathways in gemcitabine‑resistant human pancreatic cancer. Mol Med Rep. 2017 Apr;15(4):1461-1470. doi: 10.3892/mmr.2017.6182. | Click |
| 6 | Dual treatment with shikonin and temozolomide reduces glioblastoma tumor growth, migration and glial-to-mesenchymal transition. Cell Oncol (Dordr). 2017 Jun;40(3):247-261. doi: 10.1007/s13402-017-0320-1. | Click |
| 7 | 6-Shogaol Overcomes Gefitinib Resistance via ER Stress in Ovarian Cancer Cells. Int J Mol Sci. 2023 Jan 30;24(3):2639. doi: 10.3390/ijms24032639. | Click |
| 8 | Sulforaphane-cisplatin combination inhibits the stemness and metastatic potential of TNBCs via down regulation of sirtuins-mediated EMT signaling axis. Phytomedicine. 2021 Apr;84:153492. doi: 10.1016/j.phymed.2021.153492. | Click |
| 9 | Oxymatrine reverses 5-fluorouracil resistance by inhibition of colon cancer cell epithelial-mesenchymal transition and NF-κB signaling in vitro. Oncol Lett. 2020 Jan;19(1):519-526. doi: 10.3892/ol.2019.11090. | Click |
