TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Hypoxia-inducible factor 1-alpha
UniProt ID HIF1A_HUMAN
Gene Name HIF1A
Gene ID 3091
Synonyms
HIF1A, HIF-1-alpha, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78
Sequence
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYR
DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR
KMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLAC
RLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Pathway Map MAP LINK
T.C. Number 8.A.92.1.4
KEGG ID hsa3091
TTD ID T55610
Pfam PF00010; PF00989; PF08447; PF08448; PF08778; PF09756; PF11413; PF13426; PF14598
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 1025
Pair Name Lupeol, Paclitaxel
Phytochemical Name Lupeol
Anticancer drug Name Paclitaxel
Disease Info [ICD-11: 2B66.0] Oral squamous cell carcinoma Investigative
Regulate Info Down-regulation Hypoxia-inducible factor 1-alpha Expression
Result Our findings elucidated mechanistic underpinning of hypoxia induced Laminin-5γ2 driven VM formation highlighting that Lupeol-Paclitaxel combination may serve as novel therapeutic intervention in perturbation of VM in human OSCC.
Combination Pair ID: 366
Pair Name Polydatin, 2-Deoxy-d-glucose
Phytochemical Name Polydatin
Anticancer drug Name 2-Deoxy-d-glucose
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Hypoxia-inducible factor 1-alpha Expression
Result Our study demonstrates that PD synergised with 2-DG to enhance its anti-cancer efficacy by inhibiting the ROS/PI3K/AKT/HIF-1α/HK2 signalling axis, providing a potential anti-cancer strategy.
Combination Pair ID: 429
Pair Name Carvacrol, Sorafenib
Phytochemical Name Carvacrol
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Hypoxia-inducible factor 1-alpha Expression
Result CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 77
Pair Name Apigenin, Gefitinib
Phytochemical Apigenin
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Hypoxia-inducible factor 1-alpha Expression
Result Apigenin Combined With Gefitinib Blocks Autophagy Flux and Induces Apoptotic Cell Death Through Inhibition of HIF-1α, c-Myc, p-EGFR, and Glucose Metabolism in EGFR L858R+T790M-Mutated H1975 Cells
Combination Pair ID: 680
Pair Name Ursolic acid, Cisplatin
Phytochemical Ursolic acid
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Hypoxia-inducible factor 1-alpha Expression
Result UA inhibits the proliferation and reversal of drug resistance in ovarian CSCs by suppressing the expression of downregulation of HIF-1α and ABCG2.
Combination Pair ID: 1015
Pair Name Astaxanthin, Sorafenib
Phytochemical Astaxanthin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Hypoxia-inducible factor 1-alpha Expression
Result Astaxanthin Augmented the Anti-Hepatocellular Carcinoma Efficacy of Sorafenib Through the Inhibition of the JAK2/STAT3 Signaling Pathway and Mitigation of Hypoxia within the Tumor Microenvironment
Combination Pair ID: 210
Pair Name Rhizoma Paridis saponins, Sorafenib
Phytochemical Rhizoma Paridis saponins
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Hypoxia-inducible factor 1-alpha Expression
Result All of that provided possibility to overcome the intolerance of sorafenib by drug compatibility through protection against mitochondria damage, inhibition of anaerobic glycolysis and suppression of lipid synthesis based on PI3K/Akt/mTOR pathway.
Combination Pair ID: 268
Pair Name Curcumenol, Cisplatin
Phytochemical Curcumenol
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Down-regulation Hypoxia-inducible factor 1-alpha Expression
Result Curcumenol can enhance cisplatin to inhibit cancer cell proliferation, migration, and invasion and promote tumor cell apoptosis. The combination of drugs may promote the apoptosis of cervical cancer cells through the YWHAG pathway.
Combination Pair ID: 757
Pair Name Thymoquinone, Gemcitabine
Phytochemical Thymoquinone
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Hypoxia-inducible factor 1-alpha Expression
Result TQ can promote apoptosis, inhibit migration, invasion, and metastasis, and enhance the sensitivity to GEM. The underlying mechanism may involve the regulation of ECM production through the TGFβ/Smad pathway, in which HIF-1α plays a key role.
Combination Pair ID: 803
Pair Name Pterostilbene, Vorinostat
Phytochemical Pterostilbene
Drug Vorinostat
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Hypoxia-inducible factor 1-alpha Expression
Result Our study provides preclinical evidence that Pter/SAHA combination treatment inhibits MTA1/HIF-1α tumor-promoting signaling in PCa. The beneficial outcome of combinatorial strategy using a natural agent and an approved drug for higher efficacy and less toxicity supports further development of MTA1-targeted therapies in PCa.
Combination Pair ID: 812
Pair Name Resveratrol, Sorafenib
Phytochemical Resveratrol
Drug Sorafenib
Disease Info [ICD-11: 2C90.0] Renal cell carcinoma Investigative
Regulate Info Down-regulation Hypoxia-inducible factor 1-alpha Expression
Result PEGylated resveratrol combined with sorafenib can achieve synergistic anti-RCC activity, and the mechanism may be related to the inhibition of Akt/mTOR/p70S6k-4EBP-1 and c-Raf7MEK/ERK signaling pathways.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 229
Pair Name Tanshinone I, Epirubicin
Phytochemical Tanshinone I
Drug Epirubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Hypoxia-inducible factor 1-alpha Expression
Result Our results suggested that Tan I could effectively improve the anti-tumor effect of EADM, and synergize EADM to reverse HIF-1α mediated resistance via targeting PI3K/AKT/HIF-1α signaling pathway.
03. Reference
No. Title Href
1 Lupeol and Paclitaxel cooperate in hindering hypoxia induced vasculogenic mimicry via suppression of HIF-1α-EphA2-Laminin-5γ2 network in human oral cancer. J Cell Commun Signal. 2023 Sep;17(3):591-608. doi: 10.1007/s12079-022-00693-z. Click
2 Targeting the ROS/PI3K/AKT/HIF-1α/HK2 axis of breast cancer cells: Combined administration of Polydatin and 2-Deoxy-d-glucose. J Cell Mol Med. 2019 May;23(5):3711-3723. doi: 10.1111/jcmm.14276. Click
3 Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. Click
4 Apigenin Combined With Gefitinib Blocks Autophagy Flux and Induces Apoptotic Cell Death Through Inhibition of HIF-1α, c-Myc, p-EGFR, and Glucose Metabolism in EGFR L858R+T790M-Mutated H1975 Cells. Front Pharmacol. 2019 Mar 22;10:260. doi: 10.3389/fphar.2019.00260. Click
5 Ursolic acid inhibits proliferation and reverses drug resistance of ovarian cancer stem cells by downregulating ABCG2 through suppressing the expression of hypoxia-inducible factor-1α in vitro. Oncol Rep. 2016 Jul;36(1):428-40. doi: 10.3892/or.2016.4813. Click
6 Astaxanthin Augmented the Anti-Hepatocellular Carcinoma Efficacy of Sorafenib Through the Inhibition of the JAK2/STAT3 Signaling Pathway and Mitigation of Hypoxia within the Tumor Microenvironment. Mol Nutr Food Res. 2024 Jan;68(2):e2300569. doi: 10.1002/mnfr.202300569. Click
7 Combinatorial treatment of Rhizoma Paridis saponins and sorafenib overcomes the intolerance of sorafenib. J Steroid Biochem Mol Biol. 2018 Oct;183:159-166. doi: 10.1016/j.jsbmb.2018.06.010. Click
8 Curcumenol Targeting YWHAG Inhibits the Pentose Phosphate Pathway and Enhances Antitumor Effects of Cisplatin. Evid Based Complement Alternat Med. 2022 Jun 26;2022:3988916. doi: 10.1155/2022/3988916. Click
9 Thymoquinone affects the gemcitabine sensitivity of pancreatic cancer by regulating collagen via hypoxia inducible factor-1α. Front Pharmacol. 2023 May 31;14:1138265. doi: 10.3389/fphar.2023.1138265. Click
10 Targeting MTA1/HIF-1α signaling by pterostilbene in combination with histone deacetylase inhibitor attenuates prostate cancer progression. Cancer Med. 2017 Nov;6(11):2673-2685. doi: 10.1002/cam4.1209. Click
11 Synergistic anti-tumour activity of sorafenib in combination with pegylated resveratrol is mediated by Akt/mTOR/p70S6k-4EBP-1 and c-Raf7MEK/ERK signaling pathways. Heliyon. 2023 Aug 19;9(8):e19154. doi: 10.1016/j.heliyon.2023.e19154. Click
12 Combined Treatment of Tanshinone I and Epirubicin Revealed Enhanced Inhibition of Hepatocellular Carcinoma by Targeting PI3K/AKT/HIF-1α. Drug Des Devel Ther. 2022 Sep 19;16:3197-3213. doi: 10.2147/DDDT.S360691. Click
It has been 594054 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP