| Name | Interleukin-6 | ||
| UniProt ID | IL6_HUMAN | ||
| Gene Name | IL6 | ||
| Gene ID | 3569 | ||
| Synonyms |
IL6, BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2, IFNB2, IL-6
|
||
| Sequence |
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.A.1.2.5; 1.A.77.1.10 | ||
| KEGG ID | hsa3569 | ||
| TTD ID | T32578 | ||
| Pfam | PF00489; PF02899; PF07400; PF16647; PF16649 | ||
| Pair Name | Acteoside, Thymic stromal lymphopoietin | |||
| Phytochemical Name | Acteoside | |||
| Anticancer drug Name | Thymic stromal lymphopoietin | |||
| Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
| Regulate Info | Down-regulation | Interleukin-6 | Expression | |
| Result | These results indicate that acteoside is a specific regulator of MDM2 activation in TSLP-stimulated mast cells, which indicates its potential use for the treatment of mast cell-mediated inflammatory diseases. | |||
| Pair Name | Aloin, Doxorubicin | |||
| Phytochemical Name | Aloin | |||
| Anticancer drug Name | Doxorubicin | |||
| Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
| Regulate Info | Down-regulation | Interleukin-6 | Expression | |
| Result | Our results highlight the necessity to further investigate the chemopreventive effects of aloin against other chemotherapeutic agents. | |||
| Pair Name | Carvacrol, Sorafenib | |||
| Phytochemical Name | Carvacrol | |||
| Anticancer drug Name | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Interleukin-6 | Expression | |
| Result | CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC. | |||
| Pair Name | Ilexgenin A, Sorafenib | |||
| Phytochemical Name | Ilexgenin A | |||
| Anticancer drug Name | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Interleukin-6 | Expression | |
| Result | The results described in the present study identifies Ilexgenin A as a promising therapeutic candidate that modulates inflammation, angiogenesis, and HCC growth. | |||
| Pair Name | Resveratrol, Cisplatin | |||
| Phytochemical Name | Resveratrol | |||
| Anticancer drug Name | Cisplatin | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | Interleukin-6 | Expression | |
| Result | Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest | |||
| Pair Name | Usnic acid, Bleomycin | |||
| Phytochemical Name | Usnic acid | |||
| Anticancer drug Name | Bleomycin | |||
| Disease Info | [ICD-11: 2F94] | Ascitic tumor | Investigative | |
| Regulate Info | Up-regulation | Interleukin-6 | Expression | |
| Result | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin | |||
| Pair Name | Astaxanthin, Cytarabine | |||
| Phytochemical | Astaxanthin | |||
| Drug | Cytarabine | |||
| Disease Info | [ICD-11: 2B33.3] | Acute lymphoblastic leukemia | Investigative | |
| Regulate Info | Down-regulation | Interleukin-6 | Expression | |
| Result | Co-treatment of ASX and Ara-C has synergism effects on apoptosis pathways, cell proliferation inhibition, and decreased inflammation. | |||
| Pair Name | Caffeic acid phenethyl ester, Bortezomib | |||
| Phytochemical | Caffeic acid phenethyl ester | |||
| Drug | Bortezomib | |||
| Disease Info | [ICD-11: 2A83] | Multiple myeloma | Investigative | |
| Regulate Info | Down-regulation | Interleukin-6 | Expression | |
| Result | We think that our study, which is the first to demonstrate the in vitro and in vivo effectiveness of the.combined use of CAPE and bortezomib, will be a pioneer for future human applications of CAPE in MM. | |||
| Pair Name | Codonopsis pilosula polysaccharide, Dacarbazine | |||
| Phytochemical | Codonopsis pilosula polysaccharide | |||
| Drug | Dacarbazine | |||
| Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
| Regulate Info | Up-regulation | Interleukin-6 | Expression | |
| Result | It could be deduced that GLCP, CPCP and dCPP hold great potential as safe therapeutic options for melanoma and an immune-modulator which may require further exploration. | |||
| Pair Name | Glucosinalbate, Doxorubicin | |||
| Phytochemical | Glucosinalbate | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C90] | Ehrlich ascites carcinoma | Investigative | |
| Regulate Info | Down-regulation | Interleukin-6 | Expression | |
| Result | The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host. | |||
| Pair Name | Hyperoside, Paclitaxel | |||
| Phytochemical | Hyperoside | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Interleukin-6 | Expression | |
| Result | Hyperoside may elevate breast cancer cell sensitivity to paclitaxel by blocking TLR4 activation-mediated pro-inflammatory and pro-survival approaches, thereby endorsing its usefulness as a promising therapeutic combination to overcome chemosensitivity in breast cancer. | |||
| Pair Name | Quercetin, Anti-PD-1 antibody | |||
| Phytochemical | Quercetin | |||
| Drug | Anti-PD-1 antibody | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Interleukin-6 | Expression | |
| Result | Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity. | |||
| Pair Name | Thymoquinone, Bortezomib | |||
| Phytochemical | Thymoquinone | |||
| Drug | Bortezomib | |||
| Disease Info | [ICD-11: 2A85.5] | Mantle cell lymphoma | Investigative | |
| Regulate Info | Down-regulation | Interleukin-6 | Expression | |
| Result | Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-KappaB regulated gene products in multiple myeloma xenograft mouse model | |||
| No. | Title | Href |
|---|---|---|
| 1 | Acteoside attenuates TSLP-induced mast cell proliferation via down-regulating MDM2. Int Immunopharmacol. 2015 May;26(1):23-9. doi: 10.1016/j.intimp.2015.03.003. | Click |
| 2 | Aloin alleviates doxorubicin-induced cardiotoxicity in rats by abrogating oxidative stress and pro-inflammatory cytokinesAloin alleviates doxorubicin-induced cardiotoxicity in rats by abrogating oxidative stress and pro-inflammatory cytokines. Cancer Chemother Pharmacol. 2020 Sep;86(3):419-426. doi: 10.1007/s00280-020-04125-w. | Click |
| 3 | Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. | Click |
| 4 | Ilexgenin A exerts anti-inflammation and anti-angiogenesis effects through inhibition of STAT3 and PI3K pathways and exhibits synergistic effects with Sorafenib on hepatoma growth. Toxicol Appl Pharmacol. 2017 Jan 15;315:90-101. doi: 10.1016/j.taap.2016.12.008. | Click |
| 5 | Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest. Front Pharmacol. 2023;13:1068863. Published 2023 Jan 4. doi:10.3389/fphar.2022.1068863. | Click |
| 6 | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. | Click |
| 7 | Astaxanthin decreases the growth-inhibitory dose of cytarabine and inflammatory response in the acute lymphoblastic leukemia cell line NALM-6. Mol Biol Rep. 2022 Jul;49(7):6415-6422. doi: 10.1007/s11033-022-07452-8. | Click |
| 8 | An in vitro and in vivo investigation of the cytotoxic effects of caffeic acid (3,4-dihydroxycinnamic acid) phenethyl ester and bortezomib in multiple myeloma cells. Turk J Med Sci. 2015;45(1):38-46. doi: 10.3906/sag-1401-127. | Click |
| 9 | Codonopsis pilosula polysaccharide in synergy with dacarbazine inhibits mouse melanoma by repolarizing M2-like tumor-associated macrophages into M1-like tumor-associated macrophages. Biomed Pharmacother. 2021;142:112016. doi:10.1016/j.biopha.2021.112016 | Click |
| 10 | Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. | Click |
| 11 | Administration with hyperoside sensitizes breast cancer cells to paclitaxel by blocking the TLR4 signaling. Mol Cell Probes. 2020 Oct;53:101602. doi: 10.1016/j.mcp.2020.101602. | Click |
| 12 | Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. | Click |
| 13 | Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-κB regulated gene products in multiple myeloma xenograft mouse model. Oncotarget. 2014 Feb 15;5(3):634-48. doi: 10.18632/oncotarget.1596. | Click |
