Name | Prostaglandin G/H synthase 2 | ||
UniProt ID | PGH2_HUMAN | ||
Gene Name | PTGS2 | ||
Gene ID | 5743 | ||
Synonyms |
PTGS2, COX-2, COX2, GRIPGHS, PGG/HS, PGHS-2, PHS-2, hCox-2
|
||
Sequence |
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER STEL |
||
Pathway Map | MAP LINK | ||
T.C. Number | 3.A.3.1.1 | ||
KEGG ID | hsa5743 | ||
TTD ID | T66665 | ||
Pfam | PF00008; PF03098 |
Pair Name | Juglone, Indomethacin | |||
Phytochemical Name | Juglone | |||
Anticancer drug Name | Indomethacin | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Prostaglandin G/H synthase 2 | Expression | |
Result | IND and JUG reduce the inflammatory activity and induce apoptotic cell death, while JUG effectively prevents IND induced gastric ulceration. These findings establish that a combination of IND + JUG may serve as a promising treatment regimen for colon cancer. |
Pair Name | Chebulagic acid, Doxorubicin | |||
Phytochemical | Chebulagic acid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Prostaglandin G/H synthase 2 | Expression | |
Result | The present study shows the efficacy of CA to overcome MDR-1 mediated drug resistance in HepG2 cells through COX-2 dependant modulation of MDR-1. |
Pair Name | Curcumin, Celecoxib | |||
Phytochemical | Curcumin | |||
Drug | Celecoxib | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Prostaglandin G/H synthase 2 | Expression | |
Result | Our findings show the prominent anti-proliferative effects of celecoxib and/or curcumin on MDA-MB-231 cells, providing a rationale for further detailed preclinical and potential clinical studies of this combination for breast cancer therapy. Further, these computed parameters suggested that curcumin possesses a high tendency to act as an adjuvant drug with celecoxib in the treatment of breast cancer. |
Pair Name | Eugenol, Cisplatin | |||
Phytochemical | Eugenol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | Prostaglandin G/H synthase 2 | Expression | |
Result | Eugenol showed antiproliferative and cytotoxic effects via apoptosis and also synergism with cisplatin and ionizing radiation in the human cervical cancer cell line. |
Pair Name | Garcinol, Paclitaxel | |||
Phytochemical | Garcinol | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Prostaglandin G/H synthase 2 | Expression | |
Result | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model |
Pair Name | Glucosinalbate, Doxorubicin | |||
Phytochemical | Glucosinalbate | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C90] | Ehrlich ascites carcinoma | Investigative | |
Regulate Info | Down-regulation | Prostaglandin G/H synthase 2 | Expression | |
Result | The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host. |
Pair Name | Hexahydrocurcumin, Fluorouracil | |||
Phytochemical | Hexahydrocurcumin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Prostaglandin G/H synthase 2 | Expression | |
Result | The combined effects of HHC with 5-FU exhibit a synergistic inhibition by decreasing ACF formation mediated by down-regulation of COX-2 expression. |
Pair Name | Hexahydrocurcumin, Fluorouracil | |||
Phytochemical | Hexahydrocurcumin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Prostaglandin G/H synthase 2 | Expression | |
Result | HHC together with 5-FU exerts a synergistic effect and may prove chemotherapeutically useful in treating human colon cancer. |
Pair Name | Juglone, Indomethacin | |||
Phytochemical | Juglone | |||
Drug | Indomethacin | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Prostaglandin G/H synthase 2 | Expression | |
Result | A combination of both was shown to be more effective, suggesting that juglone may be considered for therapeutic intervention of colon cancer. |
Pair Name | Parthenolide, Balsalazide | |||
Phytochemical | Parthenolide | |||
Drug | Balsalazide | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Prostaglandin G/H synthase 2 | Expression | |
Result | These results demonstrate that parthenolide potentiates the efficacy of balsalazide through synergistic inhibition of NF-κB activation and the combination of dual agents prevents colon carcinogenesis from chronic inflammation. |
Pair Name | Tectochrysin, Cetuximab | |||
Phytochemical | Tectochrysin | |||
Drug | Cetuximab | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Prostaglandin G/H synthase 2 | Expression | |
Result | Our results indicate that combined therapy with lower concentration of cetuximab and tectochrysin could significantly enhance the cancer cell growth inhibitory effect through the inhibition of EGFR signaling. |
Pair Name | Tetrahydrocurcumin, Celecoxib | |||
Phytochemical | Tetrahydrocurcumin | |||
Drug | Celecoxib | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | Prostaglandin G/H synthase 2 | Expression | |
Result | The combinational treatment effect of THC and celecoxib causing inhibition of tumor growth and tumor angiogenesis via down-regulation of VEGF, COX-2 and EGFR expression. However, this combined treatment did not show the synergistic effect on inhibiting the tumor growth and tumor angiogenesis in cervical cancer (CaSki)-implanted nude mice model. |
No. | Title | Href |
---|---|---|
1 | Effects of combined treatment with Indomethacin and Juglone on AOM/DSS induced colon carcinogenesis in Balb/c mice: Roles of inflammation and apoptosis. Life Sci. 2021 Jan 1;264:118657. doi: 10.1016/j.lfs.2020.118657. | Click |
2 | Chebulagic acid synergizes the cytotoxicity of doxorubicin in human hepatocellular carcinoma through COX-2 dependant modulation of MDR-1. Med Chem. 2011 Sep;7(5):432-42. doi: 10.2174/157340611796799087. | Click |
3 | Curcumin-Celecoxib: a synergistic and rationale combination chemotherapy for breast cancer. Eur Rev Med Pharmacol Sci. 2021 Feb;25(4):1916-1927. doi: 10.26355/eurrev_202102_25086. | Click |
4 | Eugenol Exerts Apoptotic Effect and Modulates the Sensitivity of HeLa Cells to Cisplatin and Radiation. Molecules. 2019 Nov 3;24(21):3979. doi: 10.3390/molecules24213979. | Click |
5 | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. | Click |
6 | Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. | Click |
7 | Effects of hexahydrocurcumin in combination with 5-fluorouracil on dimethylhydrazine-induced colon cancer in rats. World J Gastroenterol. 2012 Dec 21;18(47):6951-9. doi: 10.3748/wjg.v18.i47.6951. | Click |
8 | Hexahydrocurcumin enhances inhibitory effect of 5-fluorouracil on HT-29 human colon cancer cells. World J Gastroenterol. 2012 May 21;18(19):2383-9. doi: 10.3748/wjg.v18.i19.2383. | Click |
9 | Indomethacin and juglone inhibit inflammatory molecules to induce apoptosis in colon cancer cells. J Biochem Mol Toxicol. 2020 Feb;34(2):e22433. doi: 10.1002/jbt.22433. | Click |
10 | Combined Parthenolide and Balsalazide Have Enhanced Antitumor Efficacy Through Blockade of NF-κB Activation. Mol Cancer Res. 2017 Feb;15(2):141-151. doi: 10.1158/1541-7786.MCR-16-0101. | Click |
11 | Synergistic inhibitory effect of cetuximab and tectochrysin on human colon cancer cell growth via inhibition of EGFR signal. Arch Pharm Res. 2016 May;39(5):721-9. doi: 10.1007/s12272-016-0735-7. | Click |
12 | Combinational Treatment Effect of Tetrahydrocurcumin and Celecoxib on Cervical Cancer Cell-Induced Tumor Growth and Tumor Angiogenesis in Nude Mice. J Med Assoc Thai. 2016 Jul;99 Suppl 4:S23-31. | Click |